[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56676.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1cs1A.bssp"
#ERROR : Can't open dsspfile "1cl1A.bssp"
#ERROR : Can't open dsspfile "1ecxA.bssp"
#ERROR : Can't open dsspfile "1qz9A.bssp"
#ERROR : Can't open dsspfile "1fc4A.bssp"
#ERROR : Can't open dsspfile "1mdoA.bssp"
#ERROR : Can't open dsspfile "1b9hA.bssp"
#ERROR : Can't open dsspfile "2fn6A1.bssp"
#ERROR : Can't open dsspfile "1c0nA.bssp"
#ERROR : Can't open dsspfile "3bc8A1.bssp"
#ERROR : Can't open dsspfile "1pmmA.bssp"
#ERROR : Can't open dsspfile "1h0cA.bssp"
#ERROR : Can't open dsspfile "1wytA1.bssp"
#ERROR : Can't open dsspfile "2bwnA1.bssp"
#ERROR : Can't open dsspfile "2aeuA1.bssp"
#ERROR : Can't open dsspfile "1wytB1.bssp"
#ERROR : Can't open dsspfile "2e7iA1.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "1lk9A.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "2cbiA1.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "1c8nA.bssp"
#ERROR : Can't open dsspfile "1m32A.bssp"
#ERROR : Can't open dsspfile "1dtyA.bssp"
#ERROR : Can't open dsspfile "1agxA.bssp"
#ERROR : Can't open dsspfile "1w9gA1.bssp"
#ERROR : Can't open dsspfile "1spvA.bssp"
#ERROR : Can't open dsspfile "1vk9A.bssp"
#ERROR : Can't open dsspfile "1v8dA.bssp"
#ERROR : Can't open dsspfile "1fhlA.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "1jg8A.bssp"

## Summary of PDB Search
:364
    7e-61  40%  1cs1A  [c.67.1.3] PROTEIN (CYSTATHIONINE GAMMA-SYNTHASE)
    9e-36  24%  1cl1A  [c.67.1.3] CYSTATHIONINE BETA-LYASE
    8e-27  11%  1ecxA  [c.67.1.3] AMINOTRANSFERASE
    1e-25  11%  1qz9A  [c.67.1.3] KYNURENINASE
    4e-25  11%  1fc4A  [c.67.1.4] 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE
    2e-24  13%  1mdoA  [c.67.1.4] ARNB AMINOTRANSFERASE
    7e-24  13%  1b9hA  [c.67.1.4] PROTEIN (3-AMINO-5-HYDROXYBENZOIC ACID SYNTHASE)
    1e-22  16%  2fn6A1 [c.67.1.4] AMINOTRANSFERASE A:2 -- 372
    2e-22   9%  1c0nA  [c.67.1.3] PROTEIN (CSDB PROTEIN)
    7e-22  10%  3bc8A1 [c.67.1.9] O-PHOSPHOSERYL-TRNA(SEC) SELENIUM TRANSFERASE
    2e-20   9%  1pmmA  [c.67.1.6] GLUTAMATE DECARBOXYLASE BETA
    2e-20  10%  1h0cA  [c.67.1.3] ALANINE--GLYOXYLATE AMINOTRANSFERASE
    3e-20  13%  1wytA1 [c.67.1.7] GLYCINE DEHYDROGENASE (DECARBOXYLATING) SUBUNIT
    2e-19  11%  2bwnA1 [c.67.1.4] 5-AMINOLEVULINATE SYNTHASE A:2 -- 397
    1e-15  17%  2aeuA1 [c.67.1.8] HYPOTHETICAL PROTEIN MJ0158 A:9 -- 374
    6e-14  18%  1wytB1 [c.67.1.7] GLYCINE DEHYDROGENASE SUBUNIT 2 (P-PROTEIN) B:2
    2e-13  13%  2e7iA1 [c.67.1.9] SEP-TRNA:CYS-TRNA SYNTHASE A:8 -- 371
    9e-13  17%  1lc5A  [c.67.1.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    4e-11  10%  1lk9A  [c.67.1.1] ALLIIN LYASE
    7e-11  11%  1b8gA  [c.67.1.4] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    4e-10  11%  1c7nA  [c.67.1.3] CYSTALYSIN
    8e-10   7%  2cbiA1 [a.246.1.1] HYALURONIDASE A:496 -- 624
    1e-09  10%  1u08A  [c.67.1.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    2e-09  11%  1c8nA  [b.121.4.7] COAT PROTEIN
    3e-08  16%  1m32A  [c.67.1.3] 2-AMINOETHYLPHOSPHONATE-PYRUVATE
    4e-08  10%  1dtyA  [c.67.1.4] ADENOSYLMETHIONINE-8-AMINO-7-OXONONANOATE
    1e-07  11%  1agxA  [c.88.1.1] GLUTAMINASE-ASPARAGINASE
    6e-07   6%  1w9gA1 [d.330.1.1] ENHANCER OF RUDIMENTARY HOMOLOG A:1 -- 103
    5e-06  21%  1spvA  [c.50.1.2] PUTATIVE POLYPROTEIN/PHOSPHATASE
    2e-05   6%  1vk9A  [c.97.1.3] CONSERVED HYPOTHETICAL PROTEIN TM1506
    8e-05   8%  1v8dA  [c.140.1.1] HYPOTHETICAL PROTEIN (TT1679)
    9e-05  16%  1fhlA  [c.1.8.3] BETA-1,4-GALACTANASE
    4e-04  17%  1vp4A  [c.67.1.1] AMINOTRANSFERASE, PUTATIVE
    4e-04  18%  1jg8A  [c.67.1.1] L-ALLO-THREONINE ALDOLASE
:364

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSKELHINTILAQAGIKSDEATGALVTPLHFSTTYQHPEFGRSTGFDYTRTKNPTRSKAEEVLATIESAD
1cs1A           -----KQATIAVRSGLNDDEQYGCVVPPIHLSSTYNFTGFNEPRAHDYSRRGNPTRDVVQRALAELEGGA
1cl1A           ------LDTQLVNAGRSKKYTLGAVNSVIQRASSLVFDSVRANGELFYGRRGTLTHFSLQQAMCELEGGA
1ecxA           ------------------------------------------NSAHGMGIEANLHMEKAREKVAKVLSPS
1qz9A           --------------------------------------EWGNLIRSWNSAGWRDLSERLGNRLATLIGAR
1fc4A           --------------------------------------------SVRFICGTQDSHKELEQKLAAFLGXE
1mdoA           ---------------------------FLPFSRPAXGAAAVKTVLDSGWITTGPKNQELEAAFCRLTGNQ
1b9hA           -------------------------------------------EQGQWWRMGGDEVNSFEREFAAHHGAA
2fn6A1          --------------------------------------------------TQGKRSLLFEEALCEFLGVK
1c0nA           --------VDAVRADFPVLSREVNGLPLAYLDSAQKPSQAVHAGAHTLSAQATEKMENVRKRASLFINAR
3bc8A1          LHELAVMDSNNFLGNCGVGEREGRVASALVRRHYRFIHGIGRQPKAAGSSLLNKITNSLVLNVIKLAGVH
1pmmA           ------------------ENVHKLMDLSINKNWIDKEEYPQSAAIDLADLWHAPAPKNGQAVGTNTIGSS
1h0cA           ----------------------------------------GLQMIGSMSKDMYQIMDEIKEGIQYVRNPL
1wytA1          -----------------------------------------------------------QTMIAELAGLE
2bwnA1          --------------------------------HEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKE
2aeuA1          ------------------------------------------------------------------DEND
1wytB1          ------------------PKLHEEAARLFADLHPYQDPRTAQGA--------LRLMWELGEYLKALTGMD
2e7iA1          -----------------------------------------------------PIHDFIHNQLPKFLGCD
1lc5A           ----------------------------------------------CIERYPDADYFHLHQALARHHQVP
1lk9A           ----------------------------------------------------------------------
1b8gA           ---------------------------------------ALFQDYHGLPAFKKAMVDFMAEIRGNKVDPN
1c7nA           -----------------------------------YLDETVLGYTGPTEEYKKTVKKWMKDRHQWDIQTD
2cbiA1          ----------------------------------------------------------------------
1u08A           ---------------INLSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQKTERLYADS
1c8nA           ----------------------------------------------------NSTVVSNSELILNL----
1m32A           --------------------------------------------DDYNIGVVEQIRQQLTALATASEGYT
1dtyA           -----------------------------LVAMTPQPLECVFLADSGSVAVEVAMKMALQYWDAKGEARD
1agxA           NLVVHTDKPIVLVGSMRPSTALSADGPLNLYSAVALASSNEA-KNKGVMVLMNDSIFAARDVTKGINIHT
1w9gA1          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1vk9A           ----------------------------------------------------------------------
1v8dA           -----------------------------------------------VAVQACEHLNRALVVTARAFGKE
1fhlA           ----------------------------------------------------------------------
1vp4A           -------------------------------------------------------------------DED
1jg8A           ----------------------------------------------------DPTINELERLAAETFGKE


                         .         .         *         .         .         .         .:140
query           YALATSSGMSAIVLAFSGFPVGSKVLAVRDLYGGSFRWFNQVEQEGRFHFTYANTEEELIAELEKDVDVL
1cs1A           GAVLTNTGMSAIHLVTVFLKPGDLLVAPHDCYGGSYRLFDSLAKRGCYRVLFVDQGQALRAALAEKPKLV
1cl1A           GCVLFPCGAAAVANSILAFIQGDHVLMTNTAYEPSQDFCSKILSKLGVSWFDPLIGADIVKHLQPNTKIV
1ecxA           EIFFTSCATESINWILKTVEKRKRTIITTPIEHKAVLETMKYLSMKGFKVKYVPVDSRGVVKLEEDTFLV
1qz9A           DGEVVVTDTTSINLFQATRSPERRVIVTETSNFPTDLYIAEGLADMLQTLRLVDSPEELPQAIDQDTAVV
1fc4A           DAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDXQE-LEARLKEAREAI
1mdoA           YAVAVSSATAGXHIALXALGEGDEVITPSXTWVSTLNXIVLLGANPVXVDVDRDTLXVTPEHIEAAIPQT
1b9hA           HALAVTNGTHALALQVMGVGPGTEVIVPAFTFISSSQAAQRVDVDAA---TYNLDPEAVAAAVTPRTKVI
2fn6A1          HALVFNSATSALLTLYRNFSEFSADRNEIITTPISFVATANMLLESGYTPVFAGIKNDGNIDELALEKLI
1c0nA           SAETTEGINLVANSWGNSNRAGDNIIISQMEHHANIVPWQMLCARVGAELRVIPLNPTLPTLFDAATRLL
3bc8A1          SVAATGMSLTLCFLTLRHKRPKAKYIIWPRIDQKSCFKSMVTAGFEPVVIENRTDLKAVEAKIQELGPCL
1pmmA           EACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELQLFMDPKRMIEACDENTIGV
1h0cA           TLVISGSGHCALEAALVNVEPGDSFLVGANGIWGQRAVDIGERIGVHPPGGHYTLQEVEEGLAQHKPVLL
1wytA1          IANASMYDGATALAEGVLLALREGVLVSQGVHPEYRAVLRAYLEAVGAKLLTLPLEGTPLPEVGEEVGAV
2bwnA1          AALVFSSAYNANDATLSTLRLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELDPAAPKLI
2aeuA1          KCVGFNRTSSAILATILALKPKKVIHYLPELPGHPSI----ERSCKIVNAKYFESDGEILNKIDKDTLVI
1wytB1          AILEPAAGAHGELTGILIEGRTRRVVLVPDSAHGSNPATASMAGYQVREIPSGPEGEALKRELGPHVAAL
2e7iA1          VARVTNGAREAKFAVMHSLKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTDYPDYAITPENFAQVVLA
1lc5A           ASLAGNGETESIFTVASGLK-PRRAMIVTPGFAEYGRALAQSGCEIRRWSLREADTDAILEALTPDLDCL
1lk9A           ----------------------------------------------------------------------
1b8gA           HLVLTAGATSANETFIFCLDPGEAVLIPTPYYPGFDRDLKWRTGVEIVPIHCTSSNYQEAEKRNLRVKGV
1c7nA           WIINTAGVVPAVFNAVREFTPGDGVIIITPVYYPFFMAIKNQERKIIECELLEIDFQKLEKLSKDKNNKA
2cbiA1          ------------------------LWNKLSSKEDASALIEELYGEFARMEEACNNLKNLPEVALEECSRQ
1u08A           DITVTAGATEALYAAITALVRNGDEVICFDPYDSYAPAIALSGGIVKQPPHFRVDWQEFAALLSERTRLV
1c8nA           --TPIALAYTVQSLPLIATQ-PAWLGTIADNYSKWRWVSLRIIYSPKCPTTTSGTLSYDRNDVAPGSRVQ
1m32A           SVLLQGSGSYAVEAVLGSAGPQDKVLIVSNGAYGARGLXGIAHHAYDCGEVARPDVQAIDAILNADPTIS
1dtyA           RFLTFRNGYHGDTFGAMSVCDDNSMHSLWKGYLPENLFAPAPQSRMDWDERDMVGFARLMAAHRHEIAAV
1agxA           HAFVSQWGALGTLVEGKPYWFRSSVKKHNNSEFNIEKIQGDALPGQIVYGSDNMMPDAYQAFAKAGVKAI
1w9gA1          ----------------------------------TILLVQPTKRPEGRTYADYESVNECMEGVCKMYEHL
1spvA           ----------------------------------------------------------------------
1vk9A           --------------------------------------------------------LKIFEKKDLSLLAY
1v8dA           EVAVFPHPKAGGAKATAAFLFRDPVMVESLKAQAHGGMDIGGVLHLRPVAVPLRLSVRKIGEAVLLAALV
1fhlA           ------------------------------YRGADISSLLLLEDEGYSYKNLNGQTQALETILDAGINSI
1vp4A           NLIFTVGSQQALDLIGKLFLDESYCVLDDPAYLGAINAFRQYLANFVVVPLEDDGXFDKNGKIKQVKFIY
1jg8A           AALFVPSGTMGNQVSIMAHQRGDEVILEADSHVGAMAVLSGVMPHPVPGKNGAMDPDDVRKAIRPRTSLI


                         +         .         .         .         .         *         .:210
query           YIETPTNPLMLEFDIEXXXXXXXXXXXXXXXDNTFYSPIYQRPIEDGADIVLHSATKYLAGHNDVLAGVV
1cs1A           LVESPSNPLLRVVDIAKICHLAREVGAVSVVDNTFLSPALQNPLALGADLVLHSCTXYLNGHSDVVAGVV
1cl1A           FLESPGSITMEVHDVPAIVAAVRSVVPDAIIMNTWAAGVLFKALDFGIDVSIQAATXYLVGHSDAMIGTA
1ecxA           SIMAANNEVGTIQPVEDVTRIVKKKNKETLVHVDAVQTIGKIPFKLEVDYASFSAHKFHGPKGVGITYIR
1qz9A           MLTHVNYKTGYMHDMQALTALSHECGALAIWDLAHSAGAVPDLHQAGADYAIGCTYKYLNGGPGSQAFVW
1fc4A           ATDGVFSXDGVIANLKGVCDLADKYDALVXVDENGRGSHEYCDVXGRVDIITGTLGKALGGASGGY--TA
1mdoA           KAIIPVHYAGAPADLDAIYALGERYGIPVIEDAAHATGTSYKGRHIGARGTAIFSFHAIKNITCAEGGIV
1b9hA           MPVHMAG-LMADMDALAKISADTGVPLLQDAAHAHGARWQGKRVGELDSIATFSFQNGKLMTAGEGGAVV
2fn6A1          NERTSVDYAGKSVEVESVQKLCKKHSLSFLSDSSHALGSEYKKVGGFALASVFSFHKPITTA---EGGAV
1c0nA           AITHVSNVLGTENPLAEMITLAHQHGAKVLVDGAQAVMHHVDVQALDCDFYVFSGHKLYGPTGIGILYVK
3bc8A1          HSTTACFAPRVPDRLEELAVICANYDIPHVVNNAYGLLIQQGARVGRIDAFVQSLDXNFMVPVGGAIIAG
1pmmA           VPTFGVTYTGNYEFPQPLHDALDKFQADTGIDAASGGFLAWDFRLPRVKSISASGHKFGLAPLGCG-WVI
1h0cA           FLTHGESSTGVLQPLDGFGELCHRYKCLLLVDSVASLGGTLYMDRQGIDILYSGSQKALNAPPGTSLISF
1wytA1          VVQNPNFLGALE-DLPFAEAAHGAGALFVAVADPLSLGVLKPPGAYGADIAVGDGQSLGLGFGGPHFGFL
2bwnA1          AFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPAERDGLMHRIDIFNGTLAXAYGVFGGYI
2aeuA1          ITGSTMDLKVIELNFKKVINTAKNKEAIVFVDDASGARVQPPALKLGADLVVTSTDKLMEGP---RGGLL
1wytB1          MLTNPNTLGLFERRILEISRLCKEAGVQLYYDNLNAIMGWARPGDMGFDVVHLNLHKTFAHLAPYLPVPL
2e7iA1          LITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEGADFIVGSGHKSMAASGPIGVMGM
1lc5A           FLCTPNNPLPERPLLQAIADRCKSLNINLILDEAFIDFIPHALKDNPHIWVLRSLTKFYAIPGLRLGYLV
1lk9A           ------------------------------------------------------------GHSGSRFGWA
1b8gA           LVTNPSNPLGTTMTRNELYLLLSFVEDKGIHDEIYSGTAFENSEVWQRVHVVYSLSKDLGLPGFRVGAIY
1c7nA           LLFCPHNPVGRVWKKDELQKIKDIVLKSDLMGYEHTVFQSIDEQLADKTITFTAPSKTFNIAGMGMSNII
2cbiA1          LDELITLAQGDKASLDMIVAQLNEDTEAYESAKEIAQNKLNTALSSFAVISEKVAQSFIQEALS------
1u08A           ILNTPHNPSATVWDFAALWQAIAGHEIFVISDEVYEASVLAHPQLRERAVAVSSFGKTYHMTGWKVGYCV
1c8nA           LSQTYKAIPYAGYDGAAILNTDVTPTSAIYVDVDVTRFDKAFAALTAFDQNQFCPCTVHIGSDGGPAVAV
1m32A           HIAXVHSETTXLNPIDEVGALAHRYGKTYIVDAXSSFGGIPXDIAAHIDYLISSANKCIQGVPGF--AFV
1dtyA           IIEPIVQGAGGMRWLKRIRKICDREGILLIADEIARTGKLFACEHAEIAPDILCLGKALTGGTMTLSATL
1agxA           IHAGTGNGSMANYLVPEVRKLHDEQGLQIVRSSRVAQGFVLRNAEQPDDKYGWIAAHDLNPQKARLMALA
1w9gA1          KRMNPNSPSITYDISQLFDFIDDLADLSCLVRADTQTYQPYNKDWIKEKIYVLLRRQA------------
1spvA           ----------------------------------ISTGVYGYPRAAAAEIAVKTVSEFITRHALPEQVYF
1vk9A           SGRSFESKDSGLKPVVELFKRFDNLEGSLVIDKXVGKAAASFPDHIHAKVISKPALKLXNEYG--QSFSY
1v8dA           GGARAVYTREEMLK--------------------------------------------------------
1fhlA           RQRVWVNPSDGSYDLD------------------------------------------------------
1vp4A           VVSNFHNPAGVTTSLEKRKALVEIAEKYDLFDDPYGALRYFKIGGPERVVLLNTFSKVLAPG---LRIGX
1jg8A           AIENTHNVVPLE-NIKEICTIAKEHGINVHIDGSIASGVPVKEYAGYADSVMFCLSXGLCA---PVGSVV


                         .         .         .         +         .         .         .:280
query           VTNSLELYEKLFYNLNTTGAVLSPFDSYQLLRGLKTLSLRMERSTANAQEVVAFLKDSPAVKEVLYTGRG
1cs1A           IAKDPDVVTELAWWANNIGVTGGAFDSYLLLRGLRTLVPRMELAQRNAQAIVKYLQTQPLVKKLYHKGFG
1cl1A           VCNA-RCWEQLRENAYLMGQMVDADTAYITSRGLRTLGVRLRQHHESSLKVAEWLAEHPQVARVNHTGSS
1ecxA           KGVPIR--PLIHGGGQERGLRSGTQNVPGIVGAARAMEIAVKHMEKLRSKLVSGLMNLGAHIITPLEISP
1qz9A           VSP--QLCDLVPQPLSGWFGHSRQFAMEPRYEPSNGIARYLCGTQPITS-LAMVECGLDVFAQTDMASLR
1fc4A           ARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEXVEAGSELRDRLWANARQFREQXSAAGFTLAGADH
1mdoA           VTDNPQFADKLRSLKFHGLYNLPDLNAAIALAQLQKLDALNARRAAIAAQYHQAXADLPFQPLSLPSWEH
1b9hA           FPDG-ETEKYEFLRHSCGRPRDDRFSASVLRAQLARLDEQIAVRDERWTLLSRLLGAIDGVVPFRIPGLT
2fn6A1          VTNDSELHEKMKLKSIGHNFRLNEIQSALGLSQLKKAPFLMQKREEAALTYDRIFKDNPYFTPLHPLLKD
1c0nA           EALLQEMPPWEGGG------SMIATVSLSEGTTWTKAPWRFEAGTPNTGGIIGLGAALEYVSALALSQLE
3bc8A1          FNEPFIQDISKMYPGRASASPSLDVLITLLSLGCSGYRKLLKERKEMFVYLSTQLKKLAEAHNERLLQTP
1pmmA           WRDEEALPQELVFNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEDE
1h0cA           SDKAKK--KMYSRKTKPFSFYLDIKWLANFWGCDDQPRMYHHTIPVISLYSLRELIAEQGLENSWRQHRE
1wytA1          ATKK-AFVRQLPGRL--VSETVDVERGFILTLQAREQYIRRAKAKSN-----------------------
2bwnA1          AASARDAVRSYAPGFIFSTAIAAGAQASIAFLKTAEGQKLRDAQQMHAKVLKMRLKALG---MPIIDHGS
2aeuA1          AGKK-ELVDKIYIEGTKFGLEAQPPLLAGIYRALKNFNLERIR---------------------------
1wytB1          VERGEEGFYLDFDRPKSIGRVRSFYGNYIRTLGLEGLKKAAALAVLNARYLKELLKEKGY--RVPYDGPS
2e7iA1          KEEWAEIVLRKNKEVELLGCTARGATIITLMASFPHVIKRWDEEVEKARRFAAQLGDNPHNHDLMFFHAE
1lc5A           NSDDAAMARMRRQQMPWSVNALAALAGEVALQDSAWQQATWHWLREEGARFYQALCQLPLLTVY---PGR
1lk9A           LIKDESVYNNLLNYMTKNTEGTPRETQL---RSLKVLKEVVAMVKTQKGTMRDLNTFGFKKLRERWVNIT
1b8gA           SND--DMVVAAATKMSSFGLVSSQTQHLLSAMLSDKKLTKHKRLKQRQKKLVSGLQKSGISCLN--GNAG
1c7nA           IKNERFTKSRDATSGMPFTTLGYKACEICYKECGKWLDGCIKVIDKNQRIVKDFFEVHPEIKAP--LIEG
2cbiA1          ----------------------------------------------------------------------
1u08A           APAPISAEIRKVHQYLTFSVPAQLALADMLRAEPEHYLALPDFYRQKRDILVNALNESRLEILPCEGTYF
1c8nA           PPG--DIFFKY-----------------------------------------------------------
1m32A           IAREXEDNHGKWRFTSPTHTVLAFAQALKELAKEGGVAARHQRYQQNQRSLVAGXRALGFNTLLDDELHS
1dtyA           TTREVETISDGEAGCFMHGPTFMPLACAAANASLAILESGQQQVADIEVQLREQLAPARDAEMVADVVLG
1agxA           LTKTNEIQNMF-----------------------------------------------------------
1w9gA1          ----------------------------------------------------------------------
1spvA           VCYDAHLYERLL----------------------------------------------------------
1vk9A           DEKIPFVLGKDGKSXCPFEKLVLE----------------------------------------------
1v8dA           ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1vp4A           VAGSKEFIRKIVQAKQSADLCSPAITHRLAARYLERYDLLRRKRTVXLNALEEYFSDIPGVKWV--KSEG
1jg8A           VGD-------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           GMISFKVADETRIPHILNSLKVFSFAESLGGVESLITYPTTQTHADIPAEVRHSYGLTDDLLRLSIGIED
1cs1A           AMLSFELDDEQTLRRFLGGLSLFTLAESLGGVESLISHAATMTHAGMAPEARAAAGISETLLRISTGIED
1cl1A           GLFSFVLKNNEELANYLDNFSLFSMAYSWGGYESLILANQPEHIAAIRPQGE--IDFSGTLIRLHIGLED
1ecxA           NTLSVSFPNI-------RGSTLQNLLSGYGIYVSTHVLDAMGVDR----------RIAQGAIRISLCKYN
1qz9A           RKSLEQRCAAHELTLVTPREHAKRGSHVSFEHPEGYAVIQALIDRGVIGDYREPRIMRFGFTPLYTTFTE
1fc4A           AIIPVXLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQAR---------IRTQXS-------AAHTPEQ
1mdoA           IHAWHLFIIRDEARCGITRDALXASLKTKGIGTGLHFRAAHTQKYYRERFPTLTLPDTERICSLPLFPDX
1b9hA           EERRNALVDRLVEAGLAFAAFRAIYRTDAFWELGAPDESVDAIARRCPNDAISSDCVWLHHRVLLAGEPE
2fn6A1          KPILMHQKFFTCKKLILESLHKRGILAQVHYIYQYQLYQQLFNTAPLKSAEDFYHAEISLPCHANLNLES
1c0nA           SVPDLTLYGPQA--RLGVIAFNLGAHHAYDVGSFLDNYGIAVRTGHHCAMPLMAYYNVPAMCRASLAMYN
3bc8A1          HAMTLKTIDGHHGSMLFTRQVSGARAVPLGNVQTVSGHTFRGFMSHADNYPCAYLNAA---AAIGMKMQD
1pmmA           GIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV---MRIM-------CRRGFEMDF
1h0cA           AAAYLHGRLQALGLQLFVKLPTVTTVAVPAGYDWRDIVSYVIDHFDIEIMGGLGPSTGKVLRIGLLGCEN
1wytA1          ----------------------------------------------------------------------
2bwnA1          HIVPVVIGPVHTKAVSDMLLSDYGVYVQPINFPTVPRGT--------------------ERLRFTPSPVH
2aeuA1          ----------------------------------------------------------------------
1wytB1          MHE-FVAQPPEGFR----ALDLAKGLLELGFHPPTVYFP---LIVKEALMVEPTETEAKETLEA--FAEA
2e7iA1          VLYEISKKAKGGRFFLLKSRKIHGIKPGLTRYFKLSTYGLSDEEVD------------------------
1lc5A           ANYLL-----LRCE-----------REDIDLQRRLLTQRILIRSCANYPGLDSRY------YRVAIRAAQ
1lk9A           ALLDQSDRFSQELPQSEYCNYFRRMRPPSPSYAWVKCEWEEDKDCYQTFQNGRGFEASSRYVRLSLIQDD
1b8gA           LFCWVDMRH---LLRSNTFEAEMELWKKIVYEVHLNISPGSSCHCTEP-----------GWFRVCFANRT
1c7nA           TYLQWIDFRALKMDH-------KAMEEFMIHKAQIFFDEGYIFGDGGIGFERINLAAPSS--VIQESLER
2cbiA1          ----------------------------------------------------------------------
1u08A           LLVDYSAVSTLDDVECQWLTQEHGVAAIPLSVFC--------ADPFPHKLIRLCFAKKE---------ST
1c8nA           ----------------------------------------------------------------------
1m32A           PIITAPEDPQYRFSEFYRRLKEQGFVIYPGKVSQSIGNIGEVYAADI-----------------------
1dtyA           AIGVVETTHPVNMAALQKFFVEQGVWIRPFGKLIYLMPPYIILPQQLQRLTA------------------
1agxA           ----------------------------------------------------------------------
1w9gA1          ----------------------------------------------------------------------
1spvA           ----------------------------------------------------------------------
1vk9A           ----------------------------------------------------------------------
1v8dA           ----------------------------------------------------------------------
1fhlA           ----------------------------------------------------------------------
1vp4A           GLF------------------IWLTLPEGFDTWEXFEYAKRKKVFYVPGRVFKVYDEPSPSXRLSFCLEK
1jg8A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           ARDLIADLRQALEG
1cs1A           GEDLIADLENGFR-
1cl1A           VDDLIADLDAGFA-
1ecxA           TEEEVDYFLKKIE-
1qz9A           VWDAVQILGEILD-
1fc4A           ITRAVEAFTRIGK-
1mdoA           TESDFDRVITALH-
1b9hA           LHATAEIIADAVA-
2fn6A1          VQNIAHSVLKTFE-
1c0nA           THEEVDRLVTGLQ-
3bc8A1          VDLFIKRLDKCLN-
1pmmA           AELLLEDYKASLK-
1h0cA           VDRVTEALRAALQ-
1wytA1          --------------
2bwnA1          DLKQIDGLVHAMD-
2aeuA1          --------------
1wytB1          MGALLKKPKEWLEN
2e7iA1          --------------
1lc5A           NERLLAALRNVL--
1lk9A           FDQLMYYLKDMVK-
1b8gA           LDLAMQRLKAFV--
1c7nA           LNKALKDLK-----
2cbiA1          --------------
1u08A           LLAAAERLRQ----
1c8nA           --------------
1m32A           --------------
1dtyA           --------------
1agxA           --------------
1w9gA1          --------------
1spvA           --------------
1vk9A           --------------
1v8dA           --------------
1fhlA           --------------
1vp4A           IVEGIKRLREVVL-
1jg8A           --------------