[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56680.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2etdA1.bssp"

## Summary of PDB Search
:186
    1e-43  42%  2etdA1 [a.29.9.1] LEMA PROTEIN A:35 -- 183
:186

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAKYEGSTLEKVA
2etdA1          ----------------------LVSLEQEVQEXYSQIQNQLQRRADLIPNLVETVXGYAAHEXEILEEIA


                         .         .         *         .         .         .         .:140
query           ELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQEELTNTENKISYSRQLYNSVV
2etdA1          NARAXLIGAXTPQESAQADAELSSALSRLLAIAENYPNLXADANFRQLXDELAGTENRIAVARRDYNEAV


                         +         .         .         .         .         *         .:210
query           SNYNVKLETFPSNIIAGMFGFKAADFLQxxxxxxxxxxxxxxxxxx
2etdA1          XXYNTAI----------XXGFEEXQYFE------------------