[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56707.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1dikA1.bssp"
#ERROR : Can't open dsspfile "1sgjA.bssp"
#ERROR : Can't open dsspfile "2gicA1.bssp"
#ERROR : Can't open dsspfile "1izcA.bssp"
#ERROR : Can't open dsspfile "1d8cA.bssp"

## Summary of PDB Search
:289
    9e-21  20%  1dikA1 [c.1.12.2] PYRUVATE PHOSPHATE DIKINASE A:510 -- 874
    4e-12  12%  1sgjA  [c.1.12.5] CITRATE LYASE, BETA SUBUNIT
    5e-10  16%  2gicA1 [a.260.1.1] NUCLEOCAPSID PROTEIN A:2 -- 422
    1e-04  14%  1izcA  [c.1.12.5] MACROPHOMATE SYNTHASE INTERMOLECULAR DIELS-
    2e-04  13%  1d8cA  [c.1.13.1] MALATE SYNTHASE G
:289

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYSDEEVWYRFT
1dikA1          -----------------------------------------------------------HTEEEQ-AELA
1sgjA           ----------------------------------------------------------------------
2gicA1          ----------------------------------------------------------------------
1izcA           ----------------------------------------------------------------------
1d8cA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ELTNTEANCLVGTKEFFDEGHPLFGYRGTRRLLACLDEFQAEAHVVTEVYQTNPNLSVIFPFVNDADQLK
1dikA1          KNMGLTLAEVKAKVDELHEFNPMMGHRGCRLAVTTRAVMEAAIEVKEETGIDIV-PEIMIPLVGEKKELK
1sgjA           ---------------------------------------------------------VVVPKLEMGAEAR
2gicA1          -----------------DKWLPLYLLGLYRVGRTQMPELTNQCKMINEQFEPLPEGRDIFDVWGNDSNYT
1izcA           --------------------------------------------------RRSFSPWTFSPGIADASLFP
1d8cA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QAITALRQYGFTGKVGTMIELPSAYFDLSSILETGISKIVVGMNDLTSFVFATMRNSQWHDLESPIMLDM
1dikA1          EQVKKEKGSDMQYHIGTMIEIPRAALTADAIAEEA-EFFSFGTNDLTQMTFGFSRDDAGKFLDSTGVGQL
1sgjA           QVAQMLQERSLPLPILAGLETGAGVWNAREIMVPEVAWAYFGAEDYT---TDLGGKRTPGGLEVLYARSQ
2gicA1          KIVAAVKHECASFRYGTIVSRFKDCAALATFGHL-CKITGMSTEDVTTWILN-------REVADEMVQMM
1izcA           NDPYNVATSNNHVCIIPQIESVKGVENVDAIAAMEIHGLMFGPGDY-MIDAGLDLNGALSGVPHPTFVEA
1d8cA           -------------KXGIXDEERRTSLNLRSCIAQRVAFINTGFLDRTGDEXHSVXEAXKSTPWIKAYERN


                         .         .         .         +         .         .         .:280
query           LRDMQDKARKNKINFAVAGYLNTSFIQKMNQLGIKCIIHYSSIPEIxxxxxxxxxxxxxxxxxxxxxxxx
1dikA1          VEMAVKKGRQTRPGLKCGGEHDPSSVEFCHKVGLNYVCSPFRVP--------------------------
1sgjA           VALAARLTGVAALDIVVTALNDPETFRADAEQGRALGIHPAQVALA------------------------
2gicA1          LPG-------QEIDKAD------SYMPYLIDFGLSSKSPYSSVK--------------------------
1izcA           MTKFSTAAQRNGVP-IFGGALSVDMVPSLIEQGYRAI---------------------------------
1d8cA           NVLSGLFCGLRGK---------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxx
1dikA1          ---------
1sgjA           ---------
2gicA1          ---------
1izcA           ---------
1d8cA           ---------