[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56712.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1a80A.bssp"
#ERROR : Can't open dsspfile "1pyfA.bssp"
#ERROR : Can't open dsspfile "1og6A.bssp"
#ERROR : Can't open dsspfile "1pz1A.bssp"
#ERROR : Can't open dsspfile "1lqaA.bssp"
#ERROR : Can't open dsspfile "1exbA.bssp"
#ERROR : Can't open dsspfile "1gveA.bssp"
#ERROR : Can't open dsspfile "2jokA1.bssp"
#ERROR : Can't open dsspfile "1m65A.bssp"
#ERROR : Can't open dsspfile "1d0nA6.bssp"
#ERROR : Can't open dsspfile "1chuA3.bssp"
#ERROR : Can't open dsspfile "1b9kA2.bssp"
#ERROR : Can't open dsspfile "1nz0A.bssp"
#ERROR : Can't open dsspfile "1k2yX1.bssp"
#ERROR : Can't open dsspfile "1tzzA1.bssp"

## Summary of PDB Search
:280
    3e-70  44%  1a80A  [c.1.7.1] 2,5-DIKETO-D-GLUCONIC ACID REDUCTASE A
    5e-58  27%  1pyfA  [c.1.7.1] IOLS PROTEIN
    8e-55  26%  1og6A  [c.1.7.1] HYPOTHETICAL OXIDOREDUCTASE YDHF
    3e-52  30%  1pz1A  [c.1.7.1] GENERAL STRESS PROTEIN 69
    8e-51  25%  1lqaA  [c.1.7.1] TAS PROTEIN
    4e-47  27%  1exbA  [c.1.7.1] KV BETA2 PROTEIN
    6e-47  22%  1gveA  [c.1.7.1] AFLATOXIN B1 ALDEHYDE REDUCTASE
    1e-43  15%  2jokA1 [a.168.1.1] PUTATIVE G-NUCLEOTIDE EXCHANGE FACTOR A:78 --
    2e-34  15%  1m65A  [c.6.3.1] HYPOTHETICAL PROTEIN YCDX
    4e-30  13%  1d0nA6 [d.109.1.1] HORSE PLASMA GELSOLIN A:629 -- 755
    2e-24  16%  1chuA3 [d.168.1.1] PROTEIN (L-ASPARTATE OXIDASE) A:238 -- 353
    9e-18  11%  1b9kA2 [d.105.1.1] PROTEIN (ALPHA-ADAPTIN APPENDAGE DOMAIN) A:825
    1e-11   5%  1nz0A  [d.14.1.2] RIBONUCLEASE P PROTEIN COMPONENT
    9e-10  15%  1k2yX1 [c.84.1.1] PHOSPHOMANNOMUTASE X:5 -- 154
    2e-06  12%  1tzzA1 [c.1.11.2] HYPOTHETICAL PROTEIN L1841 A:1146 -- 1392
:280

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MDTYQLNNGVEIPVLGFGTFKAKDGEEAYRAVLEALKAGYRHIDTAAIYQNEESVGQAIKDSGVPREELF
1a80A           VPSIVLNDGNSIPQLGYGVFKV-PPADTQRAVEEALEVGYRHIDTAAIYGNEEGVGAAIAASGIARDDLF
1pyfA           ------KSDLQVFPIGLGTYPNLNEETGKELVREAIRNGVTXLDTAYIYGIEELIGEVLRE--FNREDVV
1og6A           VQRITIPQGPEFSRFVMGYWRLMDWRQLVSFIEEHLDLGVTTVDHADIYGGEAAFGEALKLAPHLRERME
1pz1A           --------GIEASRIGLGTWAGTDEKTSIETIRAALDQGITLIDTAPAYQSEEIVGKAIKEYX-KRDQVI
1lqaA           MQYHRIHSSLEVSTLGLGTMTQNSEADAHAQLDYAVAQGINLIDVAEMYPVPPRPETQGLAKHGSREKLI
1exbA           ------KSGLRVSCLGLGTWVTFGGEMAEHLMTLAYDNGINLFDTAEVYKAEVVLGNIIKKKGWRRSSLV
1gveA           -----------RPATVLGAMERMDVTSSSRSVRAFLQRGHTEIDTAFVYANGQSEGLGLGRSGCKVKIAT
2jokA1          -------------------------------------------------------GDAKQ---AIRHFVD
1m65A           ------------------VASTHAYSTLSDYIAQAKQKGIKLFAITDHGPDMEDAPHHWHFINMRIWPRV
1d0nA6          ----------------------------------MDAHPPRLFACSNKIGREEVPGEFMQEDLATDDVML
1chuA3          --------------------------------------EFNQFHPTALYARNFLLTEALAYLKRPDGTRF
1b9kA2          --------------------------------------------------SQDFFQRWKQLSN-PQQEVQ
1nz0A           ----------------------------------------------------------------------
1k2yX1          --------------------------------------------------TAYWIGRAIGSESLARGEPC
1tzzA1          ----------RVFVYAAGGYY--GLSMLRGEMRGYLDRGYNVVK---MKIGGAPIEEDRMRIEAVLEEIG


                         .         .         *         .         .         .         .:140
query           VTTKLWNSQQTYEQARQAFEESLEKLGLDYLDLYLIHWPNPKPLRENDQWKIRNAEVWRAMEDLYQEGKI
1a80A           ITTKLWNDRHDGDEPAAAIAESLAKLALDQVDLYLVHWP--------TPAADNYVHAWEKMIELRAAGLT
1pyfA           IATKAAHRKQSPDFLKKSVDESLKRLNTDYIDLFYIHFPDEHTPKD---------EAVNALNEXKKAGKI
1og6A           IVSKCGIATTDRDHIIKSAEQSLINLATDHLDLLLIHRPDPLMDAD---------EVADAFKHLHQSGKV
1pz1A           LATKTALDWKNRARIVEEVENSLKRLQTDYIDLYQVHWPDPLVPIE---------ETAEVXKELYDAGKI
1lqaA           IASKVSGPSRNNKNIREALHDSLKRLQTDYLDLYQVHWPQRPYSWTDSAPAVSLLDTLDALAEYQRAGKI
1exbA           ITTKIWGGKAETERGIEGLKASLERLQLEYVDVVFANRPD---------PNTPMEETVRAMTHVINQGMA
1gveA           KAAPMFGKTLKPADVRFQLETSLKRLQCPRVDLFYLHFPDHGTPIE---------ETLQACHQLHQEGKF
2jokA1          EAVKQPEIRQDAEFGRQVYEATLCAIFSEAKDRFCMDPATRGNVRPAFIEALGDAARATGLPGADKQGVF
1m65A           VDGVGILRGIEANIKNVDGEIDCSGKMFDSLDLIIAGFHEP------VFAPHDKATNTQAMIATIASGNV
1d0nA6          LDTWDQVFVWVGKDSQDEEKTEALTSAKRYIDTDPAHRDRR----------TPITVVKQGFEPPSFVGWF
1chuA3          MPDFDERGELPRDIVARAIDHEMKRLGADCMFLDISHKPAD-----------FIRQHFPMIYEK-----L
1b9kA2          NIFKAKHPMAKIIGFGSALLEEVDPNPANFVGAGIIHTKTTEPNLQAQMYRLTLRTSKDTVSQLCELLSE
1nz0A           ----------------------------------------------------------------------
1k2yX1          VAVGRDGRLSGPE-LVKQLIQGLVDCGCQVSDVGMVPTPVL-------YYAANVLEGKSGVMLTGAHNPP
1tzzA1          KDAQLAVDANGRFNLETGIAKMLRDYPLFWYEEVGDPLD------------------YALQAALAEFYPG


                         +         .         .         .         .         *         .:210
query           RAIGVSNFLPHHLDALLETAKILPAVNQVRLAPGVYQDQVVAYCREKGILLEAWGPFGQGELFDSKQVQE
1a80A           RSIGVSNHLVPHLERIVAATGVVPAVNQIELHPAYQQREITDWAAAHDVKIESWGPLGQYDLFGAEPVTA
1pyfA           RSIGVSNFSLEQLKEANKDGLVDVLQGEYNLLNREAEKTFFPYTKEHNISFIPYFPLVSGNIRKVNKLAP
1og6A           RHFGVSNFTPAQFALLQSRLPFTLATNQVEISPPLLLDGTLDQLQQLRVRPMAWSCLGGGQPLRDELAVV
1pz1A           RAIGVSNFSIEQXDTFRAVAPLHTIQPPYNLFEREXEESVLPYAKDNKITTLLYGSLCRGYLSAVNQLDK
1lqaA           RYIGVSNETAFGVMRYLHLADKVTIQNPYSLLNRSFEVGLAEVSQYEGVELLAYSCLGFGTLTGKAAYVD
1exbA           MYWGTSRWSSMEIMEAYSVARIPPICEQAEFQREKVEVQLPELFHKIGVGAMTWSPLACGIVYDSKELQA
1gveA           VELGLSNYVSWEVAEICTLCKIMPTVYQGMYNAITRQTELFPCLRHFGLRFYAFNPLAGGLLLVEKALKT
2jokA1          TPSGAGTNPLYTEIRLRADTELAARPEYRELQPYQAIDLVANALPAERSNTLVEFRQTVQTLRRAAQDAS
1m65A           HIISHPGNPKYEIDAVAEAA----AKHQVAINNSSNCREVAAAVRDAGGWVALGSDSHTAFMGEFEECLK
1d0nA6          LGWDDSYWSVDPLDRALAELA-------------------------------------------------
1chuA3          LGLGIDLT--------QEPVPIVPAAH-------------------------------------------
1b9kA2          Q---------------------------------------------------------------------
1nz0A           -------------------------------------------LQNEYFVVLFRKNGXDYSRLGIVVKRK
1k2yX1          DYNGFKIVANEQIQALRERIEKNDLASGV-----------------------------------------
1tzzA1          PATGENLFSHQDARNLLRYGGMRPDRDWLQFDCALSYQRTLEVLKTHGWSPSRCIPHG------------


                         .         .         .         +         .         .         .:280
query           IAANHGKSIAQIALAWSLAEGFLPLPKSVTTSRIQANLDCFGIELSHEERETLKTIAVQSGAPRVDDVDF
1a80A           AAAAHGKTPAQAVLRWHLQKGFVVFPKSVRRERLEENLDVFDFDLTDTEIAAIDAMD-------------
1pyfA           IAEKHNVDIPHIVLAWYLARPEILIPGAKRADQLIDNIKTADVTLSQEDISFIDKL--------------
1og6A           AEELNAGSIEQVVNAWVLRSQPLPIIGSGKIERVRAAVEAETLKMTRQQWFRIRKAA-------------
1pz1A           LAKTYGKSVIHLAVRWILDQPGIALWGARKPGQLEALSEITGWTLNSEDQKDINTILENTISDPV-----
1lqaA           IARRHGLDPAQMALAFVRRQPFSTLLGATTMDQLKTNIESLHLELSEDVLAEIEAVH-------------
1exbA           IAERLGCTLPQLAIAWCLRNEGVVLLGASNAEQLMENIGAIQVKLSSSIVHEIDSI--------------
1gveA           TYGPTAPSMISAAVRWMYHQGDAVILGMSSLEQLEQNLALVEEPLEPAVVDAFDQA---WNLVAHECPNY
2jokA1          RDEKGATNAADGA---------------------------------------------------------
1m65A           ILDAVDFPPERILLNFLESRGMAPIAEFA-----------------------------------------
1d0nA6          ----------------------------------------------------------------------
1chuA3          ----------------------------------------------------------------------
1b9kA2          ----------------------------------------------------------------------
1nz0A           FGKATRRNKLKRWVREIFRRNKGVIPKGIPRKKLSEEFERVDFWTVREKLLNL-----------------
1k2yX1          ----------------------------------------------------------------------
1tzzA1          ----------------------------------------------------------------------