[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56832.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1yt8A3.bssp"
#ERROR : Can't open dsspfile "1bohA2.bssp"
#ERROR : Can't open dsspfile "1qxnA.bssp"
#ERROR : Can't open dsspfile "1tq1A.bssp"
#ERROR : Can't open dsspfile "1yt8A1.bssp"
#ERROR : Can't open dsspfile "1t3kA.bssp"
#ERROR : Can't open dsspfile "1gmxA.bssp"
#ERROR : Can't open dsspfile "1e0cA2.bssp"
#ERROR : Can't open dsspfile "1yt8A4.bssp"
#ERROR : Can't open dsspfile "1urhA2.bssp"
#ERROR : Can't open dsspfile "1uarA2.bssp"
#ERROR : Can't open dsspfile "1okgA1.bssp"
#ERROR : Can't open dsspfile "1yt8A2.bssp"
#ERROR : Can't open dsspfile "1c25A.bssp"
#ERROR : Can't open dsspfile "2gwfA1.bssp"
#ERROR : Can't open dsspfile "1hzmA.bssp"
#ERROR : Can't open dsspfile "1mwqA.bssp"
#ERROR : Can't open dsspfile "1e0cA1.bssp"
#ERROR : Can't open dsspfile "1ulrA.bssp"
#ERROR : Can't open dsspfile "1bohA1.bssp"

## Summary of PDB Search
:328
    5e-21  17%  1yt8A3 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:373 -- 529
    8e-20  19%  1bohA2 [c.46.1.2] RHODANESE A:150 -- 293
    1e-19  18%  1qxnA  [c.46.1.3] SULFIDE DEHYDROGENASE
    1e-18  22%  1tq1A  [c.46.1.3] SENESCENCE-ASSOCIATED FAMILY PROTEIN
    2e-18  21%  1yt8A1 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:107 -- 242
    3e-18  17%  1t3kA  [c.46.1.1] DUAL-SPECIFICITY TYROSINE PHOSPHATASE
    2e-17  19%  1gmxA  [c.46.1.3] GLPE PROTEIN
    3e-17  20%  1e0cA2 [c.46.1.2] SULFURTRANSFERASE A:136 -- 271
    9e-17  25%  1yt8A4 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:243 -- 372
    2e-16  19%  1urhA2 [c.46.1.2] 3-MERCAPTOPYRUVATE SULFURTRANSFERASE A:149 -- 268
    5e-16  18%  1uarA2 [c.46.1.2] RHODANESE A:145 -- 285
    7e-16  19%  1okgA1 [c.46.1.2] POSSIBLE 3-MERCAPTOPYRUVATE SULFURTRANSFERASE A:7
    4e-15  20%  1yt8A2 [c.46.1.2] THIOSULFATE SULFURTRANSFERASE A:6 -- 106
    5e-14  24%  1c25A  [c.46.1.1] CDC25A
    6e-14  12%  2gwfA1 [c.46.1.4] UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 8 A:181 --
    3e-12  18%  1hzmA  [c.46.1.1] DUAL SPECIFICITY PROTEIN PHOSPHATASE 6
    3e-09  23%  1mwqA  [d.58.4.7] HYPOTHETICAL PROTEIN HI0828
    3e-07  24%  1e0cA1 [c.46.1.2] SULFURTRANSFERASE A:1 -- 135
    5e-05  16%  1ulrA  [d.58.10.1] PUTATIVE ACYLPHOSPHATASE
    4e-04  31%  1bohA1 [c.46.1.2] RHODANESE A:1 -- 149
:328

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGM
1yt8A3          ----------------------------------------------------------------------
1bohA2          ----------------------------------------------------------------------
1qxnA           ----------------------------------------------------------------------
1tq1A           ----------------------------------------------------------------------
1yt8A1          ----------------------------------------------------------------------
1t3kA           ----------------------------------------------------------------------
1gmxA           ----------------------------------------------------------------------
1e0cA2          ----------------------------------------------------------------------
1yt8A4          ----------------------------------------------------------------------
1urhA2          ----------------------------------------------------------------------
1uarA2          ----------------------------------------------------------------------
1okgA1          ----------------------------------------------------------------------
1yt8A2          ----------------------------------------------------------------------
1c25A           ----------------------------------------------------------------------
2gwfA1          ----------------------------------------------------------------------
1hzmA           ----------------------------------------------------------------------
1mwqA           ------IFAQDIPNTLEKRLAVREQHLARLKQLQAENRLLTAGGFTGSTVIAQFENLQAAKDWAAQDPYV
1e0cA1          ----------------------------------------------------------------------
1ulrA           ---------------------YRAFAQKKALELGLSGYAENLPDGVEVVAEGPKEALELFLHHLKQGPRL
1bohA1          ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           EELWFKIDEESEQAFKKMFVxxxxxxxxxxxxxxDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTR
1yt8A3          ------------------------------------------------TIDPTTLADWLGEPGTRVLDFT
1bohA2          ---------------------------------------FKATLNRSLLKTYEQVLENLESKRFQLVDSR
1qxnA           ----------------------------------TFKAQVKAAKADMVMLSPKDAYKLLQNPDITLIDVR
1tq1A           -------------------------------------------SRVPSSVSVTVAHD-LLLAGHRYLDVR
1yt8A1          --------------------------------------ELVEAERHTPSLAAEEVQALLDRAEAVILDAR
1t3kA           ------------------------------------------------YITSTQLLPLHRRPNIAIIDVR
1gmxA           ------------------------------------------------CINVADAHQKLQEKEAVLVDIR
1e0cA2          ---------------------------------------VALSLHDEPTASRDYLLGRLGAADLAIWDAR
1yt8A4          -------------------------------------------------LDLAGLAQWQHDRTTYLLDVR
1urhA2          ------------------------------------------------VVKVTDVLLASHENTAQIIDAR
1uarA2          ------------------------------------------------RDDVLEHIIKVKEGKGALVDVR
1okgA1          -----------------------------------------PKHPGKVFLDPSEVADHL--AEYRIVDCR
1yt8A2          -------------------------------------------------------------RELALLDVR
1c25A           ------------------------------------------------YISPEIMASVLLIKEFVIIDCR
2gwfA1          -------------------------------------------------ITAKELYTMMKNISLIIMDAR
1hzmA           -------------------------------------------------KTVAWLNEQLELERLLLMDCR
1mwqA           EA--GVYADVIVKPFKKVF---------------------------------------------------
1e0cA1          --------------------------------------------------EPADLQARLSAPELILVDLT
1ulrA           ARVAVEVQWGEEAGLKGFHV--------------------------------------------------
1bohA1          --------------------------------------------------STKWLAESVVGPGLRVLDAS


                         +         .         .         .         .         *         .:210
query           NDYEYDLGHFRGAIRPDIRNFREXPQWVRDNKEKFMDKRVVVYCTGGVRCEKFSGWMVREGYKDVGQLHG
1yt8A3          ASANYAKRHIPGAAWVLRSQLKQALERLGTAERY------VLTCGSSLLARFAVAEVQALSGKPVFLLDG
1bohA2          AQGRYLGGHIRGSVNMPFMNFLTEDGFEKSPEEVDLTKPLIATXRKGVTACHIALAAYLCGKPDVAIYDG
1qxnA           DPDELKAMGKPDVKNYKHMSRGKLEPLLAK-SGLDPEKPVVVFCKTAARAALAGKTLREYGFKTIYNSEG
1tq1A           TPEEFSQGHACGAINVPYMNRGASGMSKNTDFLEQVSDNIIVGCQSGGRSIKATTDLLHAGFTGVKDIVG
1yt8A1          RFDEYQTXSIPGGISVPGAELVLRVAELAPDP----RTRVIVNCAGRTRSIIGTQSLLNAGIPPVAALRN
1t3kA           DEERNYDGHIAGSLHYASGSFDDKISHLVQNVKD-KDTLVFHSALSQVRGPTCARRKEDTGIKNIMILER
1gmxA           DPQSFAMGHAVQAFHLTNDTLGAFM------RDNDFDTPVMVMXYHGNSSKGAAQYLLQQGYDVVYSIDG
1e0cA2          SPQEYRGGHIPGAVNFEWTAAMDPSRALRIRTDITPDKEIVTHXQTHHRSGLTYLIAKALGYPRVKGYAG
1yt8A4          TPEEYEAGHLPGSRSTPGGQLVQETDHVASVR----GARLVLVDDDGVRANXSASWLAQXGW-QVAVLDG
1urhA2          PAARFNAGHIPGALNVP---WTELVREG---ELKTTDELDAIFFGRGVSYDK--PIIVSXDVPNVKLYDG
1uarA2          SPQEYRAGHIPGAKNIPWAKAVNPRALYEPLGITKDKDIVVYXRIAERSSHSWFVLKYLLGYPHVKNYDG
1okgA1          YSLQYAKEHVKSAIRADVDTNLSKLVPTSTARHPLPELPVLCYDDECGAXGGCRLWWLNSLGADAYVING
1yt8A2          EEDPFAQAHPLFAANLPLSRLELEIHARVPRR----DTPITVYDDGEGLAPVAAQRLHDLGYSDVALLDG
1c25A           YPYEYEGGHIKGAVLHMEEEVEDFLLKKPIVPTDGKRVIVVFHCESSERGPRMCRYVPKLHYPELYVLKG
2gwfA1          RMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDVEYVVLLDWFSSAKDLQIGTTLRVLRNEPLVLEG
1hzmA           PQELYESSHIESAINVAIPGIM----------LRRLQKGNLPVRALFTRGEDRDRFTRRCGTDTVVLYDE
1mwqA           ----------------------------------------------------------------------
1e0cA1          SAARYAEGHIPGARFVDPKRTQQPPQPPREQLESLFEAVYVVYDDEGGGWAGRFIWLLDVGQQRYHYLNG
1ulrA           ----------------------------------------------------------------------
1bohA1          WYSEYLERHVPGASFFDIEECRDKASPYEVSEAGFADTHVVVYDLGSFYAPRV-WWMFRVGHRTVSVLNG


                         .         .         .         +         .         .         .:280
query           GIATYGKDPEVQGELWDGKMYVFDERIAVDVNHVNPTIVGKDWxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yt8A3          GTSAWVAA---GLPTEDGESLLASPRIDRYRRPYEGTDNPREA---------------------------
1bohA2          SWFEWFHPPETWVSQGKG----------------------------------------------------
1qxnA           GMDKWLELPSLDR---------------------------------------------------------
1tq1A           GYSAW-----------------------------------------------------------------
1yt8A1          GTIGWTLQQLEHGQ--------------------------------------------------------
1t3kA           GFNGW-----------------------------------------------------------------
1gmxA           GFEAW-----------------------------------------------------------------
1e0cA2          SWGEWGNHP-------------------------------------------------------------
1yt8A4          LS--------------------------------------------------------------------
1urhA2          AW--------------------------------------------------------------------
1uarA2          SWTEWGNLPIAKGE--------------------------------------------------------
1okgA1          GFQACKALEXESGE--------------------------------------------------------
1yt8A2          GLSGW-----------------------------------------------------------------
1c25A           GYKEFMKCQ----SYCEPPSYR------------------------------------------------
2gwfA1          GYENW-----------------------------------------------------------------
1hzmA           SS--------------------------------------------------------------------
1mwqA           ----------------------------------------------------------------------
1e0cA1          GLT-------------------------------------------------------------------
1ulrA           ----------------------------------------------------------------------
1bohA1          GFRNW-----------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1yt8A3          ------------------------------------------------
1bohA2          ------------------------------------------------
1qxnA           ------------------------------------------------
1tq1A           ------------------------------------------------
1yt8A1          ------------------------------------------------
1t3kA           ------------------------------------------------
1gmxA           ------------------------------------------------
1e0cA2          ------------------------------------------------
1yt8A4          ------------------------------------------------
1urhA2          ------------------------------------------------
1uarA2          ------------------------------------------------
1okgA1          ------------------------------------------------
1yt8A2          ------------------------------------------------
1c25A           ------------------------------------------------
2gwfA1          ------------------------------------------------
1hzmA           ------------------------------------------------
1mwqA           ------------------------------------------------
1e0cA1          ------------------------------------------------
1ulrA           ------------------------------------------------
1bohA1          ------------------------------------------------