[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56852.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b4aA1.bssp"
#ERROR : Can't open dsspfile "1b4bA.bssp"
#ERROR : Can't open dsspfile "1xxaA.bssp"
#ERROR : Can't open dsspfile "1gxjA.bssp"

## Summary of PDB Search
:156
    3e-17  41%  1b4aA1 [a.4.5.3] ARGININE REPRESSOR A:4 -- 78
    1e-16  33%  1b4bA  [d.74.2.1] ARGININE REPRESSOR
    2e-16  20%  1xxaA  [d.74.2.1] ARGININE REPRESSOR
    6e-06  27%  1gxjA  [d.215.1.1] CHROMOSOME SEGREGATION SMC PROTEIN
:156

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxRHQLIRALITKNKIHTQAELQALLAKNDIQVTQATLSRDIKNMNLSKVREEDSAYYVLNNGSIS
1b4aA1          ------RHIKIREIIMSNDIETQDELVDRLREAGFNVTQATVSRDIKEMQLVKVPANGRYKYSLPSDQRF
1b4bA           ----------------------------------------------------------------------
1xxaA           ----------------------------------------------------------------------
1gxjA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KWEKRLxxxMEDALVWMRPVQHQVLLKTLPGLAQSFGSIIDTLSFPDAIATLCGNDVCLIICEDADTAQK
1b4aA1          NPLQKL----------------------------------------------------------------
1b4bA           -----------DVFIKLDGTGNLLVLRTLPGNAHAIGVLLDNLDWDEIVGTICGDDTCLIICRTPKDAKK
1xxaA           ---------LKNLVLDIDYNDAVVVIHTSPGAAQLIARLLDSLGKAEGIGTIAGDDTIFTTPANGFTVKD
1gxjA           --------------------------ERFPGL---VDVVSNLIEVDEAVSVLLGGTAQNIVVRNVDTAKA


                         +         .         .         .         .         *         .:210
query           CFEELKKFxxxxxxxx
1b4aA1          ----------------
1b4bA           VSNQLLSM--------
1xxaA           LYEAILEL--------
1gxjA           IVEFLKQ---------