[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of RPS:SCP for spne4:ACF56871.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2oa4A1.bssp"
#ERROR : Can't open dsspfile "1p4xA2.bssp"
#ERROR : Can't open dsspfile "1xmaA.bssp"
#ERROR : Can't open dsspfile "1p4xA1.bssp"
#ERROR : Can't open dsspfile "1fnnA1.bssp"
#ERROR : Can't open dsspfile "2p4wA1.bssp"

## Summary of PDB Search
:83
    2e-05  15%  2oa4A1 [a.4.12.3] SIR5 A:1 -- 93
    3e-04  12%  1p4xA2 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    5e-04  15%  1xmaA  [a.4.5.61] PREDICTED TRANSCRIPTIONAL REGULATOR
    6e-04  17%  1p4xA1 [a.4.5.28] STAPHYLOCOCCAL ACCESSORY REGULATOR A HOMOLOGUE
    6e-04  11%  1fnnA1 [a.4.5.11] CELL DIVISION CONTROL PROTEIN 6 A:277 -- 388
    8e-04  16%  2p4wA1 [a.4.5.64] TRANSCRIPTIONAL REGULATORY PROTEIN ARSR FAMILY
:83

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xGKSYKEIIELLDCNQTTIWRNVKKYEEFGLDSLLQETRGGRNHAYMTVEEEKAFLARHLKATEAGEFVT
2oa4A1          -LITLAEAKQTYGLSDEEFNSWVSALAEHGKDALKVTALKKY----------------------------
1p4xA2          ---LLKDLIETIHHKYPQTVRALNNLKKQGYLIKERSTEDERKILIHMDDAQQDHAEQLLAQVNQLL---
1xmaA           ---IRIKTDELYVIKETTLYSAFARLEKNGYIKSYYGEETKRRTYYRITPEGIKYYKQKCEEWELTK-KV
1p4xA1          -TLPFKKIVSDLCYKQSDLVQHIKVLVKHSYISKVRSKIDERNTYISISEEQREKIAERVTLFDQII---
1fnnA1          -YKIVCEEYGERPRVHSQLWSYLNDLREKG---IVETRQNTTLISIGTEPLDTLEAVITK----------
2p4wA1          -PYFVSELSRELGVGQKAVLEHLRILEEAGLIESRVEKIPRGRPRKYYMIKKGLRLEILLTPTLFGSEMY


                         .         .         *         .         .         .         .:140
query           IDALFQxxxxxxx
2oa4A1          -------------
1p4xA2          -------------
1xmaA           INKFVK-------
1p4xA1          -------------
1fnnA1          -------------
2p4wA1          EAKG---------