[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ54134.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s7jA.bssp"
#ERROR : Can't open dsspfile "1qyaB.bssp"
#ERROR : Can't open dsspfile "1qyaA.bssp"
#ERROR : Can't open dsspfile "1sdjA.bssp"
#ERROR : Can't open dsspfile "1qy9C.bssp"
#ERROR : Can't open dsspfile "1qy9A.bssp"
#ERROR : Can't open dsspfile "1xubA.bssp"
#ERROR : Can't open dsspfile "1u1wB.bssp"
#ERROR : Can't open dsspfile "1t6kA.bssp"
#ERROR : Can't open dsspfile "1ym5A.bssp"
#ERROR : Can't open dsspfile "1u1vA.bssp"
#ERROR : Can't open dsspfile "3ednA.bssp"

## Summary of PDB Search
:267
    8e-41  43%  1s7jA  [d.21.1] PHENAZINE BIOSYNTHESIS PROTEIN PHZF FAMILY
    1e-16  32%  1qyaB  [d.21.1 - d.21.1] HYPOTHETICAL PROTEIN YDDE
    4e-16  30%  1qyaA  [d.21.1 - d.21.1] HYPOTHETICAL PROTEIN YDDE
    3e-13  31%  1sdjA  [d.21.1 - d.21.1] HYPOTHETICAL PROTEIN YDDE
    3e-13  31%  1qy9C  [d.21.1 - d.21.1] HYPOTHETICAL PROTEIN YDDE
    3e-13  31%  1qy9A  [d.21.1 - d.21.1] HYPOTHETICAL PROTEIN YDDE
    9e-13  30%  1xubA  [d.21.1 - d.21.1] PHENAZINE BIOSYNTHESIS PROTEIN PHZF
    9e-13  30%  1u1wB  [d.21.1 - d.21.1] PHENAZINE BIOSYNTHESIS PROTEIN PHZF
    9e-13  30%  1t6kA  [d.21.1 - d.21.1] PHENAZINE BIOSYNTHESIS PROTEIN PHZF
    6e-12  28%  1ym5A  [x.x.x] HYPOTHETICAL 32.6 KDA PROTEIN IN DAP2-SLT2
    7e-07  28%  1u1vA  [d.21.1 - d.21.1] PHENAZINE BIOSYNTHESIS PROTEIN PHZF
    4e-06  50%  3ednA  [x.x.x] PHENAZINE BIOSYNTHESIS PROTEIN, PHZF FAMILY
:267

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYELRWFTPTTEV
1s7jA           ---YYIVDAFAEEVFKGNPAAVYVLEKWLPEAVMQNIAIENNLSETAFT---VKEGQSYALRWFTPEREI
1qyaB           ------VDAFTSQPFRGNSAGVVFPADNLSEAQMQLIARELGHSETAFL--LHSDDSDVRIRYFTPTVEV
1qyaA           ------VDAFTSQPFRGNSAGVVFPADNLSEAQMQLIARELGHSETAFL--LHSDDSDVRIRYFTPTVEV
1sdjA           ------VDAFTSQPFRGNSAGVVFPADNLSEA-QQLIARELGHSETAFL--LHSDDSDVRIRYFTPTVEV
1qy9C           ------VDAFTSQPFRGNSAGVVFPADNLSEA-QQLIARELGHSETAFL--LHSDDSDVRIRYFTPTVEV
1qy9A           ------VDAFTSQPFRGNSAGVVFPADNLSEA-QQLIARELGHSETAFL--LHSDDSDVRIRYFTPTVEV
1xubA           MHNYVIIDAFASVPLEGNPVAVFFDADDLPPAQMQRIAREMNLSESTFVKPRNGGDA--LIRIFTPVNEL
1u1wB           MHNYVIIDAFASVPLEGNPVAVFFDADDLPPAQMQRIAREMNLSESTFVKPRNGGDA--LIRIFTPVNEL
1t6kA           MHNYVIIDAFASVPLEGNPVAVFFDADDLPPAQMQRIAREMNLSESTFVKPRNGGDA--LIRIFTPVNEL
1ym5A           ---FKQVDVFTEKPFMGNPVAVIIDENEVSQEELQAIANWTNLSETTFLFKPSDKKYDYKLRIFTPRSEL
1u1vA           -HNYVIIDAFASVPLEGNPVAVF-FDADDLPPAQQRIARE-NLSESTFVKPRNGGDA--LIRIFTPVNEL
3ednA           INVFHY-DAFTNKP-NGNPAGI-VLDADGLTEEEQRIAEKVGFNETSFV--LSSEVADIR-RYFTPGYE-


                         .         .         *         .         .         .         .:140
query           DLCXXXXXXXXXXXXXXXXXXPFRFASRSGVLTVTARDGLLWLDFPANPPYAKDVPDGLVAALGGEPVWA
1s7jA           DLCGHATLATAFVLFNYYSVAELHFTSQSGPLAVTKKEEYYYLDFPYILPERIPILPEYEAALGTKIYEA
1qyaB           PICGHATVAAHYVRAKVLGLGNCTITSLAGKHRVTIEDYRISLEQGTEPPLEGETRAAIINALPGLPIQV
1qyaA           PIHATVAAHYVRAKVLGLGNCTIWQTSLKHRVTIEKHNDDYRISLEQGTPGFEPPLEGETRALPGLPIQV
1sdjA           PICGHATVAAHYVRAKVLGLGNCTITSLAGKHRVTIEDYRISLEQGTEPPLEGETRAAIINALPGLPIQV
1qy9C           PICGHATVAAHYVRAKVLGLGNCTITSLAGKHRVTIEDYRISLEQGTEPPLEGETRAAIINALPGLPIQV
1qy9A           PICGHATVAAHYVRAKVLGLGNCTITSLAGKHRVTIEDYRISLEQGTEPPLEGETRAAIINALPGLPIQV
1xubA           PFAGAPLLGTAIALGAHTDNHRLYLETQMGTIALERQNGSVSMDQPIPTWTALGRDAELLKALGISPIEI
1u1wB           PFAGHPLLGTAIALGAHTDNHRLYLETQMGTIALERQNGSVSMDQPIPTWTALGRDAELLKALGISPIEI
1t6kA           PFAGHPLLGTAIALGAHTDNHRLYLETQMGTIALERQNGSVSMDQPIPTWTALGRDAELLKALGISPIEI
1ym5A           PFAGHPTIGSCKAFLEFTKNTTATSECKIGAVPITINEGL--ISFKAPMADYESISSEMIAAIGIKPPAL
1u1vA           PFAGHPLLGTAIALGAHTDNHRLYLETQGTIAFELERQNIAASDQPIPTWTALGRDAELLKALGISPIEI
3ednA           DLC-------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSA
1s7jA           YLG--RDLFFVLKDEETVAKITPDFSALKALDLGGVIVTASGDS---VDFVSRTFFPKLRINEDPVCGSA
1qyaB           ATTGHSKVMIPLKPEVDIDALSPDLNALTAISKKGCNGFFPFQPGK-NETDGRMFSPAIGIVEDPVTGNA
1qyaA           ATTGHSKVMIPLKPEVDIDALSPDLNALTAISKKGCNGFFPFQPGK-NETDGRMFSPAIGIVEDPVTGNA
1sdjA           ATTGHSKVIPLKP-EVDIDALSPDLNALTAISKKGCNGFFPFQIRPGKNETDGRFSPAIGIVEDPVTGNA
1qy9C           ATTGHSKVIPLKP-EVDIDALSPDLNALTAISKKGCNGFFPFQIRPGKNETDGRFSPAIGIVEDPVTGNA
1qy9A           ATTGHSKVIPLKP-EVDIDALSPDLNALTAISKKGCNGFFPFQIRPGKNETDGRFSPAIGIVEDPVTGNA
1xubA           YHNGPRHVFVGLPSIDALSALHPD--HRALSNFHDMAINCFAGAGRRWR--SRMFSPAYGVVEDAATGSA
1u1wB           YHNGPRHVFVGLPSIDALSALHPD--HRALSNFHDMAINCFAGAGRRWR--SRMFSPAYGVVEDAATGSA
1t6kA           YHNGPRHVFVGLPSIDALSALHPD--HRALSNFHDMAINCFAGAGRRWR--SRMFSPAYGVVEDAATGSA
1ym5A           LHTGPEWIVALVEDAETCFNANPNFAMLAHQTKQGIILAGPKEAAIKNSYEMRAFAPVINVYEDPVCGSG
1u1vA           YHNGPRHVFVGLPSIDALSALHPDHRALSNF---HDAINCFAGAGRRW---RSRFSPAYGVVEDAATGSA
3ednA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           HTALGPYWAQRLGRTRLDAVQCSARGGRLVVELPADAPDRVLIGGTAVTVSEGTLRx
1s7jA           HANLIPYWGKRLNQTTLSAYQVSPRGGFLTCEV---KENRVIIGGTAKLFAKG----
1qyaB           NGPMGAWLVHNVLRVKGHQGRALGRDGEVTVTIRDNQPEKVTISGTAV---------
1qyaA           NGPMGAWLVHNVLRVKGHQGRALGRDGEVTVTIRDNQPEKVTISGTAV---------
1sdjA           HHNVLPHDGNVLRVKGHQGRALGRDGIEVTVTIRDNQPEKVTISGTAV---------
1qy9C           HHNVLPHDGNVLRVKGHQGRALGRDGIEVTVTIRDNQPEKVTISGTAV---------
1qy9A           HHNVLPHDGNVLRVKGHQGRALGRDGIEVTVTIRDNQPEKVTISGTAV---------
1xubA           AGPLAIHLAREIGRPSLMFAKAEGRAEQLT---------RVEVSGNGVTFGRGTI--
1u1wB           AGPLAIHLAREIGRPSLMFAKAEGRAEQLT---------RVEVSGNGVTFGRGTI--
1t6kA           AGPLAIHLAREIGRPSLMFAKAEGRAEQLT---------RVEVSGNGVTFGRGTI--
1ym5A           SVALARYLQEVYKFEKTTDITIS-EGGRLSIKKEADNSTSYYIAGHATTVIDGKIK-
1u1vA           AGPLAIHLA-RHGQIELQGVEIGRPSLFAKAEGRAEQLTRVEVSGNGVTFGRGTI--
3ednA           ---------------------------------------------------------