[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ54138.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2oceA.bssp"
#ERROR : Can't open dsspfile "3bzkA.bssp"
#ERROR : Can't open dsspfile "3bzcA.bssp"

## Summary of PDB Search
:777
      0.0  59%  2oceA  [x.x.x] HYPOTHETICAL PROTEIN PA5201
      0.0  59%  3bzkA  [x.x.x] TEX
      0.0  59%  3bzcA  [x.x.x] TEX
:777

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxSIHQRIAEELGVRERQVRAAVELLDDGATVPFIARYRKEVTEMLDDAQLRAIXXXXXXXXXXXXXXT
2oceA           ---SINTRIAEELSAXXXXXXXXXXLLDEGSTVPFIARYRKEVTGSLDDTQXXXXXXXXXXXXXXXXXXG
3bzkA           ---SINTRIAEELSAXXXXXXXXXXLLDEGSTVPFIARYRKEVTGSLDDTQXXXXXXXXXXXXXXXXXXG
3bzcA           ---SINTRIAEELSAXXXXXXXXXXLLDEGSTVPFIARYRKEVTGSLDDTQXXXXXXXXXXXXXXXXXXG


                         .         .         *         .         .         .         .:140
query           VILESIKAQGKLTPELEAAIMAADSKARLEDIYLPYKPKRRTKAQIAREAGLEPLADALLNDPSRDPHDQ
2oceA           AILASIEEQGKLTPELARDIKLADTKTRLEDLYLPYKQKRRTKGQIXXXXXXXXXXXXXFDDPTLVPESE
3bzkA           AILASIEEQGKLTPELARDIKLADTKTRLEDLYLPYKQKRRTKGQIXXXXXXXXXXXXXFDDPTLVPESE
3bzcA           AILASIEEQGKLTPELARDIKLADTKTRLEDLYLPYKQKRRTKGQIXXXXXXXXXXXXXFDDPTLVPESE


                         +         .         .         .         .         *         .:210
query           AAAYVDADKGVADTAAALEGARAILVERFTEDADLIGELRERMWQRGRLVSRVREGKEEVGVKFADYFDF
2oceA           AARFVDAEKGFADVKAVLEGAKYILMERFAEDATLLDKLRVFMKNEATLTARVVPGKEQEGAKFSDYFEH
3bzkA           AARFVDAEKGFADVKAVLEGAKYILMERFAEDATLLDKLRVFMKNEATLTARVVPGKEQEGAKFSDYFEH
3bzcA           AARFVDAEKGFADVKAVLEGAKYILMERFAEDATLLDKLRVFMKNEATLTARVVPGKEQEGAKFSDYFEH


                         .         .         .         +         .         .         .:280
query           AEAFTTLPSHRVLALFRGEKEEVLDLTLXXXXXXXXXXXXSSYEVRIAQHFGIADQGRPGDRWLLDTVRW
2oceA           DEPLKSAPSHRALAIFRGRNEGVLSASLKVGEEAPGTLHPC--EVMIAERFGLSNQGRAADKWLAEVVRW
3bzkA           DEPLKSAPSHRALAIFRGRNEGVLSASLKVGAPGTLHPC----EVMIAERFGLSNQGRAADKWLAEVVRW
3bzcA           DEPLKSAPSHRALAIFRGRNEGVLSASLKVGEEAPGTLHPC--EVMIAERFGLSNQGRAADKWLAEVVRW


                         .         *         .         .         .         .         +:350
query           AWRTRILVRLDIDLRSRLWQEAEDEAVRVFAANLRDLLLAAPAGTRPTIGLDPGLRTGVKVAVVDGTGKV
2oceA           TWKVKLYTHLETDLFGELRDGAEDEAISVFARNLHDLLLAAPAGPRATLGLDPGLRTGVKVAVVDATGKL
3bzkA           TWKVKLYTHLETDLFGELRDGAEDEAISVFARNLHDLLLAAPAGPRATLGLDPGLRTGVKVAVVDATGKL
3bzcA           TWKVKLYTHLETDLFGELRDGAEDEAISVFARNLHDLLLAAPAGPRATLGLDPGLRTGVKVAVVDATGKL


                         .         .         .         .         *         .         .:420
query           VDTATIYPHEPQKRWDESIAVLAALAQKHRVELVAIGNGTASRETDRLAADLIKRHPELKLTKVMXXXXX
2oceA           LDTATVYPHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKKYPGMKLTKIMVSEAG
3bzkA           LDTATVYPHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKKYPGMKLTKIMVSEAG
3bzcA           LDTATVYPHAPKNQWDQTLAVLAALCAKHQVELIAIGNGTASRETDKLAGELIKKYPGMKLTKIMVSEAG


                         .         .         +         .         .         .         .:490
query           XXXXXXXXXXXQELPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSEVKLSRSLDAVVED
2oceA           ASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQLKLARSLDAVVED
3bzkA           ASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQLKLARSLDAVVED
3bzcA           ASVYSASELAAKEFPELDVSLRGAVSIARRLQDPLAELVKIEPKSIGVGQYQHDVSQLKLARSLDAVVED


                         *         .         .         .         .         +         .:560
query           CVNAVGVDVNTASVPLLSRVSGITASLAQNIVAYRDANGPFRTRAQLREVPRLGPKAFEQCAGFLRIPDG
2oceA           CVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQAAGFLRVMNG
3bzkA           CVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQAAGFLRVMNG
3bzcA           CVNAVGVDVNTASAALLARISGLNSTLAQNIVAHRDANGAFRTRDELKKVSRLGEKTFEQAAGFLRVMNG


                         .         .         .         *         .         .         .:630
query           DDPLDSSSVHPEAYPVVRRILEATGRDIRALIGDTDTLRSLRPDDFVDERFGLPTVTDILAELEKPGRDP
2oceA           DNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILKELDKPGRDP
3bzkA           DNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILKELDKPGRDP
3bzcA           DNPLDASAVHPETYPLVQRIAADTERDIRSLIGDSAFLKRLDPKKFTDETFGLPTVTDILKELDKPGRDP


                         .         +         .         .         .         .         *:700
query           RPEFQTAAFRDGVEDITDLEPGMVLEGVVTNXXXXXXXXXXXXXXXXXXXXSAMSKSFVKDPRDVVKPGD
2oceA           RPEFKTAEFQEGVESLKDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAGD
3bzkA           RPEFKTAEFQEGVESLKDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAGD
3bzcA           RPEFKTAEFQEGVESLKDLKPGMVLEGVVTNVTNFGAFVDIGVHQDGLVHISALSEKFVKDPYEVVKAGD


                         .         .         .         .         +         .         .:770
query           IXXXXXXXXXXXXXXISLTLRLDDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2oceA           IVKVKVMEVDIPRNRVGLSMRMSD----------------------------------------------
3bzkA           IVKVKVMEVDIPRNRVGLSMRMSD----------------------------------------------
3bzcA           IVKVKVMEVDIPRNRVGLSMRMSD----------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxx
2oceA           -------
3bzkA           -------
3bzcA           -------