[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ54462.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2eyqB.bssp"
#ERROR : Can't open dsspfile "2eyqA.bssp"
#ERROR : Can't open dsspfile "1gm5A.bssp"
#ERROR : Can't open dsspfile "2b2nB.bssp"
#ERROR : Can't open dsspfile "2b2nA.bssp"
#ERROR : Can't open dsspfile "1t5lA.bssp"
#ERROR : Can't open dsspfile "2fdcB.bssp"
#ERROR : Can't open dsspfile "2nmvA.bssp"
#ERROR : Can't open dsspfile "2d7dA.bssp"
#ERROR : Can't open dsspfile "3fpnB.bssp"
#ERROR : Can't open dsspfile "1d9zA.bssp"
#ERROR : Can't open dsspfile "1d9xA.bssp"
#ERROR : Can't open dsspfile "2qsrA.bssp"
#ERROR : Can't open dsspfile "3eaqA.bssp"
#ERROR : Can't open dsspfile "3i32A.bssp"
#ERROR : Can't open dsspfile "2z0mA.bssp"
#ERROR : Can't open dsspfile "3easA.bssp"
#ERROR : Can't open dsspfile "3earA.bssp"
#ERROR : Can't open dsspfile "3eaqB.bssp"
#ERROR : Can't open dsspfile "1d2mA.bssp"
#ERROR : Can't open dsspfile "1wp9A.bssp"
#ERROR : Can't open dsspfile "2db3A.bssp"
#ERROR : Can't open dsspfile "1wp9D.bssp"
#ERROR : Can't open dsspfile "1wp9C.bssp"
#ERROR : Can't open dsspfile "1wp9B.bssp"
#ERROR : Can't open dsspfile "2kbfA.bssp"
#ERROR : Can't open dsspfile "3gfpA.bssp"
#ERROR : Can't open dsspfile "2zu6C.bssp"

## Summary of PDB Search
:1210
    e-162  42%  2eyqB  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    e-162  42%  2eyqA  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    6e-67  41%  1gm5A  [a.24.21 - b.40.4 - c.37.1 - c.37.1] RECG
    3e-17  30%  2b2nB  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    3e-17  30%  2b2nA  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    2e-12  28%  1t5lA  [c.37.1 - c.37.1] UVRABC SYSTEM PROTEIN B
    2e-12  31%  2fdcB  [x.x.x] UVRABC SYSTEM PROTEIN B
    9e-12  30%  2nmvA  [x.x.x] UVRABC SYSTEM PROTEIN B
    9e-12  30%  2d7dA  [x.x.x] UVRABC SYSTEM PROTEIN B
    2e-10  42%  3fpnB  [x.x.x] GEOBACILLUS STEAROTHERMOPHILUS UVRB INTERACTION
    3e-10  28%  1d9zA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    3e-10  28%  1d9xA  [c.37.1 - c.37.1] EXCINUCLEASE UVRABC COMPONENT UVRB
    3e-07  34%  2qsrA  [x.x.x] TRANSCRIPTION-REPAIR COUPLING FACTOR
    9e-06  32%  3eaqA  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    2e-05  33%  3i32A  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    8e-05  27%  2z0mA  [x.x.x] 337AA LONG HYPOTHETICAL ATP-DEPENDENT RNA
    8e-05  31%  3easA  [x.x.x] HERA
    8e-05  31%  3earA  [x.x.x] HERA
    8e-05  31%  3eaqB  [x.x.x] HEAT RESISTANT RNA DEPENDENT ATPASE
    8e-05  27%  1d2mA  [c.37.1 - c.37.1] EXCINUCLEASE ABC SUBUNIT B
    1e-04  33%  1wp9A  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    2e-04  27%  2db3A  [x.x.x] ATP-DEPENDENT RNA HELICASE VASA
    2e-04  30%  1wp9D  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    2e-04  32%  1wp9C  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    2e-04  33%  1wp9B  [x.x.x] ATP-DEPENDENT RNA HELICASE, PUTATIVE
    3e-04  29%  2kbfA  [x.x.x] ATP-DEPENDENT RNA HELICASE DBP5
    4e-04  32%  3gfpA  [x.x.x] DEAD BOX PROTEIN 5
    5e-04  23%  2zu6C  [x.x.x] EUKARYOTIC INITIATION FACTOR 4A-I
:1210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAGLAA
2eyqB           -----------------------------------------------------------------ATLVA
2eyqA           -----------------------------------------------------------------ATLVA
1gm5A           ----------------------------------------------------------------------
2b2nB           -----------------------------------------------------------------ATLVA
2b2nA           -----------------------------------------------------------------ATLVA
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DAPVGAGRPVLALTATEREAADLNSALGSLLPADSVALFPAWETLPHERLSPRSDTVGQRLAVLRRLTHP
2eyqB           EIAERHAGPVVLIAPDMQNALRLHDEI-SQFTDQMVMNLADWETLPYDSFSPHQDIISSRLSTLYQLP--
2eyqA           EIAERHAGPVVLIAPDMQNALRLHDEI-SQFTDQMVMNLADWETLPYDSFSPHQDIISSRLSTLYQLP--
1gm5A           ----------------------------------------------------------------------
2b2nB           EIAERHAGPVVLIAPDMQNALRLHDEI-SQFTDQMVMNLADWETLPYDSFSPHQDIISSRLSTLYQLP--
2b2nA           EIAERHAGPVVLIAPDMQNALRLHDEI-SQFTDQMVMNLADWETLPYDSFSPHQDIISSRLSTLYQLP--
1t5lA           -------KPTLVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYDYAQPEAYVPQTDTYIEKDAKINKLRHS
2fdcB           -------KPTLVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYDYYQPEAYVPQTDTYIEKDAKINKLRHS
2nmvA           -------KPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
2d7dA           -------KPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
3fpnB           ----------------------------------------------------------------------
1d9zA           -------KPTLVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYDYYQPEAYVPQTDTYIEKDAKINKLRHS
1d9xA           -------KPTLVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYDYYQPEAYVPQTDTYIEKDAKINKLRHS
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ------GRPALVLAPNKILAAQLAAEFRELFPENAVEYFISY----YDYYQPEAYVPGKDLYIEKDASNP
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DPDDPLTAPLRVVVAPIRSVLQPLVSGLGDLQPVRVREGDSVALDELVQSLVDIGYSRVDLVEKRGDIAV
2eyqB           ------TMQRGVLIVPVNTLMQRVCPSFLHGHALVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYAT
2eyqA           ------TMQRGVLIVPVNTLMQRVCPSFLHGHALVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYAT
1gm5A           ----------------------------------------------------------------------
2b2nB           ------TMQRGVLIVPVNTLMQRVCPSFLHGHALVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYAT
2b2nA           ------TMQRGVLIVPVNTLMQRVCPSFLHGHALVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYAT
1t5lA           ATSALFERRDVIIVASVSCIY-----GLGSPEEYRLRVGMEIERNALLRRLVDIQYDRNDIDFRRGTFRV
2fdcB           ATSALFERRDVIIVASVSCIY-----GLGSPEEYRLRVGMEIERNALLRRLVDIQYDRNDIDFRRGTFRV
2nmvA           ATSALFERRDVIIIASVSCIY-----GLGSPEEYRLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRV
2d7dA           ATSALFERRDVIIIASVSCIY-----GLGSPEEYRLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRV
3fpnB           ---------------------------------VSLRVGMEIERNALLRRLVDIQYDRNDIDFRRGTFRV
1d9zA           ATSALFERRDVIIVASVSCIY-----GLGSPEEYRLRVGMEIERNALLRRLVDIQYDRNDIF--RGTFRV
1d9xA           ATSALFERRDVIIVASVSCIY-----GLGSPEEYRLRVGMEIERNALLRRLVDIQYDRNDIF--RGTFRV
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           EIEXXXXXXXXIVVASVSAIY-----GLGDPREYRAR--NXXXXXXXXXXXXXXGYQRNDIDLSPGRFRA
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RGGILDVFPPTEEHPLRLEFWGDTVEEIRYFQVADQRSISKxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqB           RGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQRTLEE-----------------------------
2eyqA           RGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQRTLEE-----------------------------
1gm5A           ----------------------------------------------------------------------
2b2nB           RGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQRTLEE-----------------------------
2b2nA           RGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQRTLEE-----------------------------
1t5lA           RGDVVEIFPASDEHCIRVEFFGDEIERIR-----------------------------------------
2fdcB           RGDVVEIFPASDEHCIRVEFFGDEIERIR-----------------------------------------
2nmvA           RGDVVEIFPASDEHCVRVEFFGDEIERIR-----------------------------------------
2d7dA           RGDVVEIFPASDEHCVRVEFFGDEIERIR-----------------------------------------
3fpnB           RGDVVEIFPASDEHCIRVEFFGDEIERIR-----------------------------------------
1d9zA           RGDVVEIFPASDEHCIRVEFFGDEIE--------------------------------------------
1d9xA           RGDVVEIFPASDEHCIRVEFFGDEIE--------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           KGEVLEIFPAYETEPIRVE---------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqB           ----------------------------------------------------------------------
2eyqA           ----------------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxVVLLTPGQGPAERLASMLRDAGLGTQLRDALPEPPEPAVATVTTGLLEHGF
2eyqB           -------------------VVFSVESEGRREALGELLARIKIAPQRIMRLDEASDRG-RYLMIGAAEHGF
2eyqA           -------------------VVFSVESEGRREALGELLARIKIAPQRIMRLDEASDRG-RYLMIGAAEHGF
1gm5A           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           VWRSVRTVLLTETDLVGQXXXXXXXXXXXXXXXGVDPLQLKPGDYVVHEQHGIGRYVEMVSRTIQGATRE
2eyqB           VDTVRNLALICESDLLGERVARRRQDSRRTINPDTNLAELHIGQPVVHLEHGVGRYAGMTTLEAGGITGE
2eyqA           VDTVRNLALICESDLLGERVARRRQDSRRTINPDTNLAELHIGQPVVHLEHGVGRYAGMTTLEAGGITGE
1gm5A           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           YLVIEYAPSKRGQPGDRLFVPTDQLDEVTRYVGGDSPTLSKMGGSDWXXXXXXXXXXXXEIAGDLIRLYS
2eyqB           YLMLTYANDAK------LYVPVSSLHLISRYAGGENAPLHKLGGDAWSRARQKAAEKVRDVAAELLDIYA
2eyqA           YLMLTYANDAK------LYVPVSSLHLISRYAGGENAPLHKLGGDAWSRARQKAAEKVRDVAAELLDIYA
1gm5A           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           ARHASPGHAFSPDTPWQRELEDAFPYVETPDQLAAIEEVKRDMEKPVPMDRLICGDVGYGKTEVAVRAAF
2eyqB           QRAAKEGFAFKHDREQYQLFCDSFPFETTPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAF
2eyqA           QRAAKEGFAFKHDREQYQLFCDSFPFETTPDQAQAINAVLSDMCQPLAMDRLVCGDVGFGKTEVAMRAAF
1gm5A           ------------------EFIKSLPFKLTNAQKRAHQEIRNDMISEKPMNRLLQGDVGSGKTVVAQLAIL
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ---------------------------------------------------LIVLPTGLGKTLIAMMIAY
2db3A           ----------------------------------------------------------------------
1wp9D           ---------------------------------------------------LIVLPTGLGKTLIAMMIAY
1wp9C           ---------------------------------------------------LIVLPTGLGKTLIAMMIAY
1wp9B           ---------------------------------------------------LIVLPTGLGKTLIAMMIAY
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ---------------------------------------------------------GTGKTATFAISIL


                         .         .         .         .         +         .         .:770
query           KAVQDGKQVAVLVPTTLLVQQHLSTFTERYASFPVTVRPLSRFQSDAEIERIREGMRTGEVDVVIGTHRL
2eyqB           LAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKL
2eyqA           LAVDNHKQVAVLVPTTLLAQQHYDNFRDRFANWPVRIEMISRFRSAKEQTQILAEVAEGKIDILIGTHKL
1gm5A           DNYEAGFQTAFMVPTSILAIQHYRRTVESFSKFNIHVALLIGATTPSEKEKIKSGLRNGQIDVVIGTHAL
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           -----GKTAAYAIPILELGMKSLVVTPTRELTRQVAIRDIGRYM-DTKVAEVYGGMRVRNADIVVATPRL
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           RLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALTGEKSPEE-----RSKAWARAKVIVATNDL
2db3A           ----------------------------------------------------------------------
1wp9D           RLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALTGEKSPEE-----RSKAWARAKVIVATNDL
1wp9C           RLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALTGEKSPEE-----RSKAWARAKVIVATNDL
1wp9B           RLTKYGGKVLMLAPTKPLVLQHAESFRRLFNLPPEKIVALTGEKSPEE-----RSKAWARAKVIVATNDL
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           QQIEDLTQALVLAPTRELAQQ-----IQKVVMALGCHACIGGTNVRAEVQKLQ----MEAPHIIVGTRRY


                         .         .         *         .         .         .         .:840
query           LSPETQFKDLGLVIIDEEQRFGVEHKEALKRLRTQVDVLSMSATPIPRTLEMGLTGIREMTTILTPPEER
2eyqB           LQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIATPPARR
2eyqA           LQSDVKFKDLGLLIVDEEHRFGVRHKERIKAMRANVDILTLTATPIPRTLNMAMSGMRDLSIIATPPARR
1gm5A           IQEDVHFKNLGLVIIDEQHRF-----EALMNKGKMVDTLVMSATPIPRSMALAFYGDLDVTVIDEMPPGR
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           -------------------------------------IIYVSATPGPYELEHSPGVVEQITGLLDPTIDV
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           -------------------------------------IIYVSATPGPYELEHSPGVVEQITGLLDPTIDV
1d9xA           -------------------------------------IIYVSATPGPYELEHSPGVVEQITGLLDPTIDV
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           LDLWSKLSSFEIVIIDEDLMFEMGFIDDIKIILAQTSITGLFSATIPKVVKDFITNYEEIEACIGLANVE
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           LAGRISLEDVSLIVFDEAHR--------------------------------------------------
2db3A           ------FEDTRFVVLDEADRMDMGFSEDMRRIMTHVTM-----RPEHQTLMFSATFPEEIQRMAGEFLKN
1wp9D           LAGRISLEDVSLIVFDEAHR--------------------------------------------------
1wp9C           LAGRISLEDVSLIVFDEAHR--------------------------------------------------
1wp9B           LAGRISLEDVSLIVFDEAHR--------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           LSP----KYIKMFVLDEADEFKDQIYDIFQKLNSNTQVVLLSATMPSDVLEVTKKFMRDPIRILVKKEIR


                         +         .         .         .         .         *         .:910
query           HPVLTFVGPYDEKQIAAAIRRELMREGQVFFVHNRVASIERAAATVSRLVPEARVAWAHGQMNEHQLERV
2eyqB           LAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQKAAERLAELVPEARIAIGHGQMRERELERV
2eyqA           LAVKTFVREYDSMVVREAILREILRGGQVYYLYNDVENIQKAAERLAELVPEARIAIGHGQMRERELERV
1gm5A           KEVQTMLVPMDRNEVYEFVRQEVMRGGQAFIVYPLIKSAVEMYEYLSKEV--FKLGLMHGRLSQEEKDRV
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           RPTK---GQIDD--LIGEIRERVERNERTLVT----TLTKKMAEDLTDYLKEAKVAYLHSEIKTLERIEI
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           RPTK---GQIDD--LIGEIRERVERNERTLVT----TLTKKMAEDLTDYLKEAKVAYLHSEIKTLERIEI
1d9xA           RPTK---GQIDD--LIGEIRERVERNERTLVT----TLTKKMAEDLTDYLKEAKVAYLHSEIKTLERIEI
2qsrA           ----------------------------------------------------------------------
3eaqA           ---------YEEEAVPAPVRGRLEVLSDLLYVASTKAETEEIAQGLLRLGHPAQAL--HGDLSQGERERV
3i32A           ---------YEEEAVPAPVRGRLEVLSDLLYVASTKAETEEIAQGLLRLGHPAQAL--HGDMSQGERERV
2z0mA           HK---FVHVKDDWRSKVQALRENKDKGVIVFVRNRVAKLVRLFDNAIEL---------RGDLPQSVRNRN
3easA           ---------YEEEAVPAPVRGRLEVLSDLLYVASTKAETEEIAQGLLRLGHPAQAL--HGDLSQGERERV
3earA           ---------YEEEAVPAPVRGRLEVLSDLLYVASTKAETEEIAQGLLRLGHPAQAL--HGDLSQGERERV
3eaqB           ---------YEEEAVPAPVRGRLEVLSDLLYVASTKAETEEIAQGLLRLGHPAQAL--HGDLSQGERERV
1d2mA           ----------------------------------------------------------------------
1wp9A           ------------------IREQLQRKQNIVFTNYR----ETAKKIVNELVKDGIKAKRFGQASKQREQKL
2db3A           Y-VFVAIGIVDVKQTIYEVNKYAKRDGTIVFVETKRGADFLASFLSEKEFPTTSI---HGDRLQSQREQA
1wp9D           ----------------------------------------------------------------------
1wp9C           ------------------IREQLQRKQNIVFTNYR----ETAKKIVNELVKDGIKAKRFVQREQ---KLI
1wp9B           ------------------IREQLQRKQNIVFTNYR----ETAKKIVNELVKDGIKAKRFGSQREQKL--I
2kbfA           -----------------------------------VATKKTANVLYGKLKSEGHVSILHGDLQTQERDRL
3gfpA           -----------------------------------VATKKTANVLYGKLKSEGHVSILHGDLQTQERDRL
2zu6C           QFYINVEREEWKLDTLCDLYETLTITQAVIFINTRRKVDWLTEKMHAR---DFTVSAMHGDMDQKERDVI


                         .         .         .         +         .         .         .:980
query           MVDFWEKKFDVLVCTTIVESGLDVPNANTLIVDRADTYGLAQLHQLRGRVGRGRERAYAYFLYPPDKPLT
2eyqB           MNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLRGRVGRSHHQAYAWLLTPHPKAMT
2eyqA           MNDFHHQRFNVLVCTTIIETGIDIPTANTIIIERADHFGLAQLHQLRGRVGRSHHQAYAWLLTPHPKAMT
1gm5A           MLEFAEGRYDILVSTTVIEVGIDVPRANVMVIENPERFGLAQLHQLRGRVGRGGQEAYCFLVV---GDVG
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           IRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGLRSERSLIQTIGRAARNANGHVIMYAD----
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           IRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGLRSERSLIQTIGRAARNANGHVIMYAD----
1d9xA           IRDLRLGKYDVLVGINLLREGLDIPEVSLVAILDADKEGLRSERSLIQTIGRAARNANGHVIMYAD----
2qsrA           ----------------------------------------------------------------------
3eaqA           LGAFRQGEVRVLVATDVAARGLDIPQVDLVVPDRAEAY-----QHRSGRTGRAGGR--VVLLYGPRERRD
3i32A           MGAFRQGEVRVLVATDVAARGLDIPQVDLVVPDRAEAY--------------------------------
2z0mA           IDAFREGEYDMLITTDVASRGLDIPLVEKVINFDAPQDLRTYIHRI-GRTGR------------------
3easA           LGAFRQGEVRVLVATDVAARGLDIPQVDLVVPDRAEAY--------------------------------
3earA           LGAFRQGEVRVLVATDVAARGLDIPQVDLVVPDRAEAY--------------------------------
3eaqB           LGAFRQGEVRVLVATDVAARGLDIPQVDLVVPDRAEAY--------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ILDFARGEFNVLVATSVGEEGLDVPEVD-LVVFYEPVPSAIRSIQRRGRTGR------------------
2db3A           LRDFKNGSMKVLIATSVASRGLDIKNIKHVIPSKIDDY----VHRI-GRTGRVGNNGRATSFFDPEK---
1wp9D           ----------------------------------------------------------------------
1wp9C           LDEFARGEFNVLVATSVGEEGLDVPEVD-LVVFYEPVPSAIRSIQRRGRTGR------------------
1wp9B           LDEFARGEFNVLVATSVGEEGLDVPEVD-LVVFYEPVPSAIRSIQRRGRTGR------------------
2kbfA           IDDFREGRSKVLITTNVLARGIDIPTVSMVVNYDLPTLANGQIHRI-GRTGRGRKGVAISFVH-------
3gfpA           IDDFREGRSKVLITTNVLARGIDIPTVSTLANGQADP--ATYIHRI-GRTGRGRKGVAISFVH-------
2zu6C           MREFRSGSSRVLITTDLLARGIDVQQVSLVINYDLPTNRENYIHRIGGRKG-------------------


                         .         *         .         .         .         .         +:1050
query           ETAHERLATVAQHTESGAGMYVAMKDLEIRGAGNILGTEQSGSIAGVGFDLYVRMVGEAVRELKGDQSAA
2eyqB           TDAQKRLEAIASLEDLGAGFALATHDLEIRGAGELLGEEQSGSMETIGFSLYMELLENAVDALKAGREPS
2eyqA           TDAQKRLEAIASLEDLGAGFALATHDLEIRGAGELLGEEQSGSMETIGFSLYMELLENAVDALKAGREPS
1gm5A           EEAMERLRFFTLNTD---GFKIAEYDLKTRGPG-------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           VEALER----------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           QEVETKVELPINAHIPHDYVPGERLRLEAYRRIAEVASEDDIAAIREELLDRYGEPPQPVDNLLAVARFR
2eyqB           LEQQTEVELRMPSLLPDDFIPDVNTRLSFYKRIASAKTENELEEIKVELIDRFGLLPDPARTLLDIARLR
2eyqA           LEQQTEVELRMPSLLPDDFIPDVNTRLSFYKRIASAKTENELEEIKVELIDRFGLLPDPARTLLDIARLR
1gm5A           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           --------LQIDAYLPDTYISDQRHKIEIYKKIRQIDNRVNYEELQEELIDRFGEYPDVVAYLLEI----
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:1190
query           VLARSAGLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2eyqB           QQAQKLGI--------------------------------------------------------------
2eyqA           QQAQKLGI--------------------------------------------------------------
1gm5A           ----------------------------------------------------------------------
2b2nB           ----------------------------------------------------------------------
2b2nA           ----------------------------------------------------------------------
1t5lA           ----------------------------------------------------------------------
2fdcB           ----------------------------------------------------------------------
2nmvA           ----------------------------------------------------------------------
2d7dA           ----------------------------------------------------------------------
3fpnB           ----------------------------------------------------------------------
1d9zA           ----------------------------------------------------------------------
1d9xA           ----------------------------------------------------------------------
2qsrA           ----------------------------------------------------------------------
3eaqA           ----------------------------------------------------------------------
3i32A           ----------------------------------------------------------------------
2z0mA           ----------------------------------------------------------------------
3easA           ----------------------------------------------------------------------
3earA           ----------------------------------------------------------------------
3eaqB           ----------------------------------------------------------------------
1d2mA           ----------------------------------------------------------------------
1wp9A           ----------------------------------------------------------------------
2db3A           ----------------------------------------------------------------------
1wp9D           ----------------------------------------------------------------------
1wp9C           ----------------------------------------------------------------------
1wp9B           ----------------------------------------------------------------------
2kbfA           ----------------------------------------------------------------------
3gfpA           ----------------------------------------------------------------------
2zu6C           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:1260
query           xxxxxxxxxxxxxxxxxxxx
2eyqB           --------------------
2eyqA           --------------------
1gm5A           --------------------
2b2nB           --------------------
2b2nA           --------------------
1t5lA           --------------------
2fdcB           --------------------
2nmvA           --------------------
2d7dA           --------------------
3fpnB           --------------------
1d9zA           --------------------
1d9xA           --------------------
2qsrA           --------------------
3eaqA           --------------------
3i32A           --------------------
2z0mA           --------------------
3easA           --------------------
3earA           --------------------
3eaqB           --------------------
1d2mA           --------------------
1wp9A           --------------------
2db3A           --------------------
1wp9D           --------------------
1wp9C           --------------------
1wp9B           --------------------
2kbfA           --------------------
3gfpA           --------------------
2zu6C           --------------------