[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ54538.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3f69B.bssp"
#ERROR : Can't open dsspfile "2q0nA.bssp"
#ERROR : Can't open dsspfile "2j0iA.bssp"
#ERROR : Can't open dsspfile "2fumB.bssp"
#ERROR : Can't open dsspfile "2fumA.bssp"
#ERROR : Can't open dsspfile "2cdzA.bssp"
#ERROR : Can't open dsspfile "3f69A.bssp"
#ERROR : Can't open dsspfile "2bvaB.bssp"
#ERROR : Can't open dsspfile "2bvaA.bssp"
#ERROR : Can't open dsspfile "1mruB.bssp"
#ERROR : Can't open dsspfile "1mruA.bssp"
#ERROR : Can't open dsspfile "1yhvA.bssp"
#ERROR : Can't open dsspfile "1o6yA.bssp"
#ERROR : Can't open dsspfile "1yhwA.bssp"
#ERROR : Can't open dsspfile "2f57B.bssp"
#ERROR : Can't open dsspfile "2f57A.bssp"
#ERROR : Can't open dsspfile "2fumD.bssp"
#ERROR : Can't open dsspfile "3ckxA.bssp"
#ERROR : Can't open dsspfile "2c30A.bssp"
#ERROR : Can't open dsspfile "3fxzA.bssp"
#ERROR : Can't open dsspfile "3f61A.bssp"
#ERROR : Can't open dsspfile "1f3mC.bssp"
#ERROR : Can't open dsspfile "2vwiC.bssp"
#ERROR : Can't open dsspfile "1f3mD.bssp"
#ERROR : Can't open dsspfile "1u5qA.bssp"
#ERROR : Can't open dsspfile "3dakD.bssp"
#ERROR : Can't open dsspfile "3ggfA.bssp"
#ERROR : Can't open dsspfile "1fotA.bssp"
#ERROR : Can't open dsspfile "2vz6B.bssp"
#ERROR : Can't open dsspfile "2vz6A.bssp"
#ERROR : Can't open dsspfile "3ggfB.bssp"
#ERROR : Can't open dsspfile "2fumC.bssp"
#ERROR : Can't open dsspfile "3dbqA.bssp"
#ERROR : Can't open dsspfile "3c4yA.bssp"
#ERROR : Can't open dsspfile "1ol7A.bssp"
#ERROR : Can't open dsspfile "1ol5A.bssp"
#ERROR : Can't open dsspfile "3ha6A.bssp"
#ERROR : Can't open dsspfile "2j4zB.bssp"
#ERROR : Can't open dsspfile "2j4zA.bssp"
#ERROR : Can't open dsspfile "3h10B.bssp"
#ERROR : Can't open dsspfile "3h10A.bssp"
#ERROR : Can't open dsspfile "3gfwA.bssp"
#ERROR : Can't open dsspfile "3dakA.bssp"
#ERROR : Can't open dsspfile "3c51A.bssp"
#ERROR : Can't open dsspfile "3c50B.bssp"
#ERROR : Can't open dsspfile "3c50A.bssp"
#ERROR : Can't open dsspfile "3c4zA.bssp"
#ERROR : Can't open dsspfile "3c4yB.bssp"
#ERROR : Can't open dsspfile "3c4xB.bssp"
#ERROR : Can't open dsspfile "3c4xA.bssp"
#ERROR : Can't open dsspfile "3c4wB.bssp"
#ERROR : Can't open dsspfile "3c4wA.bssp"
#ERROR : Can't open dsspfile "3dy7A.bssp"
#ERROR : Can't open dsspfile "2zmcA.bssp"
#ERROR : Can't open dsspfile "2welA.bssp"
#ERROR : Can't open dsspfile "2vn9A.bssp"
#ERROR : Can't open dsspfile "3dj5A.bssp"
#ERROR : Can't open dsspfile "3c51B.bssp"
#ERROR : Can't open dsspfile "1mq4A.bssp"
#ERROR : Can't open dsspfile "3dakC.bssp"
#ERROR : Can't open dsspfile "2w1gA.bssp"
#ERROR : Can't open dsspfile "2vwiD.bssp"
#ERROR : Can't open dsspfile "2vwiA.bssp"
#ERROR : Can't open dsspfile "1s9jA.bssp"
#ERROR : Can't open dsspfile "1s9iB.bssp"
#ERROR : Can't open dsspfile "1muoA.bssp"
#ERROR : Can't open dsspfile "3h9fA.bssp"
#ERROR : Can't open dsspfile "3e5aA.bssp"
#ERROR : Can't open dsspfile "3dj7A.bssp"
#ERROR : Can't open dsspfile "3d14A.bssp"
#ERROR : Can't open dsspfile "3ckwA.bssp"
#ERROR : Can't open dsspfile "2w1fA.bssp"
#ERROR : Can't open dsspfile "1s9iA.bssp"
#ERROR : Can't open dsspfile "1ql6A.bssp"
#ERROR : Can't open dsspfile "3eqcA.bssp"
#ERROR : Can't open dsspfile "3dv3A.bssp"
#ERROR : Can't open dsspfile "3d15A.bssp"
#ERROR : Can't open dsspfile "2c6dA.bssp"
#ERROR : Can't open dsspfile "2w7xA.bssp"
#ERROR : Can't open dsspfile "2vd5B.bssp"
#ERROR : Can't open dsspfile "3fdnA.bssp"
#ERROR : Can't open dsspfile "3eqiA.bssp"
#ERROR : Can't open dsspfile "3eqfA.bssp"
#ERROR : Can't open dsspfile "3d2iA.bssp"
#ERROR : Can't open dsspfile "2zmdA.bssp"
#ERROR : Can't open dsspfile "2w1eA.bssp"
#ERROR : Can't open dsspfile "3comB.bssp"
#ERROR : Can't open dsspfile "3comA.bssp"
#ERROR : Can't open dsspfile "2cn5A.bssp"
#ERROR : Can't open dsspfile "2vwiB.bssp"
#ERROR : Can't open dsspfile "1u7eA.bssp"
#ERROR : Can't open dsspfile "2r5tA.bssp"
#ERROR : Can't open dsspfile "3hdnA.bssp"
#ERROR : Can't open dsspfile "3hdmA.bssp"
#ERROR : Can't open dsspfile "3fhiA.bssp"
#ERROR : Can't open dsspfile "2c6eA.bssp"
#ERROR : Can't open dsspfile "2uztA.bssp"
#ERROR : Can't open dsspfile "2phkA.bssp"
#ERROR : Can't open dsspfile "1phkA.bssp"
#ERROR : Can't open dsspfile "2f7xE.bssp"
#ERROR : Can't open dsspfile "3e8nA.bssp"
#ERROR : Can't open dsspfile "2clqA.bssp"
#ERROR : Can't open dsspfile "3cekA.bssp"
#ERROR : Can't open dsspfile "3bhhD.bssp"
#ERROR : Can't open dsspfile "3bhhC.bssp"
#ERROR : Can't open dsspfile "3bhhB.bssp"
#ERROR : Can't open dsspfile "3bhhA.bssp"
#ERROR : Can't open dsspfile "2v7oA.bssp"
#ERROR : Can't open dsspfile "2clqB.bssp"
#ERROR : Can't open dsspfile "2biyA.bssp"
#ERROR : Can't open dsspfile "1uu8A.bssp"
#ERROR : Can't open dsspfile "1uu7A.bssp"
#ERROR : Can't open dsspfile "1sykB.bssp"
#ERROR : Can't open dsspfile "1sykA.bssp"
#ERROR : Can't open dsspfile "2jamB.bssp"
#ERROR : Can't open dsspfile "2jamA.bssp"
#ERROR : Can't open dsspfile "2gnlA.bssp"
#ERROR : Can't open dsspfile "2gnjA.bssp"
#ERROR : Can't open dsspfile "2bmcF.bssp"
#ERROR : Can't open dsspfile "2bmcC.bssp"
#ERROR : Can't open dsspfile "2bmcB.bssp"
#ERROR : Can't open dsspfile "2bmcA.bssp"
#ERROR : Can't open dsspfile "1ydrE.bssp"
#ERROR : Can't open dsspfile "1xh8A.bssp"
#ERROR : Can't open dsspfile "1xh6A.bssp"
#ERROR : Can't open dsspfile "1stcE.bssp"
#ERROR : Can't open dsspfile "1rejA.bssp"
#ERROR : Can't open dsspfile "2qvsE.bssp"
#ERROR : Can't open dsspfile "2qurA.bssp"
#ERROR : Can't open dsspfile "1q8uA.bssp"
#ERROR : Can't open dsspfile "1q8tA.bssp"
#ERROR : Can't open dsspfile "1jbpE.bssp"
#ERROR : Can't open dsspfile "3idbA.bssp"
#ERROR : Can't open dsspfile "2gu8A.bssp"
#ERROR : Can't open dsspfile "1fmoE.bssp"
#ERROR : Can't open dsspfile "3fjqE.bssp"
#ERROR : Can't open dsspfile "3e8eI.bssp"
#ERROR : Can't open dsspfile "3e8cE.bssp"
#ERROR : Can't open dsspfile "3e8cB.bssp"
#ERROR : Can't open dsspfile "3dneA.bssp"
#ERROR : Can't open dsspfile "3dndA.bssp"
#ERROR : Can't open dsspfile "1ctpE.bssp"
#ERROR : Can't open dsspfile "1cmkE.bssp"
#ERROR : Can't open dsspfile "1cdkA.bssp"
#ERROR : Can't open dsspfile "2c1aA.bssp"
#ERROR : Can't open dsspfile "1bkxA.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "2w5bA.bssp"
#ERROR : Can't open dsspfile "2w1dA.bssp"
#ERROR : Can't open dsspfile "1okyA.bssp"
#ERROR : Can't open dsspfile "2nruB.bssp"
#ERROR : Can't open dsspfile "2nruA.bssp"
#ERROR : Can't open dsspfile "2np8A.bssp"
#ERROR : Can't open dsspfile "1j3hB.bssp"
#ERROR : Can't open dsspfile "1j3hA.bssp"
#ERROR : Can't open dsspfile "3h10D.bssp"
#ERROR : Can't open dsspfile "1h1wA.bssp"
#ERROR : Can't open dsspfile "3dakB.bssp"
#ERROR : Can't open dsspfile "2w0jA.bssp"
#ERROR : Can't open dsspfile "2gngA.bssp"
#ERROR : Can't open dsspfile "2gnfA.bssp"
#ERROR : Can't open dsspfile "2evaA.bssp"
#ERROR : Can't open dsspfile "1xh9A.bssp"
#ERROR : Can't open dsspfile "2qg5D.bssp"
#ERROR : Can't open dsspfile "2qg5B.bssp"
#ERROR : Can't open dsspfile "2qg5A.bssp"
#ERROR : Can't open dsspfile "3h0zA.bssp"
#ERROR : Can't open dsspfile "3h0yA.bssp"
#ERROR : Can't open dsspfile "3f3zA.bssp"
#ERROR : Can't open dsspfile "1uu9A.bssp"
#ERROR : Can't open dsspfile "1smhA.bssp"
#ERROR : Can't open dsspfile "1okzA.bssp"
#ERROR : Can't open dsspfile "2nryA.bssp"
#ERROR : Can't open dsspfile "3h9oA.bssp"
#ERROR : Can't open dsspfile "1z5mA.bssp"
#ERROR : Can't open dsspfile "2vo0A.bssp"
#ERROR : Can't open dsspfile "2uw4A.bssp"
#ERROR : Can't open dsspfile "2uvxA.bssp"
#ERROR : Can't open dsspfile "1uu3A.bssp"
#ERROR : Can't open dsspfile "2r7bA.bssp"
#ERROR : Can't open dsspfile "1q61A.bssp"
#ERROR : Can't open dsspfile "2jdtA.bssp"
#ERROR : Can't open dsspfile "2j50A.bssp"
#ERROR : Can't open dsspfile "3c0iA.bssp"
#ERROR : Can't open dsspfile "3c0hA.bssp"
#ERROR : Can't open dsspfile "3c0gB.bssp"
#ERROR : Can't open dsspfile "3c0gA.bssp"
#ERROR : Can't open dsspfile "3bqrA.bssp"
#ERROR : Can't open dsspfile "1q62A.bssp"
#ERROR : Can't open dsspfile "1q24A.bssp"
#ERROR : Can't open dsspfile "2nryD.bssp"
#ERROR : Can't open dsspfile "1xh7A.bssp"
#ERROR : Can't open dsspfile "1vzoA.bssp"
#ERROR : Can't open dsspfile "2uv2A.bssp"
#ERROR : Can't open dsspfile "2qcsA.bssp"
#ERROR : Can't open dsspfile "1q8wA.bssp"
#ERROR : Can't open dsspfile "1l3rE.bssp"
#ERROR : Can't open dsspfile "2jflA.bssp"
#ERROR : Can't open dsspfile "2j51A.bssp"
#ERROR : Can't open dsspfile "3hrcA.bssp"
#ERROR : Can't open dsspfile "3h0zC.bssp"
#ERROR : Can't open dsspfile "3h0zB.bssp"
#ERROR : Can't open dsspfile "2cpkE.bssp"
#ERROR : Can't open dsspfile "3bwjA.bssp"
#ERROR : Can't open dsspfile "2i0eB.bssp"
#ERROR : Can't open dsspfile "2i0eA.bssp"
#ERROR : Can't open dsspfile "3cohA.bssp"
#ERROR : Can't open dsspfile "2yzaA.bssp"
#ERROR : Can't open dsspfile "1rdqE.bssp"
#ERROR : Can't open dsspfile "2oibD.bssp"
#ERROR : Can't open dsspfile "3hrfA.bssp"
#ERROR : Can't open dsspfile "2oicD.bssp"
#ERROR : Can't open dsspfile "2nryC.bssp"
#ERROR : Can't open dsspfile "3dqxA.bssp"
#ERROR : Can't open dsspfile "2dq7X.bssp"
#ERROR : Can't open dsspfile "3d5uA.bssp"
#ERROR : Can't open dsspfile "2c6eB.bssp"
#ERROR : Can't open dsspfile "1y57A.bssp"
#ERROR : Can't open dsspfile "2srcA.bssp"
#ERROR : Can't open dsspfile "2oibB.bssp"
#ERROR : Can't open dsspfile "2h8hA.bssp"
#ERROR : Can't open dsspfile "3db6A.bssp"
#ERROR : Can't open dsspfile "1zwsA.bssp"
#ERROR : Can't open dsspfile "2vo6A.bssp"
#ERROR : Can't open dsspfile "2uvzA.bssp"
#ERROR : Can't open dsspfile "2uvyA.bssp"
#ERROR : Can't open dsspfile "1szmB.bssp"
#ERROR : Can't open dsspfile "1szmA.bssp"
#ERROR : Can't open dsspfile "2oibC.bssp"
#ERROR : Can't open dsspfile "1kswA.bssp"
#ERROR : Can't open dsspfile "3i79A.bssp"
#ERROR : Can't open dsspfile "3hx4A.bssp"
#ERROR : Can't open dsspfile "2ckeB.bssp"
#ERROR : Can't open dsspfile "2ckeA.bssp"
#ERROR : Can't open dsspfile "2a2aB.bssp"
#ERROR : Can't open dsspfile "2a2aA.bssp"
#ERROR : Can't open dsspfile "1wmkH.bssp"
#ERROR : Can't open dsspfile "1wmkB.bssp"
#ERROR : Can't open dsspfile "1wmkE.bssp"
#ERROR : Can't open dsspfile "1wmkA.bssp"
#ERROR : Can't open dsspfile "2oibA.bssp"
#ERROR : Can't open dsspfile "2dwbA.bssp"
#ERROR : Can't open dsspfile "3dqwD.bssp"
#ERROR : Can't open dsspfile "3dqwC.bssp"
#ERROR : Can't open dsspfile "3dqwA.bssp"
#ERROR : Can't open dsspfile "3bhyA.bssp"
#ERROR : Can't open dsspfile "2a27A.bssp"
#ERROR : Can't open dsspfile "3dqxB.bssp"
#ERROR : Can't open dsspfile "2qnjA.bssp"
#ERROR : Can't open dsspfile "3f6xD.bssp"
#ERROR : Can't open dsspfile "3d2kA.bssp"
#ERROR : Can't open dsspfile "2cn8A.bssp"
#ERROR : Can't open dsspfile "1zrzA.bssp"
#ERROR : Can't open dsspfile "3h4jB.bssp"
#ERROR : Can't open dsspfile "3dajA.bssp"
#ERROR : Can't open dsspfile "2w4oA.bssp"
#ERROR : Can't open dsspfile "2oicA.bssp"
#ERROR : Can't open dsspfile "2jfmA.bssp"
#ERROR : Can't open dsspfile "2h6dA.bssp"
#ERROR : Can't open dsspfile "3f6xA.bssp"
#ERROR : Can't open dsspfile "3d5wA.bssp"
#ERROR : Can't open dsspfile "2qnjB.bssp"
#ERROR : Can't open dsspfile "1o6lA.bssp"
#ERROR : Can't open dsspfile "1o6kA.bssp"
#ERROR : Can't open dsspfile "2jdoA.bssp"
#ERROR : Can't open dsspfile "3g6hA.bssp"
#ERROR : Can't open dsspfile "3e8dB.bssp"
#ERROR : Can't open dsspfile "3e8dA.bssp"
#ERROR : Can't open dsspfile "3e88A.bssp"
#ERROR : Can't open dsspfile "3e87A.bssp"
#ERROR : Can't open dsspfile "3d0eA.bssp"
#ERROR : Can't open dsspfile "2cl1A.bssp"
#ERROR : Can't open dsspfile "2weiA.bssp"
#ERROR : Can't open dsspfile "2w5aA.bssp"
#ERROR : Can't open dsspfile "2vrxB.bssp"
#ERROR : Can't open dsspfile "2vgpB.bssp"
#ERROR : Can't open dsspfile "2vgpA.bssp"
#ERROR : Can't open dsspfile "2vgoA.bssp"
#ERROR : Can't open dsspfile "2oidB.bssp"
#ERROR : Can't open dsspfile "2oicB.bssp"
#ERROR : Can't open dsspfile "3f6xC.bssp"
#ERROR : Can't open dsspfile "2dylA.bssp"
#ERROR : Can't open dsspfile "2bfyB.bssp"
#ERROR : Can't open dsspfile "2bfyA.bssp"
#ERROR : Can't open dsspfile "2bfxB.bssp"
#ERROR : Can't open dsspfile "2bfxA.bssp"
#ERROR : Can't open dsspfile "1yrpA.bssp"
#ERROR : Can't open dsspfile "2oiqB.bssp"
#ERROR : Can't open dsspfile "3fe3A.bssp"
#ERROR : Can't open dsspfile "2oidD.bssp"
#ERROR : Can't open dsspfile "2j90A.bssp"
#ERROR : Can't open dsspfile "2bdfB.bssp"
#ERROR : Can't open dsspfile "1yi6A.bssp"
#ERROR : Can't open dsspfile "2pziA.bssp"
#ERROR : Can't open dsspfile "2j7tA.bssp"
#ERROR : Can't open dsspfile "3h4jA.bssp"
#ERROR : Can't open dsspfile "2pziB.bssp"
#ERROR : Can't open dsspfile "2hakE.bssp"
#ERROR : Can't open dsspfile "2wqeA.bssp"
#ERROR : Can't open dsspfile "3hztA.bssp"
#ERROR : Can't open dsspfile "3hkoA.bssp"
#ERROR : Can't open dsspfile "3f6xB.bssp"
#ERROR : Can't open dsspfile "3dxnA.bssp"
#ERROR : Can't open dsspfile "3d7tB.bssp"
#ERROR : Can't open dsspfile "2bdjA.bssp"
#ERROR : Can't open dsspfile "2bdfA.bssp"
#ERROR : Can't open dsspfile "1a06A.bssp"
#ERROR : Can't open dsspfile "2ozaA.bssp"
#ERROR : Can't open dsspfile "2j90B.bssp"
#ERROR : Can't open dsspfile "3en4B.bssp"
#ERROR : Can't open dsspfile "2bdwB.bssp"
#ERROR : Can't open dsspfile "2bdwA.bssp"
#ERROR : Can't open dsspfile "2v5qA.bssp"
#ERROR : Can't open dsspfile "2hakA.bssp"
#ERROR : Can't open dsspfile "1zmuB.bssp"
#ERROR : Can't open dsspfile "1zmuA.bssp"
#ERROR : Can't open dsspfile "2qr8A.bssp"
#ERROR : Can't open dsspfile "1p4fA.bssp"
#ERROR : Can't open dsspfile "2oidA.bssp"
#ERROR : Can't open dsspfile "3ehaA.bssp"
#ERROR : Can't open dsspfile "3eh9A.bssp"
#ERROR : Can't open dsspfile "2w5hA.bssp"
#ERROR : Can't open dsspfile "2rkuA.bssp"
#ERROR : Can't open dsspfile "2ou7A.bssp"
#ERROR : Can't open dsspfile "3fc2A.bssp"
#ERROR : Can't open dsspfile "3el8A.bssp"
#ERROR : Can't open dsspfile "3efwB.bssp"
#ERROR : Can't open dsspfile "3efwA.bssp"
#ERROR : Can't open dsspfile "1wvyA.bssp"
#ERROR : Can't open dsspfile "1wvwA.bssp"
#ERROR : Can't open dsspfile "2oidC.bssp"
#ERROR : Can't open dsspfile "1jktA.bssp"
#ERROR : Can't open dsspfile "1jkkA.bssp"
#ERROR : Can't open dsspfile "1ig1A.bssp"
#ERROR : Can't open dsspfile "3geqB.bssp"
#ERROR : Can't open dsspfile "3dgkA.bssp"
#ERROR : Can't open dsspfile "3dfcB.bssp"
#ERROR : Can't open dsspfile "1zmvB.bssp"
#ERROR : Can't open dsspfile "1zmvA.bssp"
#ERROR : Can't open dsspfile "2vd5A.bssp"
#ERROR : Can't open dsspfile "1k9aE.bssp"
#ERROR : Can't open dsspfile "1k9aD.bssp"
#ERROR : Can't open dsspfile "2javA.bssp"
#ERROR : Can't open dsspfile "1zmwB.bssp"
#ERROR : Can't open dsspfile "1zmwA.bssp"
#ERROR : Can't open dsspfile "2jbpC.bssp"
#ERROR : Can't open dsspfile "3hmiA.bssp"
#ERROR : Can't open dsspfile "2h9vA.bssp"
#ERROR : Can't open dsspfile "3fpmA.bssp"
#ERROR : Can't open dsspfile "2f2uB.bssp"
#ERROR : Can't open dsspfile "2f2uA.bssp"
#ERROR : Can't open dsspfile "3dbeA.bssp"
#ERROR : Can't open dsspfile "2oicC.bssp"
#ERROR : Can't open dsspfile "1mryA.bssp"
#ERROR : Can't open dsspfile "2jc6C.bssp"
#ERROR : Can't open dsspfile "2jc6A.bssp"
#ERROR : Can't open dsspfile "3geqA.bssp"
#ERROR : Can't open dsspfile "3g5dB.bssp"
#ERROR : Can't open dsspfile "3g5dA.bssp"
#ERROR : Can't open dsspfile "3f3uB.bssp"
#ERROR : Can't open dsspfile "3el8B.bssp"
#ERROR : Can't open dsspfile "3f3tB.bssp"
#ERROR : Can't open dsspfile "1k9aC.bssp"
#ERROR : Can't open dsspfile "1k9aA.bssp"
#ERROR : Can't open dsspfile "1fmkA.bssp"
#ERROR : Can't open dsspfile "3d7uA.bssp"
#ERROR : Can't open dsspfile "2v55C.bssp"
#ERROR : Can't open dsspfile "2v55A.bssp"
#ERROR : Can't open dsspfile "2r0iA.bssp"
#ERROR : Can't open dsspfile "1k9aB.bssp"
#ERROR : Can't open dsspfile "2jbpF.bssp"
#ERROR : Can't open dsspfile "2jbpE.bssp"
#ERROR : Can't open dsspfile "2jbpD.bssp"
#ERROR : Can't open dsspfile "2etkB.bssp"
#ERROR : Can't open dsspfile "2etkA.bssp"
#ERROR : Can't open dsspfile "2qlqB.bssp"
#ERROR : Can't open dsspfile "2o8yB.bssp"
#ERROR : Can't open dsspfile "3igoA.bssp"
#ERROR : Can't open dsspfile "2hakD.bssp"
#ERROR : Can't open dsspfile "2hakC.bssp"
#ERROR : Can't open dsspfile "3g6gB.bssp"
#ERROR : Can't open dsspfile "2vgoB.bssp"
#ERROR : Can't open dsspfile "2pzyB.bssp"
#ERROR : Can't open dsspfile "2onlD.bssp"
#ERROR : Can't open dsspfile "2onlC.bssp"
#ERROR : Can't open dsspfile "2h96A.bssp"
#ERROR : Can't open dsspfile "2gmxB.bssp"
#ERROR : Can't open dsspfile "2gmxA.bssp"
#ERROR : Can't open dsspfile "2g01B.bssp"
#ERROR : Can't open dsspfile "2g01A.bssp"
#ERROR : Can't open dsspfile "3dfaA.bssp"
#ERROR : Can't open dsspfile "1tkiA.bssp"
#ERROR : Can't open dsspfile "2qi8A.bssp"
#ERROR : Can't open dsspfile "2pzyD.bssp"
#ERROR : Can't open dsspfile "1ol6A.bssp"
#ERROR : Can't open dsspfile "2oiqA.bssp"
#ERROR : Can't open dsspfile "1k9aF.bssp"
#ERROR : Can't open dsspfile "3cqwA.bssp"
#ERROR : Can't open dsspfile "3cquA.bssp"
#ERROR : Can't open dsspfile "2zv9A.bssp"
#ERROR : Can't open dsspfile "2o8yA.bssp"
#ERROR : Can't open dsspfile "3g6gA.bssp"
#ERROR : Can't open dsspfile "1bygA.bssp"
#ERROR : Can't open dsspfile "2pl0A.bssp"
#ERROR : Can't open dsspfile "2of2A.bssp"
#ERROR : Can't open dsspfile "1koaA.bssp"
#ERROR : Can't open dsspfile "2jbpB.bssp"
#ERROR : Can't open dsspfile "2hw6A.bssp"
#ERROR : Can't open dsspfile "3en5B.bssp"
#ERROR : Can't open dsspfile "1gzkA.bssp"
#ERROR : Can't open dsspfile "3en4A.bssp"
#ERROR : Can't open dsspfile "3d7uD.bssp"
#ERROR : Can't open dsspfile "3d7uB.bssp"
#ERROR : Can't open dsspfile "3d7tA.bssp"
#ERROR : Can't open dsspfile "1qpjA.bssp"
#ERROR : Can't open dsspfile "1qpdA.bssp"
#ERROR : Can't open dsspfile "1qpcA.bssp"
#ERROR : Can't open dsspfile "2ofuA.bssp"
#ERROR : Can't open dsspfile "2jbpI.bssp"
#ERROR : Can't open dsspfile "3gvuA.bssp"
#ERROR : Can't open dsspfile "3f3vB.bssp"
#ERROR : Can't open dsspfile "3f3tA.bssp"
#ERROR : Can't open dsspfile "3e7oA.bssp"
#ERROR : Can't open dsspfile "3bymA.bssp"
#ERROR : Can't open dsspfile "1ym7D.bssp"
#ERROR : Can't open dsspfile "1ym7C.bssp"
#ERROR : Can't open dsspfile "1ym7A.bssp"
#ERROR : Can't open dsspfile "2wntA.bssp"
#ERROR : Can't open dsspfile "2qq7A.bssp"
#ERROR : Can't open dsspfile "1omwA.bssp"
#ERROR : Can't open dsspfile "2jboA.bssp"
#ERROR : Can't open dsspfile "3g6hB.bssp"
#ERROR : Can't open dsspfile "3cikA.bssp"
#ERROR : Can't open dsspfile "2bcjA.bssp"
#ERROR : Can't open dsspfile "2pzyC.bssp"
#ERROR : Can't open dsspfile "2ptkA.bssp"
#ERROR : Can't open dsspfile "1pmqA.bssp"
#ERROR : Can't open dsspfile "2hakG.bssp"
#ERROR : Can't open dsspfile "3fmeA.bssp"
#ERROR : Can't open dsspfile "3f3wB.bssp"
#ERROR : Can't open dsspfile "3f3wA.bssp"
#ERROR : Can't open dsspfile "1yolB.bssp"
#ERROR : Can't open dsspfile "1yolA.bssp"
#ERROR : Can't open dsspfile "2wajA.bssp"
#ERROR : Can't open dsspfile "3fi2A.bssp"
#ERROR : Can't open dsspfile "2fh9A.bssp"
#ERROR : Can't open dsspfile "2wntB.bssp"
#ERROR : Can't open dsspfile "2qkwB.bssp"
#ERROR : Can't open dsspfile "2i6lA.bssp"
#ERROR : Can't open dsspfile "3hgkC.bssp"
#ERROR : Can't open dsspfile "3hgkB.bssp"
#ERROR : Can't open dsspfile "3hgkA.bssp"
#ERROR : Can't open dsspfile "3b2wA.bssp"
#ERROR : Can't open dsspfile "2qi8B.bssp"
#ERROR : Can't open dsspfile "2jbpH.bssp"
#ERROR : Can't open dsspfile "3fv8A.bssp"
#ERROR : Can't open dsspfile "1zycD.bssp"
#ERROR : Can't open dsspfile "1zycC.bssp"
#ERROR : Can't open dsspfile "2zvaA.bssp"
#ERROR : Can't open dsspfile "2zv7A.bssp"
#ERROR : Can't open dsspfile "1yomA.bssp"
#ERROR : Can't open dsspfile "2pzyA.bssp"
#ERROR : Can't open dsspfile "2hw7A.bssp"
#ERROR : Can't open dsspfile "3en7A.bssp"
#ERROR : Can't open dsspfile "3bgzA.bssp"
#ERROR : Can't open dsspfile "1ua2A.bssp"
#ERROR : Can't open dsspfile "2ofvB.bssp"
#ERROR : Can't open dsspfile "3dlsF.bssp"
#ERROR : Can't open dsspfile "3dlsE.bssp"
#ERROR : Can't open dsspfile "3dlsD.bssp"
#ERROR : Can't open dsspfile "3dlsC.bssp"
#ERROR : Can't open dsspfile "3dlsB.bssp"
#ERROR : Can't open dsspfile "3dlsA.bssp"
#ERROR : Can't open dsspfile "3cy3A.bssp"
#ERROR : Can't open dsspfile "2c3iB.bssp"
#ERROR : Can't open dsspfile "1ny3A.bssp"
#ERROR : Can't open dsspfile "1kobA.bssp"
#ERROR : Can't open dsspfile "3k2lA.bssp"
#ERROR : Can't open dsspfile "2jbpG.bssp"
#ERROR : Can't open dsspfile "2o0uA.bssp"
#ERROR : Can't open dsspfile "3hyhA.bssp"
#ERROR : Can't open dsspfile "3famB.bssp"
#ERROR : Can't open dsspfile "2eueB.bssp"
#ERROR : Can't open dsspfile "3daeB.bssp"
#ERROR : Can't open dsspfile "3daeA.bssp"
#ERROR : Can't open dsspfile "3d5xA.bssp"
#ERROR : Can't open dsspfile "1cm8A.bssp"
#ERROR : Can't open dsspfile "1zycA.bssp"
#ERROR : Can't open dsspfile "1y8gB.bssp"
#ERROR : Can't open dsspfile "1y8gA.bssp"
#ERROR : Can't open dsspfile "2j0jA.bssp"
#ERROR : Can't open dsspfile "2g9xC.bssp"
#ERROR : Can't open dsspfile "3fi3A.bssp"
#ERROR : Can't open dsspfile "3d83A.bssp"
#ERROR : Can't open dsspfile "3cy2A.bssp"
#ERROR : Can't open dsspfile "3cxwA.bssp"
#ERROR : Can't open dsspfile "3blrA.bssp"
#ERROR : Can't open dsspfile "1zycB.bssp"
#ERROR : Can't open dsspfile "1qcfA.bssp"
#ERROR : Can't open dsspfile "1pmeA.bssp"
#ERROR : Can't open dsspfile "2jedB.bssp"
#ERROR : Can't open dsspfile "2jedA.bssp"
#ERROR : Can't open dsspfile "3hyhB.bssp"
#ERROR : Can't open dsspfile "2hwoA.bssp"
#ERROR : Can't open dsspfile "2hk5A.bssp"
#ERROR : Can't open dsspfile "3gc8B.bssp"
#ERROR : Can't open dsspfile "3gc8A.bssp"
#ERROR : Can't open dsspfile "3g33A.bssp"
#ERROR : Can't open dsspfile "3famA.bssp"
#ERROR : Can't open dsspfile "2etmA.bssp"
#ERROR : Can't open dsspfile "3blhA.bssp"
#ERROR : Can't open dsspfile "1zydA.bssp"
#ERROR : Can't open dsspfile "2rioB.bssp"
#ERROR : Can't open dsspfile "2jbpA.bssp"
#ERROR : Can't open dsspfile "2j0lA.bssp"
#ERROR : Can't open dsspfile "2ac5A.bssp"
#ERROR : Can't open dsspfile "1ukiA.bssp"
#ERROR : Can't open dsspfile "1pmuA.bssp"
#ERROR : Can't open dsspfile "2objA.bssp"
#ERROR : Can't open dsspfile "2fysA.bssp"
#ERROR : Can't open dsspfile "3fxxA.bssp"
#ERROR : Can't open dsspfile "3f2aA.bssp"
#ERROR : Can't open dsspfile "3en7B.bssp"
#ERROR : Can't open dsspfile "3dcvA.bssp"
#ERROR : Can't open dsspfile "3da6A.bssp"
#ERROR : Can't open dsspfile "2bujA.bssp"
#ERROR : Can't open dsspfile "2bikB.bssp"
#ERROR : Can't open dsspfile "2b9iA.bssp"
#ERROR : Can't open dsspfile "2b9fA.bssp"
#ERROR : Can't open dsspfile "2acxB.bssp"
#ERROR : Can't open dsspfile "2acxA.bssp"
#ERROR : Can't open dsspfile "2ac3A.bssp"
#ERROR : Can't open dsspfile "1yomB.bssp"
#ERROR : Can't open dsspfile "1xo2B.bssp"
#ERROR : Can't open dsspfile "2r3qA.bssp"
#ERROR : Can't open dsspfile "2r3iA.bssp"
#ERROR : Can't open dsspfile "1jowB.bssp"
#ERROR : Can't open dsspfile "2hwpB.bssp"
#ERROR : Can't open dsspfile "1gz8A.bssp"
#ERROR : Can't open dsspfile "3gc9B.bssp"
#ERROR : Can't open dsspfile "1g3nA.bssp"
#ERROR : Can't open dsspfile "2f2cB.bssp"
#ERROR : Can't open dsspfile "2eufB.bssp"
#ERROR : Can't open dsspfile "3dogC.bssp"
#ERROR : Can't open dsspfile "1blxA.bssp"
#ERROR : Can't open dsspfile "1bi8A.bssp"
#ERROR : Can't open dsspfile "1bi7A.bssp"
#ERROR : Can't open dsspfile "1zydB.bssp"
#ERROR : Can't open dsspfile "2zdtA.bssp"
#ERROR : Can't open dsspfile "2z7sA.bssp"
#ERROR : Can't open dsspfile "2z7rA.bssp"
#ERROR : Can't open dsspfile "2z7qA.bssp"
#ERROR : Can't open dsspfile "1pmvA.bssp"
#ERROR : Can't open dsspfile "1pmnA.bssp"
#ERROR : Can't open dsspfile "2p33A.bssp"
#ERROR : Can't open dsspfile "1oguC.bssp"
#ERROR : Can't open dsspfile "1mrvA.bssp"
#ERROR : Can't open dsspfile "1jnkA.bssp"
#ERROR : Can't open dsspfile "2hwoB.bssp"
#ERROR : Can't open dsspfile "3g9nA.bssp"
#ERROR : Can't open dsspfile "3g90X.bssp"
#ERROR : Can't open dsspfile "3fbvI.bssp"
#ERROR : Can't open dsspfile "3fbvD.bssp"
#ERROR : Can't open dsspfile "3fbvA.bssp"
#ERROR : Can't open dsspfile "2fa2B.bssp"
#ERROR : Can't open dsspfile "2fa2A.bssp"
#ERROR : Can't open dsspfile "2f49A.bssp"
#ERROR : Can't open dsspfile "3el7A.bssp"
#ERROR : Can't open dsspfile "3blqA.bssp"
#ERROR : Can't open dsspfile "3bhuC.bssp"
#ERROR : Can't open dsspfile "3bhtC.bssp"
#ERROR : Can't open dsspfile "2b9hA.bssp"
#ERROR : Can't open dsspfile "1yxsA.bssp"
#ERROR : Can't open dsspfile "1ywvA.bssp"
#ERROR : Can't open dsspfile "1xwsA.bssp"
#ERROR : Can't open dsspfile "1xqzA.bssp"
#ERROR : Can't open dsspfile "2w9zB.bssp"
#ERROR : Can't open dsspfile "2w99B.bssp"
#ERROR : Can't open dsspfile "2r9sA.bssp"
#ERROR : Can't open dsspfile "2qq7B.bssp"
#ERROR : Can't open dsspfile "2j2iB.bssp"
#ERROR : Can't open dsspfile "2i6lB.bssp"
#ERROR : Can't open dsspfile "3c4eC.bssp"
#ERROR : Can't open dsspfile "2bzkB.bssp"
#ERROR : Can't open dsspfile "2bzhB.bssp"
#ERROR : Can't open dsspfile "2bilB.bssp"
#ERROR : Can't open dsspfile "2w96B.bssp"
#ERROR : Can't open dsspfile "1w98A.bssp"
#ERROR : Can't open dsspfile "2qlqA.bssp"
#ERROR : Can't open dsspfile "1oiyA.bssp"
#ERROR : Can't open dsspfile "1oiuC.bssp"
#ERROR : Can't open dsspfile "1oi9A.bssp"
#ERROR : Can't open dsspfile "1oguA.bssp"
#ERROR : Can't open dsspfile "1jsuA.bssp"
#ERROR : Can't open dsspfile "1jstA.bssp"
#ERROR : Can't open dsspfile "2jgzA.bssp"
#ERROR : Can't open dsspfile "2iw9C.bssp"
#ERROR : Can't open dsspfile "2iw9A.bssp"
#ERROR : Can't open dsspfile "2iw8C.bssp"
#ERROR : Can't open dsspfile "2iw8A.bssp"
#ERROR : Can't open dsspfile "2iw6C.bssp"
#ERROR : Can't open dsspfile "2iw6A.bssp"
#ERROR : Can't open dsspfile "2hw6B.bssp"
#ERROR : Can't open dsspfile "1h4lA.bssp"
#ERROR : Can't open dsspfile "1h27C.bssp"
#ERROR : Can't open dsspfile "1h26C.bssp"
#ERROR : Can't open dsspfile "1h25C.bssp"
#ERROR : Can't open dsspfile "1h24A.bssp"
#ERROR : Can't open dsspfile "2g9xA.bssp"
#ERROR : Can't open dsspfile "3eljA.bssp"
#ERROR : Can't open dsspfile "1e9hA.bssp"
#ERROR : Can't open dsspfile "3dogA.bssp"
#ERROR : Can't open dsspfile "3ddqC.bssp"
#ERROR : Can't open dsspfile "3ddqA.bssp"
#ERROR : Can't open dsspfile "2cjmC.bssp"
#ERROR : Can't open dsspfile "2cjmA.bssp"
#ERROR : Can't open dsspfile "2cchA.bssp"
#ERROR : Can't open dsspfile "3bhtA.bssp"
#ERROR : Can't open dsspfile "2z8cA.bssp"
#ERROR : Can't open dsspfile "1xjdA.bssp"
#ERROR : Can't open dsspfile "1ir3A.bssp"
#ERROR : Can't open dsspfile "3fy2A.bssp"
#ERROR : Can't open dsspfile "3etaB.bssp"
#ERROR : Can't open dsspfile "1zxeD.bssp"
#ERROR : Can't open dsspfile "2w9fB.bssp"
#ERROR : Can't open dsspfile "2rioA.bssp"
#ERROR : Can't open dsspfile "2qocA.bssp"
#ERROR : Can't open dsspfile "2qkrA.bssp"
#ERROR : Can't open dsspfile "3bu5A.bssp"
#ERROR : Can't open dsspfile "3bu3A.bssp"
#ERROR : Can't open dsspfile "2auhA.bssp"
#ERROR : Can't open dsspfile "1yojB.bssp"
#ERROR : Can't open dsspfile "1kwpA.bssp"
#ERROR : Can't open dsspfile "2f9gA.bssp"
#ERROR : Can't open dsspfile "3en6B.bssp"
#ERROR : Can't open dsspfile "3en6A.bssp"
#ERROR : Can't open dsspfile "3en5A.bssp"
#ERROR : Can't open dsspfile "2e9nA.bssp"
#ERROR : Can't open dsspfile "3cblA.bssp"
#ERROR : Can't open dsspfile "3bkbA.bssp"
#ERROR : Can't open dsspfile "2aypA.bssp"
#ERROR : Can't open dsspfile "3gc9A.bssp"
#ERROR : Can't open dsspfile "3eidA.bssp"
#ERROR : Can't open dsspfile "3d7zA.bssp"
#ERROR : Can't open dsspfile "3bz3A.bssp"
#ERROR : Can't open dsspfile "2z7lA.bssp"
#ERROR : Can't open dsspfile "1v0oB.bssp"
#ERROR : Can't open dsspfile "1v0oA.bssp"
#ERROR : Can't open dsspfile "1v0bA.bssp"
#ERROR : Can't open dsspfile "1tvoA.bssp"
#ERROR : Can't open dsspfile "2ojiA.bssp"
#ERROR : Can't open dsspfile "2ojgA.bssp"
#ERROR : Can't open dsspfile "2iwiB.bssp"
#ERROR : Can't open dsspfile "2iwiA.bssp"
#ERROR : Can't open dsspfile "1ia8A.bssp"
#ERROR : Can't open dsspfile "1h0vA.bssp"
#ERROR : Can't open dsspfile "2gphA.bssp"
#ERROR : Can't open dsspfile "1golA.bssp"
#ERROR : Can't open dsspfile "3g9lX.bssp"
#ERROR : Can't open dsspfile "3etaA.bssp"
#ERROR : Can't open dsspfile "3erkA.bssp"
#ERROR : Can't open dsspfile "1erkA.bssp"
#ERROR : Can't open dsspfile "3enmC.bssp"
#ERROR : Can't open dsspfile "2cgxA.bssp"
#ERROR : Can't open dsspfile "2cgvA.bssp"
#ERROR : Can't open dsspfile "2cguA.bssp"
#ERROR : Can't open dsspfile "2c3kA.bssp"
#ERROR : Can't open dsspfile "2c3jA.bssp"
#ERROR : Can't open dsspfile "2brnA.bssp"
#ERROR : Can't open dsspfile "2a1aB.bssp"
#ERROR : Can't open dsspfile "2a19B.bssp"
#ERROR : Can't open dsspfile "1zysA.bssp"
#ERROR : Can't open dsspfile "1zy4A.bssp"
#ERROR : Can't open dsspfile "2zduA.bssp"
#ERROR : Can't open dsspfile "1yhsA.bssp"
#ERROR : Can't open dsspfile "2wmxA.bssp"
#ERROR : Can't open dsspfile "2wmwA.bssp"
#ERROR : Can't open dsspfile "2wmvA.bssp"
#ERROR : Can't open dsspfile "2wmuA.bssp"
#ERROR : Can't open dsspfile "2wmtA.bssp"
#ERROR : Can't open dsspfile "2wmsA.bssp"
#ERROR : Can't open dsspfile "2wmrA.bssp"
#ERROR : Can't open dsspfile "1unlA.bssp"
#ERROR : Can't open dsspfile "1unhA.bssp"
#ERROR : Can't open dsspfile "1ungB.bssp"
#ERROR : Can't open dsspfile "1ungA.bssp"
#ERROR : Can't open dsspfile "2r3kA.bssp"
#ERROR : Can't open dsspfile "2r0uA.bssp"
#ERROR : Can't open dsspfile "2qhnA.bssp"
#ERROR : Can't open dsspfile "2pz5B.bssp"
#ERROR : Can't open dsspfile "2pz5A.bssp"
#ERROR : Can't open dsspfile "2pmiC.bssp"
#ERROR : Can't open dsspfile "2pmiA.bssp"
#ERROR : Can't open dsspfile "2pk9C.bssp"
#ERROR : Can't open dsspfile "2pk9A.bssp"
#ERROR : Can't open dsspfile "2ok1A.bssp"
#ERROR : Can't open dsspfile "2ofvA.bssp"
#ERROR : Can't open dsspfile "2o2uA.bssp"
#ERROR : Can't open dsspfile "1nvrA.bssp"
#ERROR : Can't open dsspfile "3jvsA.bssp"
#ERROR : Can't open dsspfile "3jvrA.bssp"
#ERROR : Can't open dsspfile "2hogA.bssp"
#ERROR : Can't open dsspfile "3hmmA.bssp"
#ERROR : Can't open dsspfile "2gdoA.bssp"
#ERROR : Can't open dsspfile "3g2fA.bssp"
#ERROR : Can't open dsspfile "3f9nA.bssp"
#ERROR : Can't open dsspfile "2excX.bssp"
#ERROR : Can't open dsspfile "3enmB.bssp"
#ERROR : Can't open dsspfile "2cgwA.bssp"
#ERROR : Can't open dsspfile "3cd3A.bssp"
#ERROR : Can't open dsspfile "2c3lA.bssp"
#ERROR : Can't open dsspfile "3byuA.bssp"
#ERROR : Can't open dsspfile "2brmA.bssp"
#ERROR : Can't open dsspfile "2brhA.bssp"
#ERROR : Can't open dsspfile "2brgA.bssp"
#ERROR : Can't open dsspfile "1sm2A.bssp"
#ERROR : Can't open dsspfile "2r7iD.bssp"
#ERROR : Can't open dsspfile "2qo9A.bssp"
#ERROR : Can't open dsspfile "2pzrB.bssp"
#ERROR : Can't open dsspfile "2pzrA.bssp"
#ERROR : Can't open dsspfile "2pzpA.bssp"
#ERROR : Can't open dsspfile "2og8B.bssp"
#ERROR : Can't open dsspfile "1mqbB.bssp"
#ERROR : Can't open dsspfile "2i40A.bssp"
#ERROR : Can't open dsspfile "3enmD.bssp"
#ERROR : Can't open dsspfile "3enmA.bssp"
#ERROR : Can't open dsspfile "3e92A.bssp"
#ERROR : Can't open dsspfile "2b1pA.bssp"
#ERROR : Can't open dsspfile "1ykrA.bssp"
#ERROR : Can't open dsspfile "2wipC.bssp"
#ERROR : Can't open dsspfile "2wipA.bssp"
#ERROR : Can't open dsspfile "2w06A.bssp"
#ERROR : Can't open dsspfile "1vywC.bssp"
#ERROR : Can't open dsspfile "1vywA.bssp"
#ERROR : Can't open dsspfile "2vtrA.bssp"
#ERROR : Can't open dsspfile "2vtpA.bssp"
#ERROR : Can't open dsspfile "1uwhA.bssp"
#ERROR : Can't open dsspfile "2r3jA.bssp"
#ERROR : Can't open dsspfile "2r3hA.bssp"
#ERROR : Can't open dsspfile "2pvyD.bssp"
#ERROR : Can't open dsspfile "2ow3B.bssp"
#ERROR : Can't open dsspfile "2ow3A.bssp"
#ERROR : Can't open dsspfile "1okvC.bssp"
#ERROR : Can't open dsspfile "1okvA.bssp"
#ERROR : Can't open dsspfile "1oirA.bssp"
#ERROR : Can't open dsspfile "1o9uA.bssp"
#ERROR : Can't open dsspfile "1kwpB.bssp"
#ERROR : Can't open dsspfile "1jsvA.bssp"
#ERROR : Can't open dsspfile "2jkqA.bssp"
#ERROR : Can't open dsspfile "2jkmA.bssp"
#ERROR : Can't open dsspfile "2jkkA.bssp"
#ERROR : Can't open dsspfile "2j0kB.bssp"
#ERROR : Can't open dsspfile "1irkA.bssp"
#ERROR : Can't open dsspfile "2ijmB.bssp"
#ERROR : Can't open dsspfile "2ijmA.bssp"
#ERROR : Can't open dsspfile "2hwpA.bssp"
#ERROR : Can't open dsspfile "1hckA.bssp"
#ERROR : Can't open dsspfile "1h0uA.bssp"
#ERROR : Can't open dsspfile "1h01A.bssp"
#ERROR : Can't open dsspfile "1gngB.bssp"
#ERROR : Can't open dsspfile "1gngA.bssp"
#ERROR : Can't open dsspfile "3gc7A.bssp"
#ERROR : Can't open dsspfile "3f88A.bssp"
#ERROR : Can't open dsspfile "3f7zB.bssp"
#ERROR : Can't open dsspfile "3f7zA.bssp"
#ERROR : Can't open dsspfile "3f5xA.bssp"
#ERROR : Can't open dsspfile "1f5qC.bssp"
#ERROR : Can't open dsspfile "1f5qA.bssp"
#ERROR : Can't open dsspfile "2etmB.bssp"
#ERROR : Can't open dsspfile "3eqrB.bssp"
#ERROR : Can't open dsspfile "3eocC.bssp"
#ERROR : Can't open dsspfile "3ej1C.bssp"
#ERROR : Can't open dsspfile "3ej1A.bssp"
#ERROR : Can't open dsspfile "1e1vA.bssp"
#ERROR : Can't open dsspfile "2ds1A.bssp"
#ERROR : Can't open dsspfile "1di8A.bssp"
#ERROR : Can't open dsspfile "2clxA.bssp"
#ERROR : Can't open dsspfile "2c6iA.bssp"
#ERROR : Can't open dsspfile "2c68A.bssp"
#ERROR : Can't open dsspfile "2c5yA.bssp"
#ERROR : Can't open dsspfile "2c4gC.bssp"
#ERROR : Can't open dsspfile "2c4gA.bssp"
#ERROR : Can't open dsspfile "1buhA.bssp"
#ERROR : Can't open dsspfile "2bkzC.bssp"
#ERROR : Can't open dsspfile "2a4lA.bssp"
#ERROR : Can't open dsspfile "1nxkB.bssp"
#ERROR : Can't open dsspfile "3d4qA.bssp"
#ERROR : Can't open dsspfile "1agwB.bssp"
#ERROR : Can't open dsspfile "1zxeC.bssp"
#ERROR : Can't open dsspfile "1yojA.bssp"
#ERROR : Can't open dsspfile "2vtsA.bssp"
#ERROR : Can't open dsspfile "2vtoA.bssp"
#ERROR : Can't open dsspfile "1v0bB.bssp"
#ERROR : Can't open dsspfile "1uv5A.bssp"
#ERROR : Can't open dsspfile "1r0eA.bssp"
#ERROR : Can't open dsspfile "2qokA.bssp"
#ERROR : Can't open dsspfile "1q5kB.bssp"
#ERROR : Can't open dsspfile "1q5kA.bssp"
#ERROR : Can't open dsspfile "1q4lB.bssp"
#ERROR : Can't open dsspfile "1q4lA.bssp"
#ERROR : Can't open dsspfile "1q41B.bssp"
#ERROR : Can't open dsspfile "1q41A.bssp"
#ERROR : Can't open dsspfile "1q3wB.bssp"
#ERROR : Can't open dsspfile "1q3wA.bssp"
#ERROR : Can't open dsspfile "1q3dB.bssp"
#ERROR : Can't open dsspfile "1q3dA.bssp"
#ERROR : Can't open dsspfile "1pyxB.bssp"
#ERROR : Can't open dsspfile "1pyxA.bssp"
#ERROR : Can't open dsspfile "2pwlA.bssp"
#ERROR : Can't open dsspfile "2pvfA.bssp"
#ERROR : Can't open dsspfile "1ob3A.bssp"
#ERROR : Can't open dsspfile "2o5kA.bssp"
#ERROR : Can't open dsspfile "2jldB.bssp"
#ERROR : Can't open dsspfile "2jldA.bssp"
#ERROR : Can't open dsspfile "1j1bB.bssp"
#ERROR : Can't open dsspfile "1j1bA.bssp"
#ERROR : Can't open dsspfile "2j0kA.bssp"
#ERROR : Can't open dsspfile "2i0yA.bssp"
#ERROR : Can't open dsspfile "2i0vA.bssp"
#ERROR : Can't open dsspfile "1i09B.bssp"
#ERROR : Can't open dsspfile "1i09A.bssp"
#ERROR : Can't open dsspfile "1h8fB.bssp"
#ERROR : Can't open dsspfile "1h8fA.bssp"
#ERROR : Can't open dsspfile "3eidC.bssp"
#ERROR : Can't open dsspfile "3du8A.bssp"
#ERROR : Can't open dsspfile "2bajA.bssp"
#ERROR : Can't open dsspfile "3b2tB.bssp"
#ERROR : Can't open dsspfile "3b2tA.bssp"
#ERROR : Can't open dsspfile "2zb0A.bssp"
#ERROR : Can't open dsspfile "2zazA.bssp"
#ERROR : Can't open dsspfile "1yqjA.bssp"
#ERROR : Can't open dsspfile "1y91A.bssp"
#ERROR : Can't open dsspfile "2wmqA.bssp"
#ERROR : Can't open dsspfile "1wbsA.bssp"
#ERROR : Can't open dsspfile "2pvyA.bssp"
#ERROR : Can't open dsspfile "1oz1A.bssp"
#ERROR : Can't open dsspfile "1ouyA.bssp"
#ERROR : Can't open dsspfile "2ivsA.bssp"
#ERROR : Can't open dsspfile "1iasB.bssp"
#ERROR : Can't open dsspfile "3hrbA.bssp"
#ERROR : Can't open dsspfile "1h08A.bssp"
#ERROR : Can't open dsspfile "3gfeA.bssp"
#ERROR : Can't open dsspfile "3fz1A.bssp"
#ERROR : Can't open dsspfile "1di9A.bssp"
#ERROR : Can't open dsspfile "3d94A.bssp"
#ERROR : Can't open dsspfile "3cokA.bssp"
#ERROR : Can't open dsspfile "1bmkA.bssp"
#ERROR : Can't open dsspfile "1zxeA.bssp"
#ERROR : Can't open dsspfile "1vyzA.bssp"
#ERROR : Can't open dsspfile "1ukhA.bssp"
#ERROR : Can't open dsspfile "1sm2B.bssp"
#ERROR : Can't open dsspfile "2r7iC.bssp"
#ERROR : Can't open dsspfile "2r7iA.bssp"
#ERROR : Can't open dsspfile "2pwlB.bssp"
#ERROR : Can't open dsspfile "2p3gX.bssp"
#ERROR : Can't open dsspfile "2gtmA.bssp"
#ERROR : Can't open dsspfile "3fzoA.bssp"
#ERROR : Can't open dsspfile "2fysB.bssp"
#ERROR : Can't open dsspfile "3eknA.bssp"
#ERROR : Can't open dsspfile "3e3bX.bssp"
#ERROR : Can't open dsspfile "3db8A.bssp"
#ERROR : Can't open dsspfile "3cokB.bssp"
#ERROR : Can't open dsspfile "3clyA.bssp"
#ERROR : Can't open dsspfile "2c0tB.bssp"
#ERROR : Can't open dsspfile "2c0tA.bssp"
#ERROR : Can't open dsspfile "2c0iA.bssp"
#ERROR : Can't open dsspfile "3bw5A.bssp"
#ERROR : Can't open dsspfile "2zoqA.bssp"
#ERROR : Can't open dsspfile "2qr7A.bssp"
#ERROR : Can't open dsspfile "2psqB.bssp"
#ERROR : Can't open dsspfile "2psqA.bssp"
#ERROR : Can't open dsspfile "2og8A.bssp"
#ERROR : Can't open dsspfile "1nxkD.bssp"
#ERROR : Can't open dsspfile "1nxkC.bssp"
#ERROR : Can't open dsspfile "2jbpL.bssp"
#ERROR : Can't open dsspfile "2io6A.bssp"
#ERROR : Can't open dsspfile "2in6A.bssp"
#ERROR : Can't open dsspfile "1h0wA.bssp"
#ERROR : Can't open dsspfile "3e7oB.bssp"
#ERROR : Can't open dsspfile "3coiA.bssp"
#ERROR : Can't open dsspfile "3bysA.bssp"
#ERROR : Can't open dsspfile "3bizA.bssp"
#ERROR : Can't open dsspfile "2baqA.bssp"
#ERROR : Can't open dsspfile "1ad5A.bssp"
#ERROR : Can't open dsspfile "2zjwA.bssp"
#ERROR : Can't open dsspfile "1urwA.bssp"
#ERROR : Can't open dsspfile "2rkpA.bssp"
#ERROR : Can't open dsspfile "2pzpB.bssp"
#ERROR : Can't open dsspfile "2pvrA.bssp"
#ERROR : Can't open dsspfile "1pjkA.bssp"
#ERROR : Can't open dsspfile "1ob3B.bssp"
#ERROR : Can't open dsspfile "1na7A.bssp"
#ERROR : Can't open dsspfile "1jwhB.bssp"
#ERROR : Can't open dsspfile "1jwhA.bssp"
#ERROR : Can't open dsspfile "3ig7A.bssp"
#ERROR : Can't open dsspfile "3h30A.bssp"
#ERROR : Can't open dsspfile "3gxlA.bssp"
#ERROR : Can't open dsspfile "1fvtA.bssp"
#ERROR : Can't open dsspfile "2erkA.bssp"
#ERROR : Can't open dsspfile "3eb0C.bssp"
#ERROR : Can't open dsspfile "3eb0A.bssp"
#ERROR : Can't open dsspfile "3bqcA.bssp"
#ERROR : Can't open dsspfile "2balA.bssp"
#ERROR : Can't open dsspfile "1zy4B.bssp"
#ERROR : Can't open dsspfile "2wo6B.bssp"
#ERROR : Can't open dsspfile "2wo6A.bssp"
#ERROR : Can't open dsspfile "1wccA.bssp"
#ERROR : Can't open dsspfile "2vx3D.bssp"
#ERROR : Can't open dsspfile "2vx3C.bssp"
#ERROR : Can't open dsspfile "2vx3B.bssp"
#ERROR : Can't open dsspfile "2vx3A.bssp"
#ERROR : Can't open dsspfile "2vtiA.bssp"
#ERROR : Can't open dsspfile "2vthA.bssp"
#ERROR : Can't open dsspfile "2uznA.bssp"
#ERROR : Can't open dsspfile "2rg6A.bssp"
#ERROR : Can't open dsspfile "2r7iB.bssp"
#ERROR : Can't open dsspfile "2r3lA.bssp"
#ERROR : Can't open dsspfile "2okrA.bssp"
#ERROR : Can't open dsspfile "1nxkA.bssp"
#ERROR : Can't open dsspfile "1ke6A.bssp"
#ERROR : Can't open dsspfile "1jvpP.bssp"
#ERROR : Can't open dsspfile "2jkoA.bssp"
#ERROR : Can't open dsspfile "2jbpK.bssp"
#ERROR : Can't open dsspfile "2j0mB.bssp"
#ERROR : Can't open dsspfile "1giiA.bssp"
#ERROR : Can't open dsspfile "2ghlA.bssp"
#ERROR : Can't open dsspfile "2fb8A.bssp"
#ERROR : Can't open dsspfile "3e93A.bssp"
#ERROR : Can't open dsspfile "2e14A.bssp"
#ERROR : Can't open dsspfile "1ckpA.bssp"
#ERROR : Can't open dsspfile "3cg2A.bssp"
#ERROR : Can't open dsspfile "3c4cA.bssp"
#ERROR : Can't open dsspfile "3bv2A.bssp"
#ERROR : Can't open dsspfile "1zy5B.bssp"
#ERROR : Can't open dsspfile "2wouA.bssp"
#ERROR : Can't open dsspfile "2wotA.bssp"
#ERROR : Can't open dsspfile "1vjyA.bssp"
#ERROR : Can't open dsspfile "1uwjA.bssp"
#ERROR : Can't open dsspfile "1py5A.bssp"
#ERROR : Can't open dsspfile "1mqbA.bssp"
#ERROR : Can't open dsspfile "1iasA.bssp"
#ERROR : Can't open dsspfile "1h07A.bssp"
#ERROR : Can't open dsspfile "2gsfA.bssp"
#ERROR : Can't open dsspfile "3ds6A.bssp"
#ERROR : Can't open dsspfile "3cr0A.bssp"
#ERROR : Can't open dsspfile "2bujB.bssp"
#ERROR : Can't open dsspfile "1b6cB.bssp"
#ERROR : Can't open dsspfile "1zxeE.bssp"
#ERROR : Can't open dsspfile "1zxeB.bssp"
#ERROR : Can't open dsspfile "1v1kA.bssp"
#ERROR : Can't open dsspfile "2pmlX.bssp"
#ERROR : Can't open dsspfile "1oitA.bssp"
#ERROR : Can't open dsspfile "1lezA.bssp"
#ERROR : Can't open dsspfile "2ivvA.bssp"
#ERROR : Can't open dsspfile "2ivuA.bssp"
#ERROR : Can't open dsspfile "2ivtA.bssp"
#ERROR : Can't open dsspfile "3eqpA.bssp"
#ERROR : Can't open dsspfile "3eqpB.bssp"
#ERROR : Can't open dsspfile "3c9wA.bssp"
#ERROR : Can't open dsspfile "3c4cB.bssp"
#ERROR : Can't open dsspfile "1ywrA.bssp"
#ERROR : Can't open dsspfile "2qluA.bssp"
#ERROR : Can't open dsspfile "2qd9A.bssp"
#ERROR : Can't open dsspfile "1lewA.bssp"
#ERROR : Can't open dsspfile "3idpA.bssp"
#ERROR : Can't open dsspfile "1i44A.bssp"
#ERROR : Can't open dsspfile "1h00A.bssp"
#ERROR : Can't open dsspfile "3gxjA.bssp"
#ERROR : Can't open dsspfile "3gcqA.bssp"
#ERROR : Can't open dsspfile "3eqrA.bssp"
#ERROR : Can't open dsspfile "2zb1A.bssp"
#ERROR : Can't open dsspfile "2vtjA.bssp"
#ERROR : Can't open dsspfile "2r3nA.bssp"
#ERROR : Can't open dsspfile "2hakH.bssp"
#ERROR : Can't open dsspfile "3gp0A.bssp"
#ERROR : Can't open dsspfile "3g2fB.bssp"
#ERROR : Can't open dsspfile "3fqeA.bssp"
#ERROR : Can't open dsspfile "2duvA.bssp"
#ERROR : Can't open dsspfile "2z2wA.bssp"
#ERROR : Can't open dsspfile "1x8bA.bssp"
#ERROR : Can't open dsspfile "2rg5A.bssp"
#ERROR : Can't open dsspfile "2pvyB.bssp"
#ERROR : Can't open dsspfile "2onlA.bssp"
#ERROR : Can't open dsspfile "1mp8A.bssp"
#ERROR : Can't open dsspfile "3gcvA.bssp"
#ERROR : Can't open dsspfile "3faaA.bssp"
#ERROR : Can't open dsspfile "2c47C.bssp"
#ERROR : Can't open dsspfile "2c47B.bssp"
#ERROR : Can't open dsspfile "2c47A.bssp"
#ERROR : Can't open dsspfile "3bi6A.bssp"
#ERROR : Can't open dsspfile "1zxeF.bssp"
#ERROR : Can't open dsspfile "1uwjB.bssp"
#ERROR : Can't open dsspfile "1u54A.bssp"
#ERROR : Can't open dsspfile "2jbpJ.bssp"
#ERROR : Can't open dsspfile "3bx5A.bssp"
#ERROR : Can't open dsspfile "1u54B.bssp"
#ERROR : Can't open dsspfile "1u46B.bssp"
#ERROR : Can't open dsspfile "2qo2A.bssp"
#ERROR : Can't open dsspfile "2pvyC.bssp"
#ERROR : Can't open dsspfile "2ivsB.bssp"
#ERROR : Can't open dsspfile "2c47D.bssp"
#ERROR : Can't open dsspfile "2btrA.bssp"
#ERROR : Can't open dsspfile "1zyjA.bssp"
#ERROR : Can't open dsspfile "1u4dA.bssp"
#ERROR : Can't open dsspfile "2okrD.bssp"
#ERROR : Can't open dsspfile "3gcuA.bssp"
#ERROR : Can't open dsspfile "3gcpA.bssp"
#ERROR : Can't open dsspfile "2fvdA.bssp"
#ERROR : Can't open dsspfile "3e3pB.bssp"
#ERROR : Can't open dsspfile "3e3pA.bssp"
#ERROR : Can't open dsspfile "3cc6A.bssp"
#ERROR : Can't open dsspfile "1p14A.bssp"
#ERROR : Can't open dsspfile "3idpB.bssp"
#ERROR : Can't open dsspfile "2cmwA.bssp"
#ERROR : Can't open dsspfile "3bceA.bssp"
#ERROR : Can't open dsspfile "2bakA.bssp"
#ERROR : Can't open dsspfile "2b52A.bssp"
#ERROR : Can't open dsspfile "1zz2A.bssp"
#ERROR : Can't open dsspfile "1u59A.bssp"
#ERROR : Can't open dsspfile "1u46A.bssp"
#ERROR : Can't open dsspfile "2qolA.bssp"
#ERROR : Can't open dsspfile "2puuA.bssp"
#ERROR : Can't open dsspfile "2ozaB.bssp"
#ERROR : Can't open dsspfile "3hp5A.bssp"
#ERROR : Can't open dsspfile "3hl7A.bssp"
#ERROR : Can't open dsspfile "2hakB.bssp"
#ERROR : Can't open dsspfile "2gtnA.bssp"
#ERROR : Can't open dsspfile "2ewaA.bssp"
#ERROR : Can't open dsspfile "3dzqA.bssp"
#ERROR : Can't open dsspfile "3ctqA.bssp"
#ERROR : Can't open dsspfile "1yw2A.bssp"
#ERROR : Can't open dsspfile "1xbcA.bssp"
#ERROR : Can't open dsspfile "1xbbA.bssp"
#ERROR : Can't open dsspfile "1xbaA.bssp"
#ERROR : Can't open dsspfile "1r39A.bssp"
#ERROR : Can't open dsspfile "2qooA.bssp"
#ERROR : Can't open dsspfile "2qobA.bssp"
#ERROR : Can't open dsspfile "1p2aA.bssp"
#ERROR : Can't open dsspfile "1kv1A.bssp"
#ERROR : Can't open dsspfile "1gijA.bssp"
#ERROR : Can't open dsspfile "1gihA.bssp"
#ERROR : Can't open dsspfile "3fqhB.bssp"
#ERROR : Can't open dsspfile "3dtcA.bssp"
#ERROR : Can't open dsspfile "1ckjB.bssp"
#ERROR : Can't open dsspfile "1ckjA.bssp"
#ERROR : Can't open dsspfile "2w17A.bssp"
#ERROR : Can't open dsspfile "2vv9A.bssp"
#ERROR : Can't open dsspfile "2v62B.bssp"
#ERROR : Can't open dsspfile "2v62A.bssp"
#ERROR : Can't open dsspfile "2r4bB.bssp"
#ERROR : Can't open dsspfile "2r4bA.bssp"
#ERROR : Can't open dsspfile "2qoiA.bssp"
#ERROR : Can't open dsspfile "2qofA.bssp"
#ERROR : Can't open dsspfile "2qodA.bssp"
#ERROR : Can't open dsspfile "3gcsA.bssp"
#ERROR : Can't open dsspfile "3et7A.bssp"
#ERROR : Can't open dsspfile "3bceB.bssp"

## Summary of PDB Search
:490
    3e-22  35%  3f69B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    7e-21  33%  2q0nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    7e-21  33%  2j0iA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    7e-21  35%  2fumB  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    7e-21  34%  2fumA  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    7e-21  33%  2cdzA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    1e-20  35%  3f69A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-20  32%  2bvaB  [x.x.x] P21-ACTIVATED KINASE 4
    3e-20  32%  2bvaA  [x.x.x] P21-ACTIVATED KINASE 4
    5e-20  34%  1mruB  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    5e-20  34%  1mruA  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    2e-19  30%  1yhvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    2e-19  34%  1o6yA  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE
    3e-19  30%  1yhwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    4e-19  30%  2f57B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 7
    4e-19  30%  2f57A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 7
    1e-18  34%  2fumD  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    2e-18  34%  3ckxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    4e-18  29%  2c30A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 6
    6e-18  30%  3fxzA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    6e-18  33%  3f61A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    6e-18  31%  1f3mC  [d.144.1] SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
    2e-17  27%  2vwiC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    2e-17  31%  1f3mD  [d.144.1] SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
    6e-17  28%  1u5qA  [d.144.1] SERINE/THREONINE PROTEIN KINASE TAO2
    8e-17  27%  3dakD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    1e-16  33%  3ggfA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MST4
    2e-16  28%  1fotA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE TYPE 1
    3e-16  30%  2vz6B  [x.x.x] CALCIUM CALMODULIN DEPENDENT PROTEIN KINASE TYPE
    3e-16  30%  2vz6A  [x.x.x] CALCIUM CALMODULIN DEPENDENT PROTEIN KINASE TYPE
    5e-16  32%  3ggfB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MST4
    7e-16  32%  2fumC  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    7e-16  40%  3dbqA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    9e-16  37%  3c4yA  [x.x.x] RHODOPSIN KINASE
    2e-15  30%  1ol7A  [d.144.1] SERINE/THREONINE KINASE 6
    2e-15  30%  1ol5A  [d.144.1] SERINE/THREONINE KINASE 6
    2e-15  30%  3ha6A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-15  29%  2j4zB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    2e-15  29%  2j4zA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    2e-15  29%  3h10B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-15  29%  3h10A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-15  41%  3gfwA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    3e-15  28%  3dakA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    3e-15  37%  3c51A  [x.x.x] RHODOPSIN KINASE
    3e-15  37%  3c50B  [x.x.x] RHODOPSIN KINASE
    3e-15  37%  3c50A  [x.x.x] RHODOPSIN KINASE
    3e-15  37%  3c4zA  [x.x.x] RHODOPSIN KINASE
    3e-15  37%  3c4yB  [x.x.x] RHODOPSIN KINASE
    3e-15  37%  3c4xB  [x.x.x] RHODOPSIN KINASE
    3e-15  37%  3c4xA  [x.x.x] RHODOPSIN KINASE
    3e-15  37%  3c4wB  [x.x.x] RHODOPSIN KINASE
    3e-15  37%  3c4wA  [x.x.x] RHODOPSIN KINASE
    3e-15  27%  3dy7A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    4e-15  39%  2zmcA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    4e-15  30%  2welA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-15  30%  2vn9A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-15  31%  3dj5A  [x.x.x] SERINE/THREONINE KINASE 6
    4e-15  41%  3c51B  [x.x.x] RHODOPSIN KINASE
    6e-15  30%  1mq4A  [d.144.1] AURORA-RELATED KINASE 1
    6e-15  28%  3dakC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    8e-15  31%  2w1gA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    8e-15  29%  2vwiD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    8e-15  33%  2vwiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    8e-15  27%  1s9jA  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    8e-15  28%  1s9iB  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    1e-14  31%  1muoA  [d.144.1] AURORA-RELATED KINASE 1
    1e-14  39%  3h9fA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    1e-14  29%  3e5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-14  31%  3dj7A  [x.x.x] SERINE/THREONINE KINASE 6
    1e-14  31%  3d14A  [x.x.x] SERINE/THREONINE KINASE 6
    1e-14  34%  3ckwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    1e-14  31%  2w1fA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-14  29%  1s9iA  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    1e-14  28%  1ql6A  [d.144.1] PHOSPHORYLASE KINASE
    1e-14  27%  3eqcA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    1e-14  27%  3dv3A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    1e-14  31%  3d15A  [x.x.x] SERINE/THREONINE KINASE 6
    1e-14  31%  2c6dA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-14  32%  2w7xA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    2e-14  31%  2vd5B  [x.x.x] DMPK PROTEIN
    2e-14  30%  3fdnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-14  26%  3eqiA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    2e-14  26%  3eqfA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    2e-14  31%  3d2iA  [x.x.x] SERINE/THREONINE KINASE 6
    2e-14  38%  2zmdA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    2e-14  31%  2w1eA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-14  30%  3comB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    2e-14  30%  3comA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    2e-14  32%  2cn5A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    3e-14  27%  2vwiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    3e-14  30%  1u7eA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-14  29%  2r5tA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    3e-14  29%  3hdnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    3e-14  29%  3hdmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    3e-14  30%  3fhiA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    3e-14  31%  2c6eA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-14  29%  2uztA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-14  27%  2phkA  [d.144.1] PHOSPHORYLASE KINASE
    4e-14  27%  1phkA  [x.x.x] PHOSPHORYLASE KINASE
    4e-14  29%  2f7xE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-14  26%  3e8nA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    4e-14  32%  2clqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 5
    4e-14  40%  3cekA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    4e-14  30%  3bhhD  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-14  30%  3bhhC  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-14  30%  3bhhB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-14  30%  3bhhA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    5e-14  30%  2v7oA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    5e-14  32%  2clqB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 5
    5e-14  29%  2biyA  [x.x.x] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    6e-14  30%  1uu8A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    6e-14  30%  1uu7A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    6e-14  29%  1sykB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    6e-14  29%  1sykA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    6e-14  30%  2jamB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    6e-14  30%  2jamA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    6e-14  29%  2gnlA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    6e-14  29%  2gnjA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    6e-14  30%  2bmcF  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    6e-14  30%  2bmcC  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    6e-14  30%  2bmcB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    6e-14  30%  2bmcA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    8e-14  29%  1ydrE  [d.144.1] C-AMP-DEPENDENT PROTEIN KINASE
    8e-14  29%  1xh8A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-14  29%  1xh6A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-14  29%  1stcE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    8e-14  29%  1rejA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-14  29%  2qvsE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-14  29%  2qurA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-14  29%  1q8uA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-14  29%  1q8tA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-14  29%  1jbpE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-14  29%  3idbA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-14  29%  2gu8A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    8e-14  29%  1fmoE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    8e-14  29%  3fjqE  [d.144.1 (1atpE)] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC
    8e-14  29%  3e8eI  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-14  29%  3e8cE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-14  29%  3e8cB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-14  29%  3dneA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-14  29%  3dndA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-14  29%  1ctpE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    8e-14  29%  1cmkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    8e-14  29%  1cdkA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    8e-14  29%  2c1aA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE
    8e-14  29%  1bkxA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    8e-14  29%  1apmE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-13  34%  2w5bA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    1e-13  31%  2w1dA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-13  29%  1okyA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
    1e-13  30%  2nruB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-13  30%  2nruA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-13  29%  2np8A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-13  29%  1j3hB  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  29%  1j3hA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  30%  3h10D  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-13  29%  1h1wA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    1e-13  27%  3dakB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    1e-13  32%  2w0jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    1e-13  29%  2gngA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  29%  2gnfA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  33%  2evaA  [x.x.x] TAK1 KINASE - TAB1 CHIMERA FUSION PROTEIN
    2e-13  28%  1xh9A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  27%  2qg5D  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    2e-13  27%  2qg5B  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    2e-13  27%  2qg5A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    2e-13  30%  3h0zA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-13  30%  3h0yA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-13  27%  3f3zA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE WITH
    2e-13  30%  1uu9A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    2e-13  28%  1smhA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  30%  1okzA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
    2e-13  32%  2nryA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-13  30%  3h9oA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    3e-13  30%  1z5mA  [x.x.x] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    3e-13  28%  2vo0A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-13  28%  2uw4A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-13  28%  2uvxA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-13  30%  1uu3A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    3e-13  30%  2r7bA  [x.x.x] PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    3e-13  28%  1q61A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-13  28%  2jdtA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE
    3e-13  31%  2j50A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-13  29%  3c0iA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    3e-13  29%  3c0hA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    3e-13  29%  3c0gB  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    3e-13  29%  3c0gA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    3e-13  31%  3bqrA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    4e-13  28%  1q62A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-13  28%  1q24A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-13  33%  2nryD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    5e-13  31%  1xh7A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    5e-13  30%  1vzoA  [d.144.1] RIBOSOMAL PROTEIN S6 KINASE ALPHA 5
    5e-13  28%  2uv2A  [x.x.x] STE20-LIKE SERINE-THREONINE KINASE
    5e-13  31%  2qcsA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    5e-13  31%  1q8wA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    5e-13  31%  1l3rE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    5e-13  29%  2jflA  [x.x.x] STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
    5e-13  28%  2j51A  [x.x.x] STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
    5e-13  28%  3hrcA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    5e-13  30%  3h0zC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-13  30%  3h0zB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-13  31%  2cpkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, CATALYTIC SUBUNIT
    5e-13  31%  3bwjA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-13  33%  2i0eB  [x.x.x] PROTEIN KINASE C-BETA II
    7e-13  33%  2i0eA  [x.x.x] PROTEIN KINASE C-BETA II
    7e-13  30%  3cohA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    9e-13  31%  2yzaA  [x.x.x] 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC
    9e-13  29%  1rdqE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    9e-13  32%  2oibD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    9e-13  28%  3hrfA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    1e-12  30%  2oicD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-12  30%  2nryC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-12  31%  3dqxA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-12  27%  2dq7X  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FYN
    1e-12  24%  3d5uA  [x.x.x] POLO-LIKE KINASE 1
    1e-12  30%  2c6eB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-12  30%  1y57A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-12  30%  2srcA  [x.x.x] TYROSINE-PROTEIN KINASE SRC
    2e-12  32%  2oibB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-12  30%  2h8hA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-12  24%  3db6A  [x.x.x] POLO-LIKE KINASE 1
    2e-12  25%  1zwsA  [x.x.x] DAP-KINASE RELATED PROTEIN 1
    2e-12  29%  2vo6A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  29%  2uvzA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  29%  2uvyA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  29%  1szmB  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  29%  1szmA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  31%  2oibC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-12  30%  1kswA  [b.34.2 - d.93.1 - d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN
    2e-12  24%  3i79A  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    2e-12  26%  3hx4A  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    2e-12  25%  2ckeB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-12  25%  2ckeA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-12  25%  2a2aB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-12  25%  2a2aA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    3e-12  25%  1wmkH  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    3e-12  25%  1wmkB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    3e-12  25%  1wmkE  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    3e-12  25%  1wmkA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    3e-12  31%  2oibA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    3e-12  30%  2dwbA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-12  29%  3dqwD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-12  29%  3dqwC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-12  29%  3dqwA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-12  31%  3bhyA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    3e-12  25%  2a27A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    4e-12  30%  3dqxB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-12  28%  2qnjA  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    5e-12  31%  3f6xD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-12  31%  3d2kA  [x.x.x] SERINE/THREONINE KINASE 6
    5e-12  32%  2cn8A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    6e-12  29%  1zrzA  [x.x.x] PROTEIN KINASE C, IOTA
    6e-12  28%  3h4jB  [x.x.x] SNF1-LIKE PROTEIN KINASE SSP2
    6e-12  32%  3dajA  [x.x.x] SERINE/THREONINE KINASE 6
    8e-12  34%  2w4oA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    8e-12  30%  2oicA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    8e-12  28%  2jfmA  [x.x.x] STE20-LIKE SERINE-THREONINE KINASE
    8e-12  31%  2h6dA  [x.x.x] 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC
    8e-12  32%  3f6xA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-12  24%  3d5wA  [x.x.x] POLO-LIKE KINASE 1
    1e-11  28%  2qnjB  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    1e-11  32%  1o6lA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    1e-11  32%  1o6kA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    1e-11  32%  2jdoA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-11  31%  3g6hA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-11  32%  3e8dB  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-11  32%  3e8dA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-11  32%  3e88A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-11  32%  3e87A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-11  32%  3d0eA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    1e-11  36%  2cl1A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    1e-11  25%  2weiA  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1, PUTATIVE
    1e-11  35%  2w5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    1e-11  28%  2vrxB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    1e-11  28%  2vgpB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    1e-11  28%  2vgpA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    1e-11  28%  2vgoA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    1e-11  30%  2oidB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-11  30%  2oicB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-11  32%  3f6xC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-11  36%  2dylA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    1e-11  28%  2bfyB  [x.x.x] LOC398457 PROTEIN
    1e-11  28%  2bfyA  [x.x.x] LOC398457 PROTEIN
    1e-11  28%  2bfxB  [x.x.x] LOC398457 PROTEIN
    1e-11  28%  2bfxA  [x.x.x] LOC398457 PROTEIN
    2e-11  30%  1yrpA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    2e-11  31%  2oiqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-11  27%  3fe3A  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    2e-11  30%  2oidD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-11  28%  2j90A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    2e-11  30%  2bdfB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-11  28%  1yi6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-11  33%  2pziA  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNG
    3e-11  31%  2j7tA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 10
    3e-11  29%  3h4jA  [x.x.x] SNF1-LIKE PROTEIN KINASE SSP2
    4e-11  33%  2pziB  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNG
    4e-11  28%  2hakE  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    5e-11  31%  2wqeA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    5e-11  25%  3hztA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE 3
    5e-11  32%  3hkoA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE WITH
    5e-11  30%  3f6xB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-11  25%  3dxnA  [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3
    5e-11  30%  3d7tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-11  30%  2bdjA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-11  30%  2bdfA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-11  29%  1a06A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    7e-11  31%  2ozaA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    7e-11  28%  2j90B  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    7e-11  31%  3en4B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-11  29%  2bdwB  [x.x.x] HYPOTHETICAL PROTEIN K11E8.1D
    7e-11  29%  2bdwA  [x.x.x] HYPOTHETICAL PROTEIN K11E8.1D
    9e-11  23%  2v5qA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    9e-11  28%  2hakA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    1e-10  30%  1zmuB  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    1e-10  30%  1zmuA  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    1e-10  31%  2qr8A  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-3
    1e-10  32%  1p4fA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE 1
    1e-10  38%  2oidA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-10  27%  3ehaA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    1e-10  27%  3eh9A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    1e-10  34%  2w5hA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    1e-10  23%  2rkuA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    1e-10  23%  2ou7A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    1e-10  23%  3fc2A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    1e-10  30%  3el8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-10  30%  3efwB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-10  30%  3efwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-10  32%  1wvyA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    2e-10  32%  1wvwA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    2e-10  30%  2oidC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-10  32%  1jktA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE
    2e-10  32%  1jkkA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE
    2e-10  32%  1ig1A  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE
    2e-10  30%  3geqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-10  32%  3dgkA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    2e-10  32%  3dfcB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    3e-10  29%  1zmvB  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    3e-10  29%  1zmvA  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    3e-10  30%  2vd5A  [x.x.x] DMPK PROTEIN
    3e-10  30%  1k9aE  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    3e-10  30%  1k9aD  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    3e-10  31%  2javA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    3e-10  29%  1zmwB  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    3e-10  29%  1zmwA  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    3e-10  27%  2jbpC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    3e-10  27%  3hmiA  [x.x.x] TYROSINE-PROTEIN KINASE ABL2
    3e-10  32%  2h9vA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    3e-10  31%  3fpmA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    3e-10  32%  2f2uB  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    3e-10  32%  2f2uA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    3e-10  24%  3dbeA  [x.x.x] POLO-LIKE KINASE 1
    4e-10  31%  2oicC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    4e-10  32%  1mryA  [d.144.1] RAC-BETA SERINE/THREONINE KINASE
    4e-10  28%  2jc6C  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-10  28%  2jc6A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-10  31%  3geqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-10  31%  3g5dB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-10  31%  3g5dA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-10  31%  3f3uB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-10  31%  3el8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-10  31%  3f3tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-10  31%  1k9aC  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    7e-10  30%  1k9aA  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    7e-10  30%  1fmkA  [x.x.x] TYROSINE-PROTEIN KINASE SRC
    7e-10  30%  3d7uA  [x.x.x] TYROSINE-PROTEIN KINASE CSK
    1e-09  32%  2v55C  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    1e-09  32%  2v55A  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    1e-09  29%  2r0iA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK2
    1e-09  32%  1k9aB  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    1e-09  30%  2jbpF  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-09  27%  2jbpE  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-09  28%  2jbpD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-09  32%  2etkB  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    1e-09  32%  2etkA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    1e-09  33%  2qlqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-09  31%  2o8yB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-09  24%  3igoA  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    1e-09  28%  2hakD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    1e-09  28%  2hakC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    1e-09  30%  3g6gB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-09  28%  2vgoB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    2e-09  30%  2pzyB  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-09  31%  2onlD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-09  31%  2onlC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-09  32%  2h96A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    2e-09  32%  2gmxB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    2e-09  32%  2gmxA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    2e-09  32%  2g01B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    2e-09  32%  2g01A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    2e-09  23%  3dfaA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE CGD3_920
    2e-09  31%  1tkiA  [d.144.1] TITIN
    2e-09  32%  2qi8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-09  32%  2pzyD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-09  30%  1ol6A  [d.144.1] SERINE/THREONINE KINASE 6
    2e-09  29%  2oiqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-09  30%  1k9aF  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    2e-09  30%  3cqwA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    2e-09  30%  3cquA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    3e-09  26%  2zv9A  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    3e-09  31%  2o8yA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    3e-09  30%  3g6gA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-09  31%  1bygA  [d.144.1] PROTEIN (C-TERMINAL SRC KINASE)
    4e-09  27%  2pl0A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    4e-09  27%  2of2A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    4e-09  29%  1koaA  [x.x.x] TWITCHIN
    4e-09  30%  2jbpB  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    4e-09  28%  2hw6A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    4e-09  30%  3en5B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-09  32%  1gzkA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    5e-09  31%  3en4A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-09  30%  3d7uD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-09  30%  3d7uB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-09  31%  3d7tA  [x.x.x] TYROSINE-PROTEIN KINASE CSK
    6e-09  26%  1qpjA  [d.144.1] LCK TYROSINE KINASE
    6e-09  26%  1qpdA  [d.144.1] LCK KINASE
    6e-09  26%  1qpcA  [d.144.1] LCK KINASE
    6e-09  26%  2ofuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    6e-09  31%  2jbpI  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    6e-09  27%  3gvuA  [x.x.x] TYROSINE-PROTEIN KINASE ABL2
    6e-09  30%  3f3vB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-09  30%  3f3tA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-09  31%  3e7oA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 9
    6e-09  26%  3bymA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    8e-09  29%  1ym7D  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    8e-09  29%  1ym7C  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    8e-09  29%  1ym7A  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    8e-09  31%  2wntA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE
    8e-09  32%  2qq7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-09  29%  1omwA  [a.91.1 - d.144.1 - b.55.1] G-PROTEIN COUPLED RECEPTOR KINASE
    8e-09  32%  2jboA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    8e-09  30%  3g6hB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-09  29%  3cikA  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    8e-09  29%  2bcjA  [x.x.x] G-PROTEIN COUPLED RECEPTOR KINASE 2
    1e-08  32%  2pzyC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-08  30%  2ptkA  [x.x.x] TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
    1e-08  32%  1pmqA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-08  28%  2hakG  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    1e-08  32%  3fmeA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    1e-08  30%  3f3wB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  30%  3f3wA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  28%  1yolB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  28%  1yolA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  32%  2wajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-08  34%  3fi2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-08  33%  2fh9A  [x.x.x] SNF1 KINASE
    2e-08  31%  2wntB  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE
    2e-08  29%  2qkwB  [x.x.x] PROTEIN KINASE
    2e-08  31%  2i6lA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 6
    2e-08  29%  3hgkC  [x.x.x] PROTEIN KINASE
    2e-08  29%  3hgkB  [x.x.x] PROTEIN KINASE
    2e-08  29%  3hgkA  [x.x.x] PROTEIN KINASE
    2e-08  27%  3b2wA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    2e-08  31%  2qi8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-08  27%  2jbpH  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-08  35%  3fv8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-08  33%  1zycD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    3e-08  33%  1zycC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    3e-08  26%  2zvaA  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    3e-08  25%  2zv7A  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    3e-08  29%  1yomA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  31%  2pzyA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    3e-08  28%  2hw7A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    3e-08  30%  3en7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  26%  3bgzA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    4e-08  30%  1ua2A  [d.144.1] CELL DIVISION PROTEIN KINASE 7
    4e-08  32%  2ofvB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    4e-08  33%  3dlsF  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    4e-08  33%  3dlsE  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    4e-08  33%  3dlsD  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    4e-08  33%  3dlsC  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    4e-08  33%  3dlsB  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    4e-08  33%  3dlsA  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    4e-08  26%  3cy3A  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    4e-08  26%  2c3iB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    5e-08  28%  1ny3A  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    5e-08  29%  1kobA  [d.144.1] TWITCHIN
    5e-08  36%  3k2lA  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    5e-08  29%  2jbpG  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    7e-08  31%  2o0uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    7e-08  28%  3hyhA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    7e-08  28%  3famB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    7e-08  28%  2eueB  [x.x.x] CARBON CATABOLITE DEREPRESSING PROTEIN KINASE
    7e-08  28%  3daeB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    7e-08  28%  3daeA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    7e-08  23%  3d5xA  [x.x.x] POLO-LIKE KINASE 1
    7e-08  33%  1cm8A  [d.144.1] PHOSPHORYLATED MAP KINASE P38-GAMMA
    9e-08  32%  1zycA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    9e-08  28%  1y8gB  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 2
    9e-08  28%  1y8gA  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 2
    9e-08  28%  2j0jA  [x.x.x] FOCAL ADHESION KINASE 1
    9e-08  32%  2g9xC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-08  35%  3fi3A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    9e-08  31%  3d83A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-08  27%  3cy2A  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    9e-08  27%  3cxwA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    9e-08  38%  3blrA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    1e-07  32%  1zycB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    1e-07  27%  1qcfA  [b.34.2 - d.93.1 - d.144.1] HAEMATOPOETIC CELL KINASE (HCK)
    1e-07  35%  1pmeA  [x.x.x] ERK2
    1e-07  28%  2jedB  [x.x.x] PROTEIN KINASE C THETA
    1e-07  28%  2jedA  [x.x.x] PROTEIN KINASE C THETA
    1e-07  28%  3hyhB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    1e-07  31%  2hwoA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-07  27%  2hk5A  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    1e-07  32%  3gc8B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    1e-07  32%  3gc8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    1e-07  39%  3g33A  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    1e-07  28%  3famA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    1e-07  28%  2etmA  [x.x.x] FOCAL ADHESION KINASE 1
    1e-07  32%  3blhA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    2e-07  32%  1zydA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    2e-07  28%  2rioB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    2e-07  29%  2jbpA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-07  27%  2j0lA  [x.x.x] FOCAL ADHESION KINASE 1
    2e-07  28%  2ac5A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    2e-07  34%  1ukiA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 8 ISOFORM 4
    2e-07  33%  1pmuA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    2e-07  26%  2objA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    2e-07  35%  2fysA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    2e-07  29%  3fxxA  [x.x.x] EPHRIN TYPE-A RECEPTOR 3
    2e-07  26%  3f2aA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    2e-07  31%  3en7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  26%  3dcvA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    2e-07  33%  3da6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    2e-07  31%  2bujA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 16
    2e-07  26%  2bikB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    2e-07  36%  2b9iA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    2e-07  37%  2b9fA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    2e-07  35%  2acxB  [x.x.x] G PROTEIN-COUPLED RECEPTOR KINASE 6
    2e-07  35%  2acxA  [x.x.x] G PROTEIN-COUPLED RECEPTOR KINASE 6
    2e-07  27%  2ac3A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    3e-07  29%  1yomB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-07  37%  1xo2B  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    3e-07  33%  2r3qA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  33%  2r3iA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  37%  1jowB  [d.144.1] CELL DIVISION PROTEIN KINASE 6
    3e-07  31%  2hwpB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-07  33%  1gz8A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-07  33%  3gc9B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    3e-07  37%  1g3nA  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    3e-07  37%  2f2cB  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    3e-07  37%  2eufB  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    3e-07  30%  3dogC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  37%  1blxA  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    3e-07  37%  1bi8A  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    3e-07  37%  1bi7A  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    3e-07  33%  1zydB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    3e-07  30%  2zdtA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-07  31%  2z7sA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    3e-07  31%  2z7rA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    3e-07  31%  2z7qA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    3e-07  30%  1pmvA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-07  30%  1pmnA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-07  30%  2p33A  [x.x.x] C-JUN N-TERMINAL KINASE 3
    3e-07  31%  1oguC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-07  32%  1mrvA  [d.144.1] RAC-BETA SERINE/THREONINE KINASE
    3e-07  30%  1jnkA  [x.x.x] C-JUN N-TERMINAL KINASE
    3e-07  31%  2hwoB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-07  30%  3g9nA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-07  30%  3g90X  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-07  29%  3fbvI  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    3e-07  29%  3fbvD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    3e-07  29%  3fbvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    3e-07  37%  2fa2B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    3e-07  37%  2fa2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    3e-07  37%  2f49A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    3e-07  30%  3el7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-07  39%  3blqA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    3e-07  31%  3bhuC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  31%  3bhtC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-07  37%  2b9hA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    4e-07  27%  1yxsA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    4e-07  27%  1ywvA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    4e-07  27%  1xwsA  [d.144.1] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    4e-07  27%  1xqzA  [d.144.1] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    4e-07  37%  2w9zB  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    4e-07  37%  2w99B  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    4e-07  35%  2r9sA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    4e-07  31%  2qq7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-07  27%  2j2iB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    4e-07  29%  2i6lB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 6
    4e-07  27%  3c4eC  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    4e-07  27%  2bzkB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    4e-07  27%  2bzhB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    4e-07  27%  2bilB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    6e-07  37%  2w96B  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    6e-07  36%  1w98A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  31%  2qlqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-07  36%  1oiyA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  1oiuC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  1oi9A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  1oguA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  1jsuA  [d.144.1] CYCLIN-DEPENDENT KINASE-2
    6e-07  36%  1jstA  [d.144.1] CYCLIN-DEPENDENT KINASE-2
    6e-07  36%  2jgzA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2iw9C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2iw9A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2iw8C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2iw8A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2iw6C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2iw6A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  30%  2hw6B  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    6e-07  32%  1h4lA  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    6e-07  36%  1h27C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  1h26C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  1h25C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  1h24A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2g9xA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  30%  3eljA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    6e-07  36%  1e9hA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  3dogA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  3ddqC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  3ddqA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2cjmC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2cjmA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  2cchA  [d.144.1 (1e9hC)] CELL DIVISION PROTEIN KINASE 2
    6e-07  36%  3bhtA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-07  27%  2z8cA  [x.x.x] INSULIN RECEPTOR
    8e-07  29%  1xjdA  [d.144.1] PROTEIN KINASE C, THETA TYPE
    8e-07  27%  1ir3A  [d.144.1] INSULIN RECEPTOR
    8e-07  29%  3fy2A  [x.x.x] EPHRIN TYPE-A RECEPTOR 3
    8e-07  25%  3etaB  [x.x.x] INSULIN RECEPTOR, KINASE DOMAIN
    1e-06  28%  1zxeD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    1e-06  41%  2w9fB  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    1e-06  27%  2rioA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    1e-06  28%  2qocA  [x.x.x] EPHRIN RECEPTOR
    1e-06  28%  2qkrA  [x.x.x] CDC2-LIKE CDK2/CDC28 LIKE PROTEIN KINASE
    1e-06  27%  3bu5A  [x.x.x] INSULIN RECEPTOR SUBUNIT BETA
    1e-06  27%  3bu3A  [d.144.1 (1rqqA)] INSULIN RECEPTOR SUBUNIT BETA
    1e-06  27%  2auhA  [x.x.x] INSULIN RECEPTOR
    1e-06  30%  1yojB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-06  32%  1kwpA  [d.144.1] MAP KINASE ACTIVATED PROTEIN KINASE 2
    1e-06  39%  2f9gA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-06  31%  3en6B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-06  31%  3en6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-06  31%  3en5A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-06  25%  2e9nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    1e-06  24%  3cblA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FES/FPS
    1e-06  24%  3bkbA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FES/FPS
    1e-06  25%  2aypA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  33%  3gc9A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    2e-06  36%  3eidA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-06  31%  3d7zA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  28%  3bz3A  [x.x.x] FOCAL ADHESION KINASE 1
    2e-06  35%  2z7lA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    2e-06  28%  1v0oB  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    2e-06  28%  1v0oA  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    2e-06  28%  1v0bA  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    2e-06  35%  1tvoA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    2e-06  35%  2ojiA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    2e-06  35%  2ojgA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    2e-06  32%  2iwiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PIM-2
    2e-06  32%  2iwiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PIM-2
    2e-06  22%  1ia8A  [d.144.1] CHK1 CHECKPOINT KINASE
    2e-06  37%  1h0vA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-06  35%  2gphA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    2e-06  35%  1golA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    2e-06  32%  3g9lX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    2e-06  26%  3etaA  [x.x.x] INSULIN RECEPTOR, KINASE DOMAIN
    2e-06  35%  3erkA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    2e-06  35%  1erkA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    2e-06  33%  3enmC  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    2e-06  22%  2cgxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  22%  2cgvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  22%  2cguA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  22%  2c3kA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  23%  2c3jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  22%  2brnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  30%  2a1aB  [x.x.x] INTERFERON-INDUCED, DOUBLE-STRANDED RNA-
    2e-06  30%  2a19B  [x.x.x] INTERFERON-INDUCED, DOUBLE-STRANDED RNA-
    3e-06  27%  1zysA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  31%  1zy4A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    3e-06  33%  2zduA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-06  26%  1yhsA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    3e-06  27%  2wmxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2wmwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2wmvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2wmuA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2wmtA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2wmsA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2wmrA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  31%  1unlA  [d.144.1] CYCLIN-DEPENDENT KINASE 5
    3e-06  31%  1unhA  [d.144.1] CYCLIN-DEPENDENT KINASE 5
    3e-06  31%  1ungB  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    3e-06  31%  1ungA  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    3e-06  37%  2r3kA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-06  27%  2r0uA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2qhnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  26%  2pz5B  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    3e-06  26%  2pz5A  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    3e-06  33%  2pmiC  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    3e-06  33%  2pmiA  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    3e-06  33%  2pk9C  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    3e-06  33%  2pk9A  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    3e-06  33%  2ok1A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-06  30%  2ofvA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    3e-06  33%  2o2uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-06  27%  1nvrA  [d.144.1] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  3jvsA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  3jvrA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2hogA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  39%  3hmmA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    3e-06  27%  2gdoA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  44%  3g2fA  [x.x.x] BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE-2
    3e-06  27%  3f9nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  33%  2excX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-06  32%  3enmB  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    3e-06  27%  2cgwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  22%  3cd3A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FES/FPS
    3e-06  27%  2c3lA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  3byuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    3e-06  27%  2brmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2brhA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  27%  2brgA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  27%  1sm2A  [d.144.1] TYROSINE-PROTEIN KINASE ITK/TSK
    4e-06  28%  2r7iD  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    4e-06  29%  2qo9A  [x.x.x] EPHRIN RECEPTOR
    4e-06  27%  2pzrB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-06  27%  2pzrA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-06  26%  2pzpA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-06  27%  2og8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    4e-06  25%  1mqbB  [d.144.1] EPHRIN TYPE-A RECEPTOR 2
    4e-06  37%  2i40A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-06  29%  3enmD  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    4e-06  29%  3enmA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    4e-06  34%  3e92A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-06  33%  2b1pA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    5e-06  33%  1ykrA  [d.144.1 (1finA)] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2wipC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2wipA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  37%  2w06A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  1vywC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  1vywA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2vtrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  37%  2vtpA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  28%  1uwhA  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    5e-06  37%  2r3jA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2r3hA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  27%  2pvyD  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    5e-06  40%  2ow3B  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    5e-06  40%  2ow3A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    5e-06  33%  1okvC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  1okvA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  1oirA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-06  40%  1o9uA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    5e-06  33%  1kwpB  [d.144.1] MAP KINASE ACTIVATED PROTEIN KINASE 2
    5e-06  33%  1jsvA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-06  27%  2jkqA  [x.x.x] FOCAL ADHESION KINASE 1
    5e-06  28%  2jkmA  [x.x.x] FOCAL ADHESION KINASE 1
    5e-06  28%  2jkkA  [x.x.x] FOCAL ADHESION KINASE 1
    5e-06  28%  2j0kB  [x.x.x] FOCAL ADHESION KINASE 1
    5e-06  26%  1irkA  [x.x.x] INSULIN RECEPTOR TYROSINE KINASE DOMAIN
    5e-06  27%  2ijmB  [x.x.x] FOCAL ADHESION KINASE 1
    5e-06  27%  2ijmA  [x.x.x] FOCAL ADHESION KINASE 1
    5e-06  31%  2hwpA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-06  33%  1hckA  [d.144.1 (1pw2A)] HUMAN CYCLIN-DEPENDENT KINASE 2
    5e-06  33%  1h0uA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  1h01A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-06  40%  1gngB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    5e-06  40%  1gngA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    5e-06  34%  3gc7A  [d.144.1 (1oveA)] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-06  40%  3f88A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    5e-06  40%  3f7zB  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    5e-06  40%  3f7zA  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    5e-06  33%  3f5xA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  1f5qC  [d.144.1] CYCLIN DEPENDENT KINASE 2
    5e-06  33%  1f5qA  [d.144.1] CYCLIN DEPENDENT KINASE 2
    5e-06  28%  2etmB  [x.x.x] FOCAL ADHESION KINASE 1
    5e-06  26%  3eqrB  [x.x.x] ACTIVATED CDC42 KINASE 1
    5e-06  33%  3eocC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  3ej1C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  3ej1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  1e1vA  [d.144.1] CYCLIN-DEPENDENT PROTEIN KINASE 2
    5e-06  33%  2ds1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  37%  1di8A  [d.144.1] CYCLIN-DEPENDENT KINASE 2
    5e-06  33%  2clxA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2c6iA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2c68A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2c5yA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2c4gC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2c4gA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  1buhA  [d.144.1] PROTEIN (CDK2 HUMAN)
    5e-06  33%  2bkzC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-06  33%  2a4lA  [x.x.x] HOMO SAPIENS CYCLIN-DEPENDENT KINASE 2
    6e-06  29%  1nxkB  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    6e-06  29%  3d4qA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    6e-06  28%  1agwB  [d.144.1] FGF RECEPTOR 1
    8e-06  32%  1zxeC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    8e-06  29%  1yojA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-06  37%  2vtsA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-06  37%  2vtoA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-06  31%  1v0bB  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    8e-06  37%  1uv5A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1r0eA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  29%  2qokA  [x.x.x] EPHRIN RECEPTOR
    8e-06  37%  1q5kB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1q5kA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1q4lB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1q4lA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1q41B  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1q41A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1q3wB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1q3wA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1q3dB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1q3dA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1pyxB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1pyxA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  25%  2pwlA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    8e-06  26%  2pvfA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    8e-06  32%  1ob3A  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    8e-06  37%  2o5kA  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  2jldB  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  2jldA  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1j1bB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1j1bA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  28%  2j0kA  [x.x.x] FOCAL ADHESION KINASE 1
    8e-06  25%  2i0yA  [x.x.x] CFMS TYROSINE KINASE
    8e-06  25%  2i0vA  [x.x.x] CFMS TYROSINE KINASE
    8e-06  37%  1i09B  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1i09A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1h8fB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  37%  1h8fA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  36%  3eidC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-06  37%  3du8A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    8e-06  36%  2bajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-06  25%  3b2tB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    8e-06  25%  3b2tA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-05  34%  2zb0A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  34%  2zazA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  34%  1yqjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  36%  1y91A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-05  30%  2wmqA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    1e-05  34%  1wbsA  [d.144.1 (1bl6A)] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  26%  2pvyA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-05  34%  1oz1A  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  34%  1ouyA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  30%  2ivsA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    1e-05  37%  1iasB  [d.144.1] TGF-BETA RECEPTOR TYPE I
    1e-05  34%  3hrbA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  36%  1h08A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-05  34%  3gfeA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  36%  3fz1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-05  34%  1di9A  [d.144.1] P38 KINASE
    1e-05  23%  3d94A  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR BETA CHAIN
    1e-05  23%  3cokA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK4
    1e-05  34%  1bmkA  [d.144.1] PROTEIN (MAP KINASE P38)
    1e-05  30%  1zxeA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    1e-05  37%  1vyzA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-05  32%  1ukhA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 8 ISOFORM 4
    1e-05  26%  1sm2B  [d.144.1] TYROSINE-PROTEIN KINASE ITK/TSK
    1e-05  29%  2r7iC  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-05  29%  2r7iA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    1e-05  25%  2pwlB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-05  31%  2p3gX  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-05  32%  2gtmA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-05  25%  3fzoA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    1e-05  32%  2fysB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    1e-05  25%  3eknA  [x.x.x] INSULIN RECEPTOR
    1e-05  34%  3e3bX  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA'
    1e-05  23%  3db8A  [x.x.x] POLO-LIKE KINASE 1
    1e-05  22%  3cokB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK4
    1e-05  25%  3clyA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-05  27%  2c0tB  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    1e-05  27%  2c0tA  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    1e-05  27%  2c0iA  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    1e-05  30%  3bw5A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    2e-05  34%  2zoqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 3
    2e-05  37%  2qr7A  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-3
    2e-05  25%  2psqB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    2e-05  25%  2psqA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    2e-05  27%  2og8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    2e-05  36%  1nxkD  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-05  31%  1nxkC  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-05  26%  2jbpL  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-05  26%  2io6A  [x.x.x] WEE1-LIKE PROTEIN KINASE
    2e-05  26%  2in6A  [x.x.x] WEE1-LIKE PROTEIN KINASE
    2e-05  37%  1h0wA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-05  33%  3e7oB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 9
    2e-05  34%  3coiA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 13
    2e-05  27%  3bysA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    2e-05  26%  3bizA  [x.x.x] WEE1-LIKE PROTEIN KINASE
    2e-05  35%  2baqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  28%  1ad5A  [b.34.2 - d.93.1 - d.144.1] HAEMATOPOETIC CELL KINASE HCK
    2e-05  29%  2zjwA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    2e-05  38%  1urwA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-05  29%  2rkpA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    2e-05  25%  2pzpB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    2e-05  29%  2pvrA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA, CATALYTIC
    2e-05  29%  1pjkA  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    2e-05  31%  1ob3B  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    2e-05  29%  1na7A  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    2e-05  29%  1jwhB  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    2e-05  29%  1jwhA  [d.144.1] CASEIN KINASE II, ALPHA CHAIN
    2e-05  38%  3ig7A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-05  29%  3h30A  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    2e-05  36%  3gxlA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    2e-05  38%  1fvtA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-05  31%  2erkA  [x.x.x] EXTRACELLULAR SIGNAL-REGULATED KINASE 2
    2e-05  35%  3eb0C  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-05  35%  3eb0A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    2e-05  29%  3bqcA  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    2e-05  36%  2balA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  32%  1zy4B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    3e-05  39%  2wo6B  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    3e-05  39%  2wo6A  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    3e-05  38%  1wccA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-05  39%  2vx3D  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    3e-05  39%  2vx3C  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    3e-05  39%  2vx3B  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    3e-05  39%  2vx3A  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    3e-05  38%  2vtiA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-05  38%  2vthA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-05  38%  2uznA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-05  38%  2rg6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  28%  2r7iB  [x.x.x] CASEIN KINASE II SUBUNIT ALPHA
    3e-05  37%  2r3lA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-05  38%  2okrA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  32%  1nxkA  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    3e-05  38%  1ke6A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-05  38%  1jvpP  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-05  28%  2jkoA  [x.x.x] FOCAL ADHESION KINASE 1
    3e-05  31%  2jbpK  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    3e-05  28%  2j0mB  [x.x.x] FOCAL ADHESION KINASE 1
    3e-05  38%  1giiA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-05  38%  2ghlA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  28%  2fb8A  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    3e-05  33%  3e93A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  33%  2e14A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    3e-05  38%  1ckpA  [d.144.1] PROTEIN (CYCLIN-DEPENDENT PROTEIN KINASE 2)
    3e-05  40%  3cg2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  29%  3c4cA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    3e-05  38%  3bv2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-05  32%  1zy5B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    4e-05  37%  2wouA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    4e-05  37%  2wotA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    4e-05  34%  1vjyA  [d.144.1] TGF-BETA RECEPTOR TYPE I
    4e-05  28%  1uwjA  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    4e-05  37%  1py5A  [d.144.1] TGF-BETA RECEPTOR TYPE I
    4e-05  25%  1mqbA  [d.144.1] EPHRIN TYPE-A RECEPTOR 2
    4e-05  37%  1iasA  [d.144.1] TGF-BETA RECEPTOR TYPE I
    4e-05  35%  1h07A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-05  28%  2gsfA  [x.x.x] EPHRIN TYPE-A RECEPTOR 3
    4e-05  35%  3ds6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-05  26%  3cr0A  [x.x.x] WEE1-LIKE PROTEIN KINASE
    4e-05  35%  2bujB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 16
    4e-05  37%  1b6cB  [d.144.1] TGF-B SUPERFAMILY RECEPTOR TYPE I
    5e-05  31%  1zxeE  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    5e-05  31%  1zxeB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    5e-05  37%  1v1kA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-05  32%  2pmlX  [x.x.x] SER/THR PROTEIN KINASE
    5e-05  37%  1oitA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-05  35%  1lezA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-05  28%  2ivvA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    5e-05  26%  2ivuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    5e-05  26%  2ivtA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    5e-05  29%  3eqpA  [x.x.x] ACTIVATED CDC42 KINASE 1
    5e-05  29%  3eqpB  [x.x.x] ACTIVATED CDC42 KINASE 1
    5e-05  34%  3c9wA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    5e-05  28%  3c4cB  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    7e-05  36%  1ywrA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-05  41%  2qluA  [x.x.x] ACTIVIN RECEPTOR TYPE IIB
    7e-05  35%  2qd9A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-05  36%  1lewA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-05  29%  3idpA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    7e-05  26%  1i44A  [d.144.1] INSULIN RECEPTOR
    7e-05  38%  1h00A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    7e-05  40%  3gxjA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    7e-05  32%  3gcqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-05  29%  3eqrA  [x.x.x] ACTIVATED CDC42 KINASE 1
    9e-05  33%  2zb1A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-05  38%  2vtjA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-05  36%  2r3nA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-05  26%  2hakH  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    9e-05  36%  3gp0A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    9e-05  44%  3g2fB  [x.x.x] BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE-2
    9e-05  22%  3fqeA  [x.x.x] TYROSINE-PROTEIN KINASE SYK
    9e-05  38%  2duvA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-04  25%  2z2wA  [x.x.x] WEE1-LIKE PROTEIN KINASE
    1e-04  25%  1x8bA  [x.x.x] WEE1-LIKE PROTEIN KINASE
    1e-04  37%  2rg5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-04  30%  2pvyB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-04  37%  2onlA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-04  27%  1mp8A  [d.144.1] FOCAL ADHESION KINASE 1
    1e-04  31%  3gcvA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-04  37%  3faaA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    1e-04  29%  2c47C  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    1e-04  32%  2c47B  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    1e-04  32%  2c47A  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    1e-04  25%  3bi6A  [x.x.x] WEE1-LIKE PROTEIN KINASE
    2e-04  31%  1zxeF  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    2e-04  28%  1uwjB  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    2e-04  27%  1u54A  [d.144.1] ACTIVATED CDC42 KINASE 1
    2e-04  32%  2jbpJ  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-04  36%  3bx5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-04  27%  1u54B  [d.144.1] ACTIVATED CDC42 KINASE 1
    2e-04  29%  1u46B  [d.144.1] ACTIVATED CDC42 KINASE 1
    2e-04  29%  2qo2A  [x.x.x] EPHRIN RECEPTOR
    2e-04  28%  2pvyC  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    2e-04  28%  2ivsB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    2e-04  31%  2c47D  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    2e-04  36%  2btrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-04  38%  1zyjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-04  28%  1u4dA  [d.144.1] ACTIVATED CDC42 KINASE 1
    3e-04  45%  2okrD  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-04  36%  3gcuA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-04  31%  3gcpA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-04  34%  2fvdA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-04  37%  3e3pB  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    3e-04  37%  3e3pA  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    3e-04  25%  3cc6A  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    4e-04  26%  1p14A  [d.144.1] INSULIN RECEPTOR
    4e-04  28%  3idpB  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    4e-04  27%  2cmwA  [x.x.x] CASEIN KINASE I ISOFORM GAMMA-1
    4e-04  22%  3bceA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    4e-04  33%  2bakA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-04  35%  2b52A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-04  36%  1zz2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-04  27%  1u59A  [d.144.1] TYROSINE-PROTEIN KINASE ZAP-70
    5e-04  28%  1u46A  [d.144.1] ACTIVATED CDC42 KINASE 1
    5e-04  26%  2qolA  [x.x.x] EPHRIN RECEPTOR
    5e-04  36%  2puuA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-04  34%  2ozaB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-04  36%  3hp5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-04  36%  3hl7A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-04  25%  2hakB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    5e-04  36%  2gtnA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-04  36%  2ewaA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-04  28%  3dzqA  [x.x.x] EPH RECEPTOR A3
    5e-04  36%  3ctqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-04  35%  1yw2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-04  22%  1xbcA  [d.144.1] TYROSINE-PROTEIN KINASE SYK
    6e-04  22%  1xbbA  [d.144.1] TYROSINE-PROTEIN KINASE SYK
    6e-04  22%  1xbaA  [d.144.1] TYROSINE-PROTEIN KINASE SYK
    6e-04  33%  1r39A  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-04  27%  2qooA  [x.x.x] EPHRIN RECEPTOR
    6e-04  28%  2qobA  [x.x.x] EPHRIN RECEPTOR
    6e-04  37%  1p2aA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-04  38%  1kv1A  [d.144.1] P38 MAP KINASE
    6e-04  37%  1gijA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-04  37%  1gihA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-04  22%  3fqhB  [x.x.x] TYROSINE-PROTEIN KINASE SYK
    6e-04  31%  3dtcA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 9
    6e-04  31%  1ckjB  [d.144.1] RECOMBINANT CASEIN KINASE I DELTA
    6e-04  31%  1ckjA  [d.144.1] RECOMBINANT CASEIN KINASE I DELTA
    8e-04  36%  2w17A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-04  36%  2vv9A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-04  30%  2v62B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE VRK2
    8e-04  30%  2v62A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE VRK2
    8e-04  44%  2r4bB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    8e-04  44%  2r4bA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    8e-04  27%  2qoiA  [x.x.x] EPHRIN RECEPTOR
    8e-04  27%  2qofA  [x.x.x] EPHRIN RECEPTOR
    8e-04  27%  2qodA  [x.x.x] EPHRIN RECEPTOR
    8e-04  33%  3gcsA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-04  25%  3et7A  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    8e-04  44%  3bceB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
:490

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAPDGARVAVKTLHRDA
3f69B           --------------------------------------------------------DHRDVAVKVLRADL
2q0nA           ---------------------------------------------------------GKLVAVKKMD---
2j0iA           ---------------------------------------------------------GKLVAVKKMD---
2fumB           ------------------------------------------------------------VAVKVLRADL
2fumA           ------------------------------------------------------------VAVKVLRADL
2cdzA           ---------------------------------------------------------GKLVAVKKMD---
3f69A           --------------------------------------------------------DHRDVAVKVLRADL
2bvaB           ----------------------------------------------------------------------
2bvaA           ----------------------------------------------------------------------
1mruB           ------------------------------------------------------------VAVKVLRADL
1mruA           ------------------------------------------------------------VAVKVLRADL
1yhvA           ---------------------------------------------------------GQEVAIRQMN---
1o6yA           ------------------------------------------------------------VAVKVLRADL
1yhwA           ---------------------------------------------------------GQEVAIRQMN---
2f57B           ---------------------------------------------------------GKQVAVKKMD---
2f57A           ---------------------------------------------------------GKQVAVKKMD---
2fumD           ------------------------------------------------------------VAVKVLRADL
3ckxA           ----------------------------------------------------------------------
2c30A           ---------------------------------------------------------GRQVAVKMMD---
3fxzA           ---------------------------------------------------------GQEVAIRQMN---
3f61A           --------------------------------------------------------DHRDVAVKVLRADL
1f3mC           ---------------------------------------------------------GQEVAIRQMN---
2vwiC           ------------------------------------------------------APKKEKVAIKRINLEK
1f3mD           ---------------------------------------------------------GQEVAIRQMN---
1u5qA           ------------------------------------------------------------VAIKKMSYSG
3dakD           ------------------------------------------------------APKKEKVAIKRINLEK
3ggfA           ----------------------------------------------------------------------
1fotA           ----------------------------------------------------------------------
2vz6B           ----------------------------------------------------------------------
2vz6A           ----------------------------------------------------------------------
3ggfB           ----------------------------------------------------------------------
2fumC           ------------------------------------------------------------VAVKVLRADL
3dbqA           ----------------------------------------------------------------------
3c4yA           ----------------------------------------------------------------------
1ol7A           ------------------------------------------------------------LALKVLFKAQ
1ol5A           ------------------------------------------------------------LALKVLFKAQ
3ha6A           ------------------------------------------------------------LALKVLFKAQ
2j4zB           ------------------------------------------------------------LALKVLFKAQ
2j4zA           ------------------------------------------------------------LALKVLFKAQ
3h10B           ------------------------------------------------------------LALKVLFKAQ
3h10A           ------------------------------------------------------------LALKVLFKAQ
3gfwA           ----------------------------------------------------------------------
3dakA           ------------------------------------------------------APKKEKVAIKRINLEK
3c51A           ----------------------------------------------------------------------
3c50B           ----------------------------------------------------------------------
3c50A           ----------------------------------------------------------------------
3c4zA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
3c4xB           ----------------------------------------------------------------------
3c4xA           ----------------------------------------------------------------------
3c4wB           ----------------------------------------------------------------------
3c4wA           ----------------------------------------------------------------------
3dy7A           -------------------------------------------------------PSGLVMARKLIHLEI
2zmcA           ----------------------------------------------------------------------
2welA           ----------------------------------------------------------------------
2vn9A           ----------------------------------------------------------------------
3dj5A           ------------------------------------------------------------LALKVLFKTQ
3c51B           ----------------------------------------------------------------------
1mq4A           ------------------------------------------------------------LALKVLFKAQ
3dakC           ------------------------------------------------------APKKEKVAIKRINLEK
2w1gA           ------------------------------------------------------------LALKVLFKAQ
2vwiD           ------------------------------------------------------APKKEKVAIKRINLEK
2vwiA           ----------------------------------------------------------------------
1s9jA           -------------------------------------------------------PSGLVMARKLIHLEI
1s9iB           -------------------------------------------------------PSGLIMARKLIHLEI
1muoA           ------------------------------------------------------------LALKVLFKAQ
3h9fA           ----------------------------------------------------------------------
3e5aA           ------------------------------------------------------------LALKVLFKAQ
3dj7A           ------------------------------------------------------------LALKVLFKTQ
3d14A           ------------------------------------------------------------LALKVLFKTQ
3ckwA           ----------------------------------------------------------------------
2w1fA           ------------------------------------------------------------LALKVLFKAQ
1s9iA           -------------------------------------------------------PSGLIMARKLIHLEI
1ql6A           ---------------------------------------------------------------------A
3eqcA           -------------------------------------------------------PSGLVMARKLIHLEI
3dv3A           -------------------------------------------------------PSGLVMARKLIHLEI
3d15A           ------------------------------------------------------------LALKVLFKTQ
2c6dA           ------------------------------------------------------------LALKVLFKAQ
2w7xA           ---------------------------------------------------------------KTCKKVA
2vd5B           ----------------------------------------------------------------------
3fdnA           ------------------------------------------------------------LALKVLFKAQ
3eqiA           -------------------------------------------------------PSGLVMARKLIHLEI
3eqfA           -------------------------------------------------------PSGLVMARKLIHLEI
3d2iA           ------------------------------------------------------------LALKVLFKTQ
2zmdA           ----------------------------------------------------------------------
2w1eA           ------------------------------------------------------------LALKVLFKAQ
3comB           ----------------------------------------------------------------------
3comA           ----------------------------------------------------------------------
2cn5A           ----------------------------------------------------------------------
2vwiB           ------------------------------------------------------APKKEKVAIKRINLEK
1u7eA           ----------------------------------------------------------------------
2r5tA           ----------------------------------------------------------------------
3hdnA           ----------------------------------------------------------------------
3hdmA           ----------------------------------------------------------------------
3fhiA           ----------------------------------------------------------------------
2c6eA           ------------------------------------------------------------LALKVLFKAQ
2uztA           ----------------------------------------------------------------------
2phkA           ---------------------------------------------------------------------A
1phkA           ---------------------------------------------------------------------A
2f7xE           ----------------------------------------------------------------------
3e8nA           -------------------------------------------------------PSGLVMARKLIHLEI
2clqA           -----------------------------------------------------------RIAIKEIERDS
3cekA           ----------------------------------------------------------------------
3bhhD           ----------------------------------------------------------------------
3bhhC           ----------------------------------------------------------------------
3bhhB           ----------------------------------------------------------------------
3bhhA           ----------------------------------------------------------------------
2v7oA           ----------------------------------------------------------------------
2clqB           -----------------------------------------------------------RIAIK------
2biyA           ----------------------------------------------------------------------
1uu8A           ----------------------------------------------------------------------
1uu7A           ----------------------------------------------------------------------
1sykB           ----------------------------------------------------------------------
1sykA           ----------------------------------------------------------------------
2jamB           ----------------------------------------------------------------------
2jamA           ----------------------------------------------------------------------
2gnlA           ----------------------------------------------------------------------
2gnjA           ----------------------------------------------------------------------
2bmcF           ------------------------------------------------------------LALKVLFKAQ
2bmcC           ------------------------------------------------------------LALKVLFKAQ
2bmcB           ------------------------------------------------------------LALKVLFKAQ
2bmcA           ------------------------------------------------------------LALKVLFKAQ
1ydrE           ----------------------------------------------------------------------
1xh8A           ----------------------------------------------------------------------
1xh6A           ----------------------------------------------------------------------
1stcE           ----------------------------------------------------------------------
1rejA           ----------------------------------------------------------------------
2qvsE           ----------------------------------------------------------------------
2qurA           ----------------------------------------------------------------------
1q8uA           ----------------------------------------------------------------------
1q8tA           ----------------------------------------------------------------------
1jbpE           ----------------------------------------------------------------------
3idbA           ----------------------------------------------------------------------
2gu8A           ----------------------------------------------------------------------
1fmoE           ----------------------------------------------------------------------
3fjqE           ----------------------------------------------------------------------
3e8eI           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3e8cB           ----------------------------------------------------------------------
3dneA           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
1ctpE           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
2c1aA           ----------------------------------------------------------------------
1bkxA           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
2w5bA           ----------------------------------------------------------------------
2w1dA           ------------------------------------------------------------LALKVLFKAQ
1okyA           ----------------------------------------------------------------------
2nruB           ----------------------------------------------------------------------
2nruA           ----------------------------------------------------------------------
2np8A           ------------------------------------------------------------LALKVLFKAQ
1j3hB           ----------------------------------------------------------------------
1j3hA           ----------------------------------------------------------------------
3h10D           ------------------------------------------------------------LALKVLFKAQ
1h1wA           ----------------------------------------------------------------------
3dakB           ------------------------------------------------------APKKEKVAIKRINLEK
2w0jA           ---------------------------------------------------------------KTCKKVA
2gngA           ----------------------------------------------------------------------
2gnfA           ----------------------------------------------------------------------
2evaA           ----------------------------------------------------------------------
1xh9A           ----------------------------------------------------------------------
2qg5D           ----------------------------------------------------------------------
2qg5B           ----------------------------------------------------------------------
2qg5A           ----------------------------------------------------------------------
3h0zA           ------------------------------------------------------------LALKVLFKAQ
3h0yA           ------------------------------------------------------------LALKVLFKAQ
3f3zA           ----------------------------------------------------------------------
1uu9A           ----------------------------------------------------------------------
1smhA           ----------------------------------------------------------------------
1okzA           ----------------------------------------------------------------------
2nryA           ------------------------------------------------------------VAVKKLA--A
3h9oA           ----------------------------------------------------------------------
1z5mA           ----------------------------------------------------------------------
2vo0A           ----------------------------------------------------------------------
2uw4A           ----------------------------------------------------------------------
2uvxA           ----------------------------------------------------------------------
1uu3A           ----------------------------------------------------------------------
2r7bA           ----------------------------------------------------------------------
1q61A           ----------------------------------------------------------------------
2jdtA           ----------------------------------------------------------------------
2j50A           ------------------------------------------------------------LALKVLFKAQ
3c0iA           ----------------------------------------------------------------------
3c0hA           ----------------------------------------------------------------------
3c0gB           ----------------------------------------------------------------------
3c0gA           ----------------------------------------------------------------------
3bqrA           ----------------------------------------------------------------------
1q62A           ----------------------------------------------------------------------
1q24A           ----------------------------------------------------------------------
2nryD           ------------------------------------------------------------VAVKKLE---
1xh7A           ----------------------------------------------------------------------
1vzoA           ----------------------------------------------------------------------
2uv2A           ----------------------------------------------------------------------
2qcsA           ----------------------------------------------------------------------
1q8wA           ----------------------------------------------------------------------
1l3rE           ----------------------------------------------------------------------
2jflA           ----------------------------------------------------------------------
2j51A           ----------------------------------------------------------------------
3hrcA           ----------------------------------------------------------------------
3h0zC           ------------------------------------------------------------LALKVLFKAQ
3h0zB           ------------------------------------------------------------LALKVLFKAQ
2cpkE           ----------------------------------------------------------------------
3bwjA           ----------------------------------------------------------------------
2i0eB           ----------------------------------------------------------------------
2i0eA           ----------------------------------------------------------------------
3cohA           ------------------------------------------------------------LALKVLFKAQ
2yzaA           ---------------------------------------------------------GHKVAVKILNRQS
1rdqE           ----------------------------------------------------------------------
2oibD           ------------------------------------------------------------VAVKKLTTEE
3hrfA           ----------------------------------------------------------------------
2oicD           ----------------------------------------------------------------------
2nryC           ----------------------------------------------------------------------
3dqxA           -----------------------------------------------------------RVAIKTLKPGT
2dq7X           -----------------------------------------------------------KVAIKTLKPGT
3d5uA           -------------------------------------------------------------AGKVVPKSM
2c6eB           ------------------------------------------------------------LALKVLFKAQ
1y57A           -----------------------------------------------------------RVAIKTLKPGT
2srcA           -----------------------------------------------------------RVAIKTLKPGT
2oibB           ------------------------------------------------------------VAVKKLATEE
2h8hA           -----------------------------------------------------------RVAIKTLKPGT
3db6A           -------------------------------------------------------------AGKVVPKSM
1zwsA           ----------------------------------------------------------------------
2vo6A           ----------------------------------------------------------------------
2uvzA           ----------------------------------------------------------------------
2uvyA           ----------------------------------------------------------------------
1szmB           ----------------------------------------------------------------------
1szmA           ----------------------------------------------------------------------
2oibC           ------------------------------------------------------------VAVKKLAEE-
1kswA           -----------------------------------------------------------RVAIKTLKPGT
3i79A           ---------------------------------------------------------GQECAVKVISKRQ
3hx4A           ---------------------------------------------------------GQECAVKVISKD-
2ckeB           ----------------------------------------------------------------------
2ckeA           ----------------------------------------------------------------------
2a2aB           ----------------------------------------------------------------------
2a2aA           ----------------------------------------------------------------------
1wmkH           ----------------------------------------------------------------------
1wmkB           ----------------------------------------------------------------------
1wmkE           ----------------------------------------------------------------------
1wmkA           ----------------------------------------------------------------------
2oibA           ----------------------------------------------------------------------
2dwbA           ------------------------------------------------------------LALKVLFKAQ
3dqwD           -----------------------------------------------------------RVAIKTLKPGT
3dqwC           -----------------------------------------------------------RVAIKTLKPGT
3dqwA           -----------------------------------------------------------RVAIKTLKPGT
3bhyA           ----------------------------------------------------------------------
2a27A           ----------------------------------------------------------------------
3dqxB           -----------------------------------------------------------RVAIKTLKPGT
2qnjA           ---------------------------------------------------------GREVAIKIIDKTQ
3f6xD           -----------------------------------------------------------RVAIKTLKPGT
3d2kA           ------------------------------------------------------------LALKVLFKTQ
2cn8A           ---------------------------------------------------------------KTCKKVA
1zrzA           ----------------------------------------------------------------------
3h4jB           -----------------------------------------------------------KVALKFISRQL
3dajA           ------------------------------------------------------------LALKVLFKTQ
2w4oA           ----------------------------------------------------------------------
2oicA           ----------------------------------------------------------------------
2jfmA           ----------------------------------------------------------------------
2h6dA           ---------------------------------------------------------GHKVAVKILNRQS
3f6xA           -----------------------------------------------------------RVAIKTLSPEA
3d5wA           ----------------------------------------------------------------------
2qnjB           ---------------------------------------------------------GREVAIKIIDKTQ
1o6lA           ----------------------------------------------------------------------
1o6kA           ----------------------------------------------------------------------
2jdoA           ----------------------------------------------------------------------
3g6hA           -----------------------------------------------------------RVAIKTLKPGT
3e8dB           ----------------------------------------------------------------------
3e8dA           ----------------------------------------------------------------------
3e88A           ----------------------------------------------------------------------
3e87A           ----------------------------------------------------------------------
3d0eA           ----------------------------------------------------------------------
2cl1A           ----------------------------------------------------------------------
2weiA           ----------------------------------------------------------------------
2w5aA           ----------------------------------------------------------------------
2vrxB           ------------------------------------------------------------MALKVLFKSQ
2vgpB           ------------------------------------------------------------MALKVLFKSQ
2vgpA           ------------------------------------------------------------MALKVLFKSQ
2vgoA           ------------------------------------------------------------MALKVLFKSQ
2oidB           ----------------------------------------------------------------------
2oicB           ----------------------------------------------------------------------
3f6xC           -----------------------------------------------------------RVAIKTLKPP-
2dylA           ----------------------------------------------------------------------
2bfyB           ------------------------------------------------------------MALKVLFKSQ
2bfyA           ------------------------------------------------------------MALKVLFKSQ
2bfxB           ------------------------------------------------------------MALKVLFKSQ
2bfxA           ------------------------------------------------------------MALKVLFKSQ
1yrpA           ----------------------------------------------------------------------
2oiqB           -----------------------------------------------------------RVAIKTLKPGT
3fe3A           ---------------------------------------------------------GREVAIKIIDKTQ
2oidD           ----------------------------------------------------------------------
2j90A           ----------------------------------------------------------------------
2bdfB           -----------------------------------------------------------RVAIKTLKPGT
1yi6A           -----------------------------------------------------------RVAIKTLKPGT
2pziA           ----------------------------------------------------------------------
2j7tA           ----------------------------------------------------------------------
3h4jA           -----------------------------------------------------------KVALKFISRQL
2pziB           ----------------------------------------------------------------------
2hakE           ---------------------------------------------------------GREVAVKIIDKTQ
2wqeA           ------------------------------------------------------------LALKVLFKAQ
3hztA           ---------------------------------------------------------GAERAIKIIKKSS
3hkoA           ----------------------------------------------------------------------
3f6xB           -----------------------------------------------------------RVAIKTLKPGT
3dxnA           ---------------------------------------------------------GAERAIKIIKKSS
3d7tB           -----------------------------------------------------------RVAIKTLKPGT
2bdjA           -----------------------------------------------------------RVAIKTLKPGT
2bdfA           -----------------------------------------------------------RVAIKTLKPGT
1a06A           ----------------------------------------------------------------------
2ozaA           ----------------------------------------------------------------------
2j90B           ----------------------------------------------------------------------
3en4B           -----------------------------------------------------------RVAIKTLKPGT
2bdwB           ----------------------------------------------------------------------
2bdwA           ----------------------------------------------------------------------
2v5qA           -------------------------------------------------------------AGKIVPKSL
2hakA           ---------------------------------------------------------GREVAVKIIDKTQ
1zmuB           ---------------------------------------------------------GKEVAVKIIDKTQ
1zmuA           ---------------------------------------------------------GKEVAVKIIDKTQ
2qr8A           ----------------------------------------------------------------------
1p4fA           ----------------------------------------------------------------------
2oidA           ----------------------------------------------------------------------
3ehaA           ----------------------------------------------------------------------
3eh9A           ----------------------------------------------------------------------
2w5hA           ----------------------------------------------------------------------
2rkuA           -------------------------------------------------------------AGKIVPKSL
2ou7A           -------------------------------------------------------------AGKIVPKSL
3fc2A           -------------------------------------------------------------AGKIVPKSL
3el8A           -----------------------------------------------------------RVAIKTLKPGT
3efwB           ------------------------------------------------------------LALKVLFKAQ
3efwA           ------------------------------------------------------------LALKVLFKAQ
1wvyA           ----------------------------------------------------------------------
1wvwA           ----------------------------------------------------------------------
2oidC           ----------------------------------------------------------------------
1jktA           ----------------------------------------------------------------------
1jkkA           ----------------------------------------------------------------------
1ig1A           ----------------------------------------------------------------------
3geqB           -----------------------------------------------------------RVAIKTLKPGT
3dgkA           ----------------------------------------------------------------------
3dfcB           ----------------------------------------------------------------------
1zmvB           ---------------------------------------------------------GKEVAVRIIDKTQ
1zmvA           ---------------------------------------------------------GKEVAVRIIDKTQ
2vd5A           ----------------------------------------------------------------------
1k9aE           ---------------------------------------------------------GNKVAVKCIKNDA
1k9aD           ---------------------------------------------------------GNKVAVKCIKNDA
2javA           ----------------------------------------------------------------------
1zmwB           ---------------------------------------------------------GKEVAVKIIDKTQ
1zmwA           ---------------------------------------------------------GKEVAVKIIDKTQ
2jbpC           ----------------------------------------------------------------------
3hmiA           ------------------------------------------------------------VAVKTLKEDT
2h9vA           ----------------------------------------------------------------------
3fpmA           ----------------------------------------------------------------------
2f2uB           ----------------------------------------------------------------------
2f2uA           ----------------------------------------------------------------------
3dbeA           -------------------------------------------------------------AGKVVPKSM
2oicC           ------------------------------------------------------------VAVKKLEE--
1mryA           ----------------------------------------------------------------------
2jc6C           ----------------------------------------------------------------------
2jc6A           ----------------------------------------------------------------------
3geqA           -----------------------------------------------------------RVAIKTLKPGT
3g5dB           -----------------------------------------------------------RVAIKTLKMSP
3g5dA           -----------------------------------------------------------RVAIKTLSPEA
3f3uB           -----------------------------------------------------------RVAIKTLK---
3el8B           -----------------------------------------------------------RVAIKTLP---
3f3tB           -----------------------------------------------------------RVAIKTLKPSP
1k9aC           ---------------------------------------------------------GNKVAVKCIKNDA
1k9aA           ---------------------------------------------------------GNKVAVKCIKNDA
1fmkA           -----------------------------------------------------------RVAIKTLKPGT
3d7uA           ---------------------------------------------------------GNKVAVKCIKNDA
2v55C           ----------------------------------------------------------------------
2v55A           ----------------------------------------------------------------------
2r0iA           ---------------------------------------------------------GKEVAVKIIDKTQ
1k9aB           ---------------------------------------------------------GNKVAVKCIKNDA
2jbpF           ----------------------------------------------------------------------
2jbpE           ----------------------------------------------------------------------
2jbpD           ----------------------------------------------------------------------
2etkB           ----------------------------------------------------------------------
2etkA           ----------------------------------------------------------------------
2qlqB           ----------------------------------------------------------------------
2o8yB           ----------------------------------------------------------------------
3igoA           ----------------------------------------------------------------------
2hakD           ---------------------------------------------------------GREVAVKIIDKTQ
2hakC           ---------------------------------------------------------GREVAVKIIDKTQ
3g6gB           -----------------------------------------------------------RVAIKTLKPGT
2vgoB           ------------------------------------------------------------MALKVLFKSQ
2pzyB           ----------------------------------------------------------------------
2onlD           ----------------------------------------------------------------------
2onlC           ----------------------------------------------------------------------
2h96A           ----------------------------------------------------------------------
2gmxB           ----------------------------------------------------------------------
2gmxA           ----------------------------------------------------------------------
2g01B           ----------------------------------------------------------------------
2g01A           ----------------------------------------------------------------------
3dfaA           ----------------------------------------------------------------------
1tkiA           ----------------------------------------------------------------------
2qi8A           -----------------------------------------------------------RVAIKTL----
2pzyD           ----------------------------------------------------------------------
1ol6A           ------------------------------------------------------------LALKVLFKAQ
2oiqA           -----------------------------------------------------------RVAIKTLKPGT
1k9aF           ---------------------------------------------------------GNKVAVKCIKNDA
3cqwA           ----------------------------------------------------------------------
3cquA           ----------------------------------------------------------------------
2zv9A           --------------------------------------------------------NSTKVAVKTLKPGT
2o8yA           ----------------------------------------------------------------------
3g6gA           -----------------------------------------------------------RVAIKTLKPGT
1bygA           ---------------------------------------------------------GNKVAVKCIKNDA
2pl0A           -----------------------------------------------------------KVAVKSLKQGS
2of2A           -----------------------------------------------------------KVAVKSLKQGS
1koaA           ----------------------------------------------------------------------
2jbpB           ----------------------------------------------------------------------
2hw6A           ----------------------------------------------------------------------
3en5B           -----------------------------------------------------------RVAIKTLKPGT
1gzkA           ----------------------------------------------------------------------
3en4A           -----------------------------------------------------------RVAIKTLK---
3d7uD           -----------------------------------------------------------RVAIKTLKPGT
3d7uB           -----------------------------------------------------------RVAIKTLKPGT
3d7tA           ---------------------------------------------------------GNKVAVKCIKNDA
1qpjA           -----------------------------------------------------------KVAVKSLKQGS
1qpdA           -----------------------------------------------------------KVAVKSLKQGS
1qpcA           -----------------------------------------------------------KVAVKSLKQGS
2ofuA           -----------------------------------------------------------KVAVKSLKQGS
2jbpI           ----------------------------------------------------------------------
3gvuA           ------------------------------------------------------------VAVKTLKEDT
3f3vB           -----------------------------------------------------------RVAIKTLKPGT
3f3tA           -----------------------------------------------------------RVAIKTLKPGT
3e7oA           ----------------------------------------------------------------------
3bymA           -----------------------------------------------------------KVAVKSLKQGS
1ym7D           ----------------------------------------------------------------------
1ym7C           ----------------------------------------------------------------------
1ym7A           ----------------------------------------------------------------------
2wntA           ----------------------------------------------------------------------
2qq7A           -----------------------------------------------------------RVAIKTL----
1omwA           ----------------------------------------------------------------------
2jboA           ----------------------------------------------------------------------
3g6hB           -----------------------------------------------------------RVAIKTLKPGT
3cikA           ----------------------------------------------------------------------
2bcjA           ----------------------------------------------------------------------
2pzyC           ----------------------------------------------------------------------
2ptkA           -----------------------------------------------------------RVAIKTLKPP-
1pmqA           ----------------------------------------------------------------------
2hakG           ---------------------------------------------------------GREVAVKIIDKTQ
3fmeA           ----------------------------------------------------------------------
3f3wB           -----------------------------------------------------------RVAIKTLKPGT
3f3wA           -----------------------------------------------------------RVAIKTLKPGT
1yolB           -----------------------------------------------------------RVAIKTLKPGT
1yolA           -----------------------------------------------------------RVAIKTLKPGT
2wajA           ----------------------------------------------------------------------
3fi2A           ----------------------------------------------------------------------
2fh9A           ----------------------------------------------------------------------
2wntB           ----------------------------------------------------------------------
2qkwB           --------------------------------------------------------DGAKVALKRRTPES
2i6lA           ----------------------------------------------------------------------
3hgkC           --------------------------------------------------------DGAKVALKRRTPES
3hgkB           --------------------------------------------------------DGAKVALKRRTPES
3hgkA           --------------------------------------------------------DGAKVALKRRTPES
3b2wA           -----------------------------------------------------------KVAVKSLKQGS
2qi8B           -----------------------------------------------------------RVAIKTL----
2jbpH           ----------------------------------------------------------------------
3fv8A           ----------------------------------------------------------------------
1zycD           ----------------------------------------------------------------------
1zycC           ----------------------------------------------------------------------
2zvaA           --------------------------------------------------------NSTKVAVKTLKPGT
2zv7A           --------------------------------------------------------NSTKVAVKTLKPGT
1yomA           -----------------------------------------------------------RVAIKTLKPGT
2pzyA           ----------------------------------------------------------------------
2hw7A           -------------------------------------------------------------AVKIIEKQ-
3en7A           -----------------------------------------------------------RVAIKTL----
3bgzA           --------------------------------------------------------DNLPVAIKHVEKDR
1ua2A           ------------------------------------------------------------VAIKKINRTA
2ofvB           -----------------------------------------------------------KVAVKSLKQGA
3dlsF           ----------------------------------------------------------------------
3dlsE           ----------------------------------------------------------------------
3dlsD           ----------------------------------------------------------------------
3dlsC           ----------------------------------------------------------------------
3dlsB           ----------------------------------------------------------------------
3dlsA           ----------------------------------------------------------------------
3cy3A           --------------------------------------------------------DNLPVAIKHVEKDR
2c3iB           --------------------------------------------------------DNLPVAIKHVEKDR
1ny3A           ----------------------------------------------------------------------
1kobA           ----------------------------------------------------------------------
3k2lA           ----------------------------------------------------------------------
2jbpG           ----------------------------------------------------------------------
2o0uA           ----------------------------------------------------------------------
3hyhA           ---------------------------------------------------------GQKVALKIINKK-
3famB           ---------------------------------------------------------GQKVALKIINKK-
2eueB           ---------------------------------------------------------GQKVALKIINKK-
3daeB           ---------------------------------------------------------GQKVALKIINKKV
3daeA           ---------------------------------------------------------GQKVALKIINKKV
3d5xA           -------------------------------------------------------------AGKVVPKSM
1cm8A           ---------------------------------------------------------GAKVAIKKLYR--
1zycA           ----------------------------------------------------------------------
1y8gB           ---------------------------------------------------------GKEVAVKIIDKTQ
1y8gA           ---------------------------------------------------------GKEVAVKIIDKTQ
2j0jA           ------------------------------------------------------------VAIKTCKNCT
2g9xC           ----------------------------------------------------------------------
3fi3A           ----------------------------------------------------------------------
3d83A           ----------------------------------------------------------------------
3cy2A           --------------------------------------------------------DNLPVAIKHVEKDR
3cxwA           --------------------------------------------------------DNLPVAIKHVEKDR
3blrA           ----------------------------------------------------------------------
1zycB           ----------------------------------------------------------------------
1qcfA           -----------------------------------------------------------KVAVKTMKPGS
1pmeA           ----------------------------------------------------------------------
2jedB           ----------------------------------------------------------------------
2jedA           ----------------------------------------------------------------------
3hyhB           ---------------------------------------------------------GQKVALKIINKKV
2hwoA           -----------------------------------------------------------RVAIKTL----
2hk5A           -----------------------------------------------------------KVAVKTMKPGS
3gc8B           ----------------------------------------------------------------------
3gc8A           ----------------------------------------------------------------------
3g33A           ----------------------------------------------------------------------
3famA           ---------------------------------------------------------GQKVALKIINKKV
2etmA           ------------------------------------------------------------VAIKTCKNCT
3blhA           ---------------------------------------------------------GQKVALKKVEKEG
1zydA           ----------------------------------------------------------------------
2rioB           ---------------------------------------------------------GRPVAVKRMLIDF
2jbpA           ----------------------------------------------------------------------
2j0lA           ------------------------------------------------------------VAIKTCKNCT
2ac5A           -------------------------------------------------------------AVKIIEKQ-
1ukiA           ----------------------------------------------------------------------
1pmuA           ----------------------------------------------------------------------
2objA           --------------------------------------------------------DNLPVAIKHVEKDR
2fysA           ----------------------------------------------------------------------
3fxxA           ----------------------------------------------------------------------
3f2aA           --------------------------------------------------------DNLPVAIKHVEKDR
3en7B           ----------------------------------------------------------------------
3dcvA           --------------------------------------------------------DNLPVAIKHVEKDR
3da6A           ----------------------------------------------------------------------
2bujA           ----------------------------------------------------------------------
2bikB           --------------------------------------------------------DNLPVAIKHVEKDR
2b9iA           ----------------------------------------------------------------------
2b9fA           ----------------------------------------------------------------------
2acxB           ----------------------------------------------------------------------
2acxA           ----------------------------------------------------------------------
2ac3A           -------------------------------------------------------------AVKIIEKQ-
1yomB           -----------------------------------------------------------RVAIKTLKPGT
1xo2B           ----------------------------------------------------------------------
2r3qA           ----------------------------------------------------------------------
2r3iA           ----------------------------------------------------------------------
1jowB           ----------------------------------------------------------------------
2hwpB           ----------------------------------------------------------------------
1gz8A           ----------------------------------------------------------------------
3gc9B           ----------------------------------------------------------------------
1g3nA           ----------------------------------------------------------------------
2f2cB           ----------------------------------------------------------------------
2eufB           ----------------------------------------------------------------------
3dogC           ----------------------------------------------------------------------
1blxA           ----------------------------------------------------------------------
1bi8A           ----------------------------------------------------------------------
1bi7A           ----------------------------------------------------------------------
1zydB           ----------------------------------------------------------------------
2zdtA           ----------------------------------------------------------------------
2z7sA           ----------------------------------------------------------------------
2z7rA           ----------------------------------------------------------------------
2z7qA           ----------------------------------------------------------------------
1pmvA           ----------------------------------------------------------------------
1pmnA           ----------------------------------------------------------------------
2p33A           ----------------------------------------------------------------------
1oguC           ----------------------------------------------------------------------
1mrvA           ----------------------------------------------------------------------
1jnkA           ----------------------------------------------------------------------
2hwoB           ----------------------------------------------------------------------
3g9nA           ----------------------------------------------------------------------
3g90X           ----------------------------------------------------------------------
3fbvI           ---------------------------------------------------------GRPVAVKRMLIDF
3fbvD           ---------------------------------------------------------GRPVAVKRMLIDF
3fbvA           ---------------------------------------------------------GRPVAVKRMLIDF
2fa2B           ----------------------------------------------------------------------
2fa2A           ----------------------------------------------------------------------
2f49A           ----------------------------------------------------------------------
3el7A           -----------------------------------------------------------RVAIKTLKPTM
3blqA           ----------------------------------------------------------------------
3bhuC           ----------------------------------------------------------------------
3bhtC           ----------------------------------------------------------------------
2b9hA           ----------------------------------------------------------------------
1yxsA           --------------------------------------------------------DNLPVAIKHVEKDR
1ywvA           --------------------------------------------------------DNLPVAIKHVEKDR
1xwsA           --------------------------------------------------------DNLPVAIKHVEKDR
1xqzA           --------------------------------------------------------DNLPVAIKHVEKDR
2w9zB           ----------------------------------------------------------------------
2w99B           ----------------------------------------------------------------------
2r9sA           ----------------------------------------------------------------------
2qq7B           ----------------------------------------------------------------------
2j2iB           --------------------------------------------------------DNLPVAIKHVEKDR
2i6lB           -----------------------------------------------------------RVAIKKI---V
3c4eC           --------------------------------------------------------DNLPVAIKHVEKDR
2bzkB           --------------------------------------------------------DNLPVAIKHVEKDR
2bzhB           --------------------------------------------------------DNLPVAIKHVEKDR
2bilB           --------------------------------------------------------DNLPVAIKHVEKDR
2w96B           ----------------------------------------------------------------------
1w98A           ----------------------------------------------------------------------
2qlqA           ----------------------------------------------------------------------
1oiyA           ----------------------------------------------------------------------
1oiuC           ----------------------------------------------------------------------
1oi9A           ----------------------------------------------------------------------
1oguA           ----------------------------------------------------------------------
1jsuA           ----------------------------------------------------------------------
1jstA           ----------------------------------------------------------------------
2jgzA           ----------------------------------------------------------------------
2iw9C           ----------------------------------------------------------------------
2iw9A           ----------------------------------------------------------------------
2iw8C           ----------------------------------------------------------------------
2iw8A           ----------------------------------------------------------------------
2iw6C           ----------------------------------------------------------------------
2iw6A           ----------------------------------------------------------------------
2hw6B           ----------------------------------------------------------------------
1h4lA           ----------------------------------------------------------------------
1h27C           ----------------------------------------------------------------------
1h26C           ----------------------------------------------------------------------
1h25C           ----------------------------------------------------------------------
1h24A           ----------------------------------------------------------------------
2g9xA           ----------------------------------------------------------------------
3eljA           ----------------------------------------------------------------------
1e9hA           ----------------------------------------------------------------------
3dogA           ----------------------------------------------------------------------
3ddqC           ----------------------------------------------------------------------
3ddqA           ----------------------------------------------------------------------
2cjmC           ----------------------------------------------------------------------
2cjmA           ----------------------------------------------------------------------
2cchA           ----------------------------------------------------------------------
3bhtA           ----------------------------------------------------------------------
2z8cA           -----------------------------------------------------------RVAVKTVNESA
1xjdA           ----------------------------------------------------------------------
1ir3A           -----------------------------------------------------------RVAVKTVNESA
3fy2A           ----------------------------------------------------------------------
3etaB           -----------------------------------------------------------RVAVKTVNESA
1zxeD           ----------------------------------------------------------------------
2w9fB           ----------------------------------------------------------------------
2rioA           ---------------------------------------------------------GRPVAVKRMLIDF
2qocA           ----------------------------------------------------------------------
2qkrA           ----------------------------------------------------------------------
3bu5A           -----------------------------------------------------------RVAVKTVNESA
3bu3A           -----------------------------------------------------------RVAVKTVNESA
2auhA           -----------------------------------------------------------RVAVKTVNESA
1yojB           ----------------------------------------------------------------------
1kwpA           ----------------------------------------------------------------------
2f9gA           ----------------------------------------------------------------------
3en6B           ----------------------------------------------------------------------
3en6A           ----------------------------------------------------------------------
3en5A           ----------------------------------------------------------------------
2e9nA           ------------------------------------------------------------VAVKIVDKRA
3cblA           --------------------------------------------------------DNTLVAVKSC-RET
3bkbA           --------------------------------------------------------DNTLVAVKSC-RET
2aypA           ------------------------------------------------------------VAVKIVDKRA
3gc9A           ----------------------------------------------------------------------
3eidA           ----------------------------------------------------------------------
3d7zA           ----------------------------------------------------------------------
3bz3A           ------------------------------------------------------------VAIKTCKNCT
2z7lA           ----------------------------------------------------------------------
1v0oB           ----------------------------------------------------------------------
1v0oA           ----------------------------------------------------------------------
1v0bA           ----------------------------------------------------------------------
1tvoA           ----------------------------------------------------------------------
2ojiA           ----------------------------------------------------------------------
2ojgA           ----------------------------------------------------------------------
2iwiB           ----------------------------------------------------------------------
2iwiA           ----------------------------------------------------------------------
1ia8A           -----------------------------------------------------------RVTEEAVAVKI
1h0vA           ----------------------------------------------------------------------
2gphA           ----------------------------------------------------------------------
1golA           ----------------------------------------------------------------------
3g9lX           ----------------------------------------------------------------------
3etaA           -----------------------------------------------------------RVAVKTVNESA
3erkA           ----------------------------------------------------------------------
1erkA           ----------------------------------------------------------------------
3enmC           ----------------------------------------------------------------------
2cgxA           -----------------------------------------------------------RVTEEAVAVKI
2cgvA           -----------------------------------------------------------RVTEEAVAVKI
2cguA           -----------------------------------------------------------RVTEEAVAVKI
2c3kA           -----------------------------------------------------------RVTEEAVAVKI
2c3jA           ----------------------------------------------------------------------
2brnA           -----------------------------------------------------------RVTEEAVAVKI
2a1aB           ----------------------------------------------------------------------
2a19B           ----------------------------------------------------------------------
1zysA           ----------------------------------------------------------------------
1zy4A           ----------------------------------------------------------------------
2zduA           ----------------------------------------------------------------------
1yhsA           --------------------------------------------------------DNLPVAIKHVEKDR
2wmxA           ----------------------------------------------------------------------
2wmwA           ----------------------------------------------------------------------
2wmvA           ----------------------------------------------------------------------
2wmuA           ----------------------------------------------------------------------
2wmtA           ----------------------------------------------------------------------
2wmsA           ----------------------------------------------------------------------
2wmrA           ----------------------------------------------------------------------
1unlA           ----------------------------------------------------------------------
1unhA           ----------------------------------------------------------------------
1ungB           ----------------------------------------------------------------------
1ungA           ----------------------------------------------------------------------
2r3kA           ----------------------------------------------------------------------
2r0uA           ----------------------------------------------------------------------
2qhnA           ----------------------------------------------------------------------
2pz5B           --------------------------------------------------------EAVTVAVKMLKDDA
2pz5A           --------------------------------------------------------EAVTVAVKMLKDDA
2pmiC           ----------------------------------------------------------------------
2pmiA           ----------------------------------------------------------------------
2pk9C           ----------------------------------------------------------------------
2pk9A           ----------------------------------------------------------------------
2ok1A           ----------------------------------------------------------------------
2ofvA           -----------------------------------------------------------KVAVKSL-KQG
2o2uA           ----------------------------------------------------------------------
1nvrA           ----------------------------------------------------------------------
3jvsA           ----------------------------------------------------------------------
3jvrA           ----------------------------------------------------------------------
2hogA           ----------------------------------------------------------------------
3hmmA           ----------------------------------------------------------------------
2gdoA           ----------------------------------------------------------------------
3g2fA           ----------------------------------------------------------------------
3f9nA           ----------------------------------------------------------------------
2excX           ----------------------------------------------------------------------
3enmB           ----------------------------------------------------------------------
2cgwA           ----------------------------------------------------------------------
3cd3A           --------------------------------------------------------DNTLVAVKSCR---
2c3lA           ----------------------------------------------------------------------
3byuA           -----------------------------------------------------------KVAVKSLKQGS
2brmA           ----------------------------------------------------------------------
2brhA           ----------------------------------------------------------------------
2brgA           ----------------------------------------------------------------------
1sm2A           -----------------------------------------------------------KVAIKTIREGA
2r7iD           ----------------------------------------------------------------------
2qo9A           ----------------------------------------------------------------------
2pzrB           --------------------------------------------------------EAVTVAVKMLKDDA
2pzrA           --------------------------------------------------------EAVTVAVKMLKDDA
2pzpA           --------------------------------------------------------EAVTVAVKMLKDDA
2og8B           -----------------------------------------------------------KVAVKSLKQGS
1mqbB           ----------------------------------------------------------------------
2i40A           ----------------------------------------------------------------------
3enmD           ----------------------------------------------------------------------
3enmA           ----------------------------------------------------------------------
3e92A           ----------------------------------------------------------------------
2b1pA           ----------------------------------------------------------------------
1ykrA           ----------------------------------------------------------------------
2wipC           ----------------------------------------------------------------------
2wipA           ----------------------------------------------------------------------
2w06A           ----------------------------------------------------------------------
1vywC           ----------------------------------------------------------------------
1vywA           ----------------------------------------------------------------------
2vtrA           ----------------------------------------------------------------------
2vtpA           ----------------------------------------------------------------------
1uwhA           ------------------------------------------------------------VAVKMLNVTA
2r3jA           ----------------------------------------------------------------------
2r3hA           ----------------------------------------------------------------------
2pvyD           --------------------------------------------------------EAVTVAVKMLKDDA
2ow3B           ----------------------------------------------------------------------
2ow3A           ----------------------------------------------------------------------
1okvC           ----------------------------------------------------------------------
1okvA           ----------------------------------------------------------------------
1oirA           ----------------------------------------------------------------------
1o9uA           ----------------------------------------------------------------------
1kwpB           ----------------------------------------------------------------------
1jsvA           ----------------------------------------------------------------------
2jkqA           ------------------------------------------------------------VAIKTCKNCT
2jkmA           ------------------------------------------------------------VAIKTCKNCT
2jkkA           ------------------------------------------------------------VAIKTCKNCT
2j0kB           ------------------------------------------------------------VAIKTCKNCT
1irkA           -----------------------------------------------------------RVAVKTVNESA
2ijmB           ------------------------------------------------------------VAIKTCKNCT
2ijmA           ------------------------------------------------------------VAIKTCKNCT
2hwpA           ----------------------------------------------------------------------
1hckA           ----------------------------------------------------------------------
1h0uA           ----------------------------------------------------------------------
1h01A           ----------------------------------------------------------------------
1gngB           ----------------------------------------------------------------------
1gngA           ----------------------------------------------------------------------
3gc7A           ----------------------------------------------------------------------
3f88A           ----------------------------------------------------------------------
3f7zB           ----------------------------------------------------------------------
3f7zA           ----------------------------------------------------------------------
3f5xA           ----------------------------------------------------------------------
1f5qC           ----------------------------------------------------------------------
1f5qA           ----------------------------------------------------------------------
2etmB           ------------------------------------------------------------VAIKTCKNCT
3eqrB           ------------------------------------------------------APSGVSVAVKCLKPDV
3eocC           ----------------------------------------------------------------------
3ej1C           ----------------------------------------------------------------------
3ej1A           ----------------------------------------------------------------------
1e1vA           ----------------------------------------------------------------------
2ds1A           ----------------------------------------------------------------------
1di8A           ----------------------------------------------------------------------
2clxA           ----------------------------------------------------------------------
2c6iA           ----------------------------------------------------------------------
2c68A           ----------------------------------------------------------------------
2c5yA           ----------------------------------------------------------------------
2c4gC           ----------------------------------------------------------------------
2c4gA           ----------------------------------------------------------------------
1buhA           ----------------------------------------------------------------------
2bkzC           ----------------------------------------------------------------------
2a4lA           ----------------------------------------------------------------------
1nxkB           ----------------------------------------------------------------------
3d4qA           ----------------------------------------------------------------------
1agwB           -----------------------------------------------------------KVAVKMLKSDA
1zxeC           ----------------------------------------------------------------------
1yojA           ----------------------------------------------------------------------
2vtsA           ----------------------------------------------------------------------
2vtoA           ----------------------------------------------------------------------
1v0bB           ----------------------------------------------------------------------
1uv5A           ----------------------------------------------------------------------
1r0eA           ----------------------------------------------------------------------
2qokA           ----------------------------------------------------------------------
1q5kB           ----------------------------------------------------------------------
1q5kA           ----------------------------------------------------------------------
1q4lB           ----------------------------------------------------------------------
1q4lA           ----------------------------------------------------------------------
1q41B           ----------------------------------------------------------------------
1q41A           ----------------------------------------------------------------------
1q3wB           ----------------------------------------------------------------------
1q3wA           ----------------------------------------------------------------------
1q3dB           ----------------------------------------------------------------------
1q3dA           ----------------------------------------------------------------------
1pyxB           ----------------------------------------------------------------------
1pyxA           ----------------------------------------------------------------------
2pwlA           --------------------------------------------------------EAVTVAVKMLKDDA
2pvfA           ------------------------------------------------------------VAVKMLKDDA
1ob3A           ----------------------------------------------------------------------
2o5kA           ----------------------------------------------------------------------
2jldB           ----------------------------------------------------------------------
2jldA           ----------------------------------------------------------------------
1j1bB           ----------------------------------------------------------------------
1j1bA           ----------------------------------------------------------------------
2j0kA           ------------------------------------------------------------VAIKTCKNCT
2i0yA           -----------------------------------------------------------KVAVKTAHADE
2i0vA           -----------------------------------------------------------KVAVKTAHADE
1i09B           ----------------------------------------------------------------------
1i09A           ----------------------------------------------------------------------
1h8fB           ----------------------------------------------------------------------
1h8fA           ----------------------------------------------------------------------
3eidC           ----------------------------------------------------------------------
3du8A           ----------------------------------------------------------------------
2bajA           ----------------------------------------------------------------------
3b2tB           --------------------------------------------------------EAVTVAVKMLKDDA
3b2tA           --------------------------------------------------------EAVTVAVKMLKDDA
2zb0A           ----------------------------------------------------------------------
2zazA           ----------------------------------------------------------------------
1yqjA           ----------------------------------------------------------------------
1y91A           ----------------------------------------------------------------------
2wmqA           ----------------------------------------------------------------------
1wbsA           ----------------------------------------------------------------------
2pvyA           --------------------------------------------------------EAVTVAVKMLKDDA
1oz1A           ----------------------------------------------------------------------
1ouyA           ----------------------------------------------------------------------
2ivsA           ------------------------------------------------------------VAVKMLKENA
1iasB           ----------------------------------------------------------------------
3hrbA           ----------------------------------------------------------------------
1h08A           ----------------------------------------------------------------------
3gfeA           ----------------------------------------------------------------------
3fz1A           ----------------------------------------------------------------------
1di9A           ----------------------------------------------------------------------
3d94A           -----------------------------------------------------------RVAIKTVNEAA
3cokA           ---------------------------------------------------------GLEVAIKMIDKKA
1bmkA           ----------------------------------------------------------------------
1zxeA           ----------------------------------------------------------------------
1vyzA           ----------------------------------------------------------------------
1ukhA           ----------------------------------------------------------------------
1sm2B           -----------------------------------------------------------KVAIKTIREGA
2r7iC           ----------------------------------------------------------------------
2r7iA           ----------------------------------------------------------------------
2pwlB           --------------------------------------------------------EAVTVAVKMLKDDA
2p3gX           ----------------------------------------------------------------------
2gtmA           ----------------------------------------------------------------------
3fzoA           ------------------------------------------------------------VAVKTCKKDC
2fysB           ----------------------------------------------------------------------
3eknA           -----------------------------------------------------------RVAVKTVNESA
3e3bX           ----------------------------------------------------------------------
3db8A           -------------------------------------------------------------AGKVVPKSM
3cokB           ---------------------------------------------------------GLEVAIKMIDKKA
3clyA           --------------------------------------------------------EAVTVAVKMLKDDA
2c0tB           -----------------------------------------------------------KVAVKTMKPGS
2c0tA           -----------------------------------------------------------KVAVKTMKPGS
2c0iA           -----------------------------------------------------------KVAVKTMKPGS
3bw5A           ----------------------------------------------------------------------
2zoqA           ----------------------------------------------------------------------
2qr7A           ----------------------------------------------------------------------
2psqB           --------------------------------------------------------EAVTVAVKMLKDDA
2psqA           --------------------------------------------------------EAVTVAVKMLKDDA
2og8A           -----------------------------------------------------------KVAVKSLKQGS
1nxkD           ----------------------------------------------------------------------
1nxkC           ----------------------------------------------------------------------
2jbpL           ----------------------------------------------------------------------
2io6A           --------------------------------------------------------DGCIYAIKRSKKPS
2in6A           --------------------------------------------------------DGCIYAIKRSKKPS
1h0wA           ----------------------------------------------------------------------
3e7oB           ----------------------------------------------------------------------
3coiA           ----------------------------------------------------------------------
3bysA           -----------------------------------------------------------KVAVKSLKQGS
3bizA           --------------------------------------------------------DGCIYAIKRSKKPS
2baqA           ----------------------------------------------------------------------
1ad5A           -----------------------------------------------------------KVAVKTMKPGS
2zjwA           ----------------------------------------------------------------------
1urwA           ----------------------------------------------------------------------
2rkpA           ----------------------------------------------------------------------
2pzpB           --------------------------------------------------------EAVTVAVKMLKDDA
2pvrA           ----------------------------------------------------------------------
1pjkA           ----------------------------------------------------------------------
1ob3B           ----------------------------------------------------------------------
1na7A           ----------------------------------------------------------------------
1jwhB           ----------------------------------------------------------------------
1jwhA           ----------------------------------------------------------------------
3ig7A           ----------------------------------------------------------------------
3h30A           ----------------------------------------------------------------------
3gxlA           ----------------------------------------------------------------------
1fvtA           ----------------------------------------------------------------------
2erkA           ----------------------------------------------------------------------
3eb0C           ----------------------------------------------------------------------
3eb0A           ----------------------------------------------------------------------
3bqcA           ----------------------------------------------------------------------
2balA           ----------------------------------------------------------------------
1zy4B           ----------------------------------------------------------------------
2wo6B           ----------------------------------------------------------------------
2wo6A           ----------------------------------------------------------------------
1wccA           ----------------------------------------------------------------------
2vx3D           ----------------------------------------------------------------------
2vx3C           ----------------------------------------------------------------------
2vx3B           ----------------------------------------------------------------------
2vx3A           ----------------------------------------------------------------------
2vtiA           ----------------------------------------------------------------------
2vthA           ----------------------------------------------------------------------
2uznA           ----------------------------------------------------------------------
2rg6A           ----------------------------------------------------------------------
2r7iB           ----------------------------------------------------------------------
2r3lA           ----------------------------------------------------------------------
2okrA           ----------------------------------------------------------------------
1nxkA           ----------------------------------------------------------------------
1ke6A           ----------------------------------------------------------------------
1jvpP           ----------------------------------------------------------------------
2jkoA           ------------------------------------------------------------VAIKTCKNCT
2jbpK           ----------------------------------------------------------------------
2j0mB           ------------------------------------------------------------VAIKTCKNCT
1giiA           ----------------------------------------------------------------------
2ghlA           ----------------------------------------------------------------------
2fb8A           ----------------------------------------------------------------------
3e93A           ----------------------------------------------------------------------
2e14A           ----------------------------------------------------------------------
1ckpA           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
3c4cA           ----------------------------------------------------------------------
3bv2A           ----------------------------------------------------------------------
1zy5B           ----------------------------------------------------------------------
2wouA           ----------------------------------------------------------------------
2wotA           ----------------------------------------------------------------------
1vjyA           ----------------------------------------------------------------------
1uwjA           ----------------------------------------------------------------------
1py5A           ----------------------------------------------------------------------
1mqbA           ----------------------------------------------------------------------
1iasA           ----------------------------------------------------------------------
1h07A           ----------------------------------------------------------------------
2gsfA           ----------------------------------------------------------------------
3ds6A           ----------------------------------------------------------------------
3cr0A           ----------------------------------------------------------------------
2bujB           ----------------------------------------------------------------------
1b6cB           ----------------------------------------------------------------------
1zxeE           ----------------------------------------------------------------------
1zxeB           ----------------------------------------------------------------------
1v1kA           ----------------------------------------------------------------------
2pmlX           ----------------------------------------------------------------------
1oitA           ----------------------------------------------------------------------
1lezA           ----------------------------------------------------------------------
2ivvA           ------------------------------------------------------------VAVKMLKENA
2ivuA           ------------------------------------------------------------VAVKMLKENA
2ivtA           ------------------------------------------------------------VAVKMLKENA
3eqpA           ------------------------------------------------------APSGVSVAVKCLQPEA
3eqpB           ------------------------------------------------------APSGVSVAVKCLQPEA
3c9wA           ----------------------------------------------------------------------
3c4cB           ----------------------------------------------------------------------
1ywrA           ----------------------------------------------------------------------
2qluA           ----------------------------------------------------------------------
2qd9A           ----------------------------------------------------------------------
1lewA           ----------------------------------------------------------------------
3idpA           ----------------------------------------------------------------------
1i44A           -----------------------------------------------------------RVAVKTVNESA
1h00A           ----------------------------------------------------------------------
3gxjA           ----------------------------------------------------------------------
3gcqA           ----------------------------------------------------------------------
3eqrA           ------------------------------------------------------APSGVSVAVKCLKPEA
2zb1A           ----------------------------------------------------------------------
2vtjA           ----------------------------------------------------------------------
2r3nA           ----------------------------------------------------------------------
2hakH           ---------------------------------------------------------GREVAVKIIDKTQ
3gp0A           ----------------------------------------------------------------------
3g2fB           ----------------------------------------------------------------------
3fqeA           ------------------------------------------------------------VAVKILK---
2duvA           ----------------------------------------------------------------------
2z2wA           ----------------------------------------------------------------------
1x8bA           ----------------------------------------------------------------------
2rg5A           ----------------------------------------------------------------------
2pvyB           --------------------------------------------------------EAVTVAVKMLKDDA
2onlA           ----------------------------------------------------------------------
1mp8A           ------------------------------------------------------SPPALAVAIKTCKNCT
3gcvA           ----------------------------------------------------------------------
3faaA           ----------------------------------------------------------------------
2c47C           ----------------------------------------------------------------------
2c47B           ----------------------------------------------------------------------
2c47A           ----------------------------------------------------------------------
3bi6A           ----------------------------------------------------------------------
1zxeF           ----------------------------------------------------------------------
1uwjB           ----------------------------------------------------------------------
1u54A           ----------------------------------------------------------------------
2jbpJ           ----------------------------------------------------------------------
3bx5A           ----------------------------------------------------------------------
1u54B           ------------------------------------------------------APSGKTVSVAVKCLEA
1u46B           ----------------------------------------------------------------------
2qo2A           ----------------------------------------------------------------------
2pvyC           --------------------------------------------------------EAVTVAVKMLKDDA
2ivsB           ------------------------------------------------------------VAVKMLKENA
2c47D           ----------------------------------------------------------------------
2btrA           ----------------------------------------------------------------------
1zyjA           ----------------------------------------------------------------------
1u4dA           ------------------------------------------------------APSGKTVSVAVKCPEA
2okrD           ----------------------------------------------------------------------
3gcuA           ----------------------------------------------------------------------
3gcpA           ----------------------------------------------------------------------
2fvdA           ----------------------------------------------------------------------
3e3pB           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3cc6A           ------------------------------------------------------------VAVKTCKKDC
1p14A           -----------------------------------------------------------RVAVKTVNESA
3idpB           ----------------------------------------------------------------------
2cmwA           ----------------------------------------------------------------------
3bceA           -------------------------------------------------------PEGETVKIPVAIKIL
2bakA           ----------------------------------------------------------------------
2b52A           ----------------------------------------------------------------------
1zz2A           ----------------------------------------------------------------------
1u59A           ----------------------------------------------------------------------
1u46A           ------------------------------------------------------APSGKTVSVAVKCPEA
2qolA           ----------------------------------------------------------------------
2puuA           ----------------------------------------------------------------------
2ozaB           ----------------------------------------------------------------------
3hp5A           ----------------------------------------------------------------------
3hl7A           ----------------------------------------------------------------------
2hakB           ---------------------------------------------------------GREVAVKIIDKTQ
2gtnA           ----------------------------------------------------------------------
2ewaA           ----------------------------------------------------------------------
3dzqA           ----------------------------------------------------------------------
3ctqA           ----------------------------------------------------------------------
1yw2A           ----------------------------------------------------------------------
1xbcA           ----------------------------------------------------------------------
1xbbA           ------------------------------------------------------------VAVKILK---
1xbaA           ----------------------------------------------------------------------
1r39A           ----------------------------------------------------------------------
2qooA           ----------------------------------------------------------------------
2qobA           ----------------------------------------------------------------------
1p2aA           ----------------------------------------------------------------------
1kv1A           ----------------------------------------------------------------------
1gijA           ----------------------------------------------------------------------
1gihA           ----------------------------------------------------------------------
3fqhB           ------------------------------------------------------------VAVKILK---
3dtcA           ----------------------------------------------------------------------
1ckjB           ----------------------------------------------------------------------
1ckjA           ----------------------------------------------------------------------
2w17A           ----------------------------------------------------------------------
2vv9A           ----------------------------------------------------------------------
2v62B           ----------------------------------------------------------------------
2v62A           ----------------------------------------------------------------------
2r4bB           ----------------------------------------------------------------------
2r4bA           ----------------------------------------------------------------------
2qoiA           ----------------------------------------------------------------------
2qofA           ----------------------------------------------------------------------
2qodA           ----------------------------------------------------------------------
3gcsA           ----------------------------------------------------------------------
3et7A           ------------------------------------------------------------VAVKTCKKDC
3bceB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LDLPGLREQLAEEVEMARRVARFCTAQVLAADLDADPPYVVSEYVEGPSLQAVVRERGPLRGASLERLAV
3f69B           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
2q0nA           LRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIAAVCL
2j0iA           LRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIAAVCL
2fumB           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
2fumA           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
2cdzA           LRKQQRRELLFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIAAVCL
3f69A           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
2bvaB           ---------LFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIAAVCL
2bvaA           ---------LFNEVVIMRDYQHENVVEMYNSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIAAVCL
1mruB           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
1mruA           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
1yhvA           LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEG-QIAAVCR
1o6yA           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
1yhwA           LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEG-QIAAVCR
2f57B           LRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCL
2f57A           LRKQQRRELLFNEVVIMRDYHHDNVVDMYSSYLVGDELWVVMEFLEGGALTDIVTHTR-MNEEQIATVCL
2fumD           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
3ckxA           --------------------------------------WIIMEYLGGGSALDLL-EPGPLDETQIATILR
2c30A           LRKQQRRELLFNEVVIMRDYQHFNVVEMYKSYLVGEELWVLMEFLQGGALTDIVSQVR-LNEEQIATVCE
3fxzA           LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEG-QIAAVCR
3f61A           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
1f3mC           LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEG-QIAAVCR
2vwiC           CQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHKGEHKSGVLDESTI
1f3mD           LQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCMDEG-QIAAVCR
1u5qA           KQSNEKWQDIIKEVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTH
3dakD           CQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHKGEHKSGVLDESTI
3ggfA           --------------------------------------WIIMEYLGGGSALDLLRA-GPFDEFQIATMLK
1fotA           ---------------------------------DAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAA
2vz6B           --------------------------------------YLIFDLVTGGELFEDIVAREYYSEADASHCIQ
2vz6A           --------------------------------------YLIFDLVTGGELFEDIVAREYYSEADASHCIQ
3ggfB           --------------------------------------WIIMEYLGGGSALDLLRA-GPFDEFQIATMLK
2fumC           ARDPSFYLRFRREAQNAAALNHPAIVAVYEAETPAGPPYIVMEYVDGVTLRDIVHTEGPMTPKRAIEVIA
3dbqA           ----------------------------------------------------------------------
3c4yA           ----------------------------------------------------------------------
1ol7A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
1ol5A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3ha6A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2j4zB           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2j4zA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3h10B           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3h10A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3gfwA           ----------------------------------------------------------------------
3dakA           CQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHKGEHKSGVLDESTI
3c51A           ----------------------------------------------------------------------
3c50B           ----------------------------------------------------------------------
3c50A           ----------------------------------------------------------------------
3c4zA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
3c4xB           ----------------------------------------------------------------------
3c4xA           ----------------------------------------------------------------------
3c4wB           ----------------------------------------------------------------------
3c4wA           ----------------------------------------------------------------------
3dy7A           K--PAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI
2zmcA           ----------------------------------------------------------------------
2welA           --------------------------------------YLVFDLVTGGELFEDIVAREYYSEADASHCIQ
2vn9A           --------------------------------------YLVFDLVTGGELFEDIVAREYYSEADASHCIQ
3dj5A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSRFDEQRTAT
3c51B           ----------------------------------------------------------------------
1mq4A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3dakC           CQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHKGEHKSGVLDESTI
2w1gA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2vwiD           CQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHKGEHKSGVLDESTI
2vwiA           -----------------------------------DELWLVMKLLSGGSVLDIIKHKGEHKSGVLDESTI
1s9jA           K--PAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI
1s9iB           K--PAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSI
1muoA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3h9fA           ----------------------------------------------------------------------
3e5aA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3dj7A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSRFDEQRTAT
3d14A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSRFDEQRTAT
3ckwA           --------------------------------------WIIMEYLGGGSALDLL-EPGPLDETQIATILR
2w1fA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
1s9iA           K--PAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSI
1ql6A           EEVQELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMR
3eqcA           K--PAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI
3dv3A           K--PAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI
3d15A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSRFDEQRTAT
2c6dA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2w7xA           IKI--ISKNVETEIEILKKLNHPCIIKIKNF-FDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFY
2vd5B           --------------------------------------YLVMEYYVGGDLLTLLSKFGERIPAEMARFYL
3fdnA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3eqiA           K--PAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI
3eqfA           K--PAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI
3d2iA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSRFDEQRTAT
2zmdA           ----------------------------------------------------------------------
2w1eA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3comB           --------------------------------------WIVMEYCGAGSVSDIIRLRNKLTEDEIATILQ
3comA           --------------------------------------WIVMEYCGAGSVSDIIRLRNKLTEDEIATILQ
2cn5A           ------KRNVETEIEILKKLNHPCIIKIKNF-FDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFY
2vwiB           CQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHKGEHKSGVLDESTI
1u7eA           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
2r5tA           ----------------------------------ADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAA
3hdnA           ----------------------------------ADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAA
3hdmA           ----------------------------------ADKLYFVLDYINGGELFYHLQRERCFLEPRARFYAA
3fhiA           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
2c6eA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2uztA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
2phkA           EEVQELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMR
1phkA           EEVQELREATLKEVDILRKVSGHPNIIQLKDTYETNTFFLVFDLMKKGELFDYLTEKVTLSEKETRKIMR
2f7xE           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
3e8nA           K--PAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKKAGRIPEQILGKVSI
2clqA           -------QPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKGPLKDQTIGFYTK
3cekA           ----------------------------------------------------------------------
3bhhD           --------------------------------------YLVFDLVTGGELFEDIVAREYYSEADASHCIQ
3bhhC           --------------------------------------YLVFDLVTGGELFEDIVAREYYSEADASHCIQ
3bhhB           --------------------------------------YLVFDLVTGGELFEDIVAREYYSEADASHCIQ
3bhhA           --------------------------------------YLVFDLVTGGELFEDIVAREYYSEADASHCIQ
2v7oA           --------------------------------------YLVFDLVTGGELFEDIVAREYYSEADASHCIH
2clqB           -EIPERSQPLHEEIALHKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKGPLKDQTIGFYTK
2biyA           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
1uu8A           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
1uu7A           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
1sykB           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
1sykA           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
2jamB           --------------------------------------YLVMQLVSGGELFDRILERGVYTEKDASLVIQ
2jamA           --------------------------------------YLVMQLVSGGELFDRILERGVYTEKDASLVIQ
2gnlA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
2gnjA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
2bmcF           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2bmcC           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2bmcB           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2bmcA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
1ydrE           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
1xh8A           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
1xh6A           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
1stcE           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
1rejA           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
2qvsE           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
2qurA           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
1q8uA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
1q8tA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
1jbpE           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
3idbA           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
2gu8A           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
1fmoE           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
3fjqE           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
3e8eI           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
3e8cE           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
3e8cB           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
3dneA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
3dndA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
1ctpE           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
1cmkE           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
1cdkA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
2c1aA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFSEPHARFYAA
1bkxA           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
1apmE           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFAEPHARFYAA
2w5bA           --------------------------------------YIVMEYCEGGDLASVIKERQYLDEEFVLRVMT
2w1dA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
1okyA           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
2nruB           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
2nruA           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
2np8A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
1j3hB           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
1j3hA           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
3h10D           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
1h1wA           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
3dakB           CQTS--MDELLKEIQAMSQCHHPNIVSYYTSFVVKDELWLVMKLLSGGSVLDIIKHKGEHKSGVLDESTI
2w0jA           IKI--ISKNVETEIEILKKLNHPCIIKIKNF-FDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFY
2gngA           --------------------------------------YMVMEYMPGGDMFSHLRRIGRFSEPHARFYAA
2gnfA           --------------------------------------YMVMEYMPGGDMFSHLRRIGRFSEPHARFYAA
2evaA           -----------------------------------NPVCLVMEYAEGGSLYNVLHGAEPLTAAHAMSWCL
1xh9A           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFSEPHARFYAA
2qg5D           -------DRFKQEIEIMKSLDHPNIIRLYETFEDNTDIYLVMELCTGGELFERVVHKRVFRESDAARIMK
2qg5B           -------DRFKQEIEIMKSLDHPNIIRLYETFEDNTDIYLVMELCTGGELFERVVHKRVFRESDAARIMK
2qg5A           -------DRFKQEIEIMKSLDHPNIIRLYETFEDNTDIYLVMELCTGGELFERVVHKRVFRESDAARIMK
3h0zA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3h0yA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3f3zA           -------DRFKQEIEIMKSLDHPNIIRLYETFEDNTDIYLVMELCTGGELFERVVHKRVFRESDAARIMK
1uu9A           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
1smhA           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFSEPHARFYAA
1okzA           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
2nryA           ITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
3h9oA           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
1z5mA           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
2vo0A           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFSEPHARFYAA
2uw4A           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFSEPHARFYAA
2uvxA           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFSEPHARFYAA
1uu3A           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
2r7bA           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
1q61A           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFSEPHARFYAA
2jdtA           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFSEPHARFYAA
2j50A           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3c0iA           ---PGLSEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVAS
3c0hA           ---PGLSEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVAS
3c0gB           ---PGLSEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVAS
3c0gA           ---PGLSEDLKREASICHMLKHPHIVELLETYSSDGMLYMVFEFMDGADLCFEIVKRADAGFVYSEAVAS
3bqrA           ---------------------------------------LILELVSGGELFDFLAEKESLTEDEATQFLK
1q62A           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFSEPHARFYAA
1q24A           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFSEPHARFYAA
2nryD           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
1xh7A           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQ
1vzoA           --------------------------------------HLILDYINGGELFTHLSQRERFTEHEVQIYVG
2uv2A           --------------------------------------WILIEFCAGGAVDAVMLEERPLTESQIQVVCK
2qcsA           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQ
1q8wA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQ
1l3rE           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQ
2jflA           --------------------------------------WILIEFCAGGAVDAVMLEERPLTESQIQVVCK
2j51A           --------------------------------------WILIEFCAGGAVDAVMLEERPLTESQIQVVCK
3hrcA           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
3h0zC           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3h0zB           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2cpkE           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFEPHARFYAAQ
3bwjA           --------------------------------------YMVMEYVPGGEMFSHLRRIGRFEPHARFYAAQ
2i0eB           -----------------------------------DRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAA
2i0eA           -----------------------------------DRLYFVMEYVNGGDLMYHIQQVGRFKEPHAVFYAA
3cohA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSTRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2yzaA           LDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDF---FMVMEYVSGGELFDYICKHGRVEEMEARRLFQ
1rdqE           --------------------------------------YMVMEYVAGGEMFSHLRRIGRFSEPHARFYAA
2oibD           L-----KQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
3hrfA           ---------------------------------DDEKLYFGLSYAKNGELLKYIRKIGSFDETCTRFYTA
2oicD           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
2nryC           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
3dqxA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
2dq7X           MS----PESFLEEAQIMKKLKHDKLVQLYAV-VSEEPIYIVTEYMNKGSLLDFLKEGRALKLPNLVDMAA
3d5uA           LLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMR
2c6eB           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
1y57A           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMAA
2srcA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMAA
2oibB           L-----KQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
2h8hA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMAA
3db6A           LLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMR
1zwsA           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
2vo6A           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQ
2uvzA           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQ
2uvyA           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQ
1szmB           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQ
1szmA           --------------------------------------YMVMEYAPGGEMFSHLRRIGRFEPHARFYAAQ
2oibC           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
1kswA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVGEYMKGSLLDFLKGETGKLRLPQLVDMAA
3i79A           VKQKTDKESLLREVQLLKQLDHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKRFSEVDAARIIR
3hx4A           ------KESLLREVQLLKQLDHPNIMKLYEFFEDKGYFYLVGEVYTGGELFDEIISRKRFSEVDAARIIR
2ckeB           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
2ckeA           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
2a2aB           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
2a2aA           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
1wmkH           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
1wmkB           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
1wmkE           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
1wmkA           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
2oibA           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
2dwbA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3dqwD           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVIEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3dqwC           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVIEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3dqwA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVIEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3bhyA           ---------------------------------------LILELVSGGELFDFLAEKESLTEDEATQFLK
2a27A           ------REEIEREVSILRQVLHHNVITLHDVYENRTDVVLILELVSGGELFDFLAQKESLSEEEATSFIK
3dqxB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
2qnjA           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFR
3f6xD           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3d2kA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSRFDEQRTAT
2cn8A           IKI--ISKNVETEIEILKKLNHPCIIKIKNF-FDAEDYYIVLELMEGGELFDKVVGNKRLKEATCKLYFY
1zrzA           --------------------------------------FFVIEYVNGGDLMFHMQRQRKLPEEHARFYSA
3h4jB           LKKSDMHMRVEREISYLKLLRHPHIIKLYDVITTPTDIVMVIEYAGGELFDYIVEKKRMTEDEG-RRFFQ
3dajA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSRFDEQRTAT
2w4oA           ---------------------------------------LVLELVTGGELFDRIVEKGYYSERDAADAVK
2oicA           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
2jfmA           --------------------------------------WILIEFCAGGAVDAVMLEERPLTESQIQVVCK
2h6dA           LDVVGKIKREIQNLKLFRHPHIIKLYQVISTPTDF---FMVMEYVSGGELFDYICKHGRVEEMEARRLFQ
3f6xA           F---------LQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3d5wA           --LPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMR
2qnjB           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFR
1o6lA           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
1o6kA           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
2jdoA           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
3g6hA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVIEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3e8dB           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
3e8dA           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
3e88A           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
3e87A           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
3d0eA           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
2cl1A           -----------------------------------DTLYIVMEYCEGGDLASVIKERQYLDEEFVLRVMT
2weiA           ---------ILREVELLKKLDHPNIMKLFEILEDSSSFYIVGELYTGGELFDEIIKRKRFSEHDAARIIK
2w5aA           --------------------------------------YIVMEYCEGGDLASVIKERQYLDEEFVLRVMT
2vrxB           LEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFRSATMEELA-
2vgpB           LEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFRSATMEELA-
2vgpA           LEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFRSATMEELA-
2vgoA           LEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFRSATMEELA-
2oidB           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
2oicB           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
3f6xC           -------EAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
2dylA           ------------------------------------------------------RMQGPIPERILGKMTV
2bfyB           LEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFRSATMEELA-
2bfyA           LEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFRSATMEELA-
2bfxB           LEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFRSATMEELA-
2bfxA           LEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFRSATMEELA-
1yrpA           ---------------------------------------LILELVSGGELFDFLAEKESLTEDEATQFLK
2oiqB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3fe3A           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVAHGRMKEKEARSKFR
2oidD           -------KKLDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
2j90A           ------REEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKESLTEDEATQFLK
2bdfB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMAA
1yi6A           MS----PEAFLQEAQVMKKLRHEKLVQLYA--VVSEEPIIVTEYMKGSLLDFLKGETGKLRLPQLVDMAA
2pziA           -------------------------------DRHGDPVYIVMEYVGGQSL----KQKLPVAEAIAYLLEI
2j7tA           --------------------------------------WIMIEFCPGGAVDAIMLERG-LTEPQIQVVCR
3h4jA           LKKSDMHMRVEREISYLKLLRHPHIIKLYDVITTPTDIVMVIEYAGGELFDYIVEKKRMTEDEG-RRFFQ
2pziB           -------------------------------DRHGDPVYIVMEYVGGQSL----KQKLPVAEAIAYLLEI
2hakE           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
2wqeA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3hztA           VTTTSNSGALLDEVAVLKQLDHPNIMKLYEFFEDKRNYYLVMEVYRGGELFDEIILRQKFSEVDAAVIMK
3hkoA           ----------------------------------------------------------------------
3f6xB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3dxnA           VTTTSNSGALLDEVAVLKQLDHPNIMKLYEFFEDKRNYYLVMEVYRGGELFDEIILRQKFSEVDAAVIMK
3d7tB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
2bdjA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMAA
2bdfA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMAA
1a06A           --------------------------------------YLIMQLVSGGELFDRIVEKGFYTERDASRLIF
2ozaA           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2j90B           ------REEIEREVNILREIRHPNIITLHDIFENKTDVVLILELVSGGELFDFLAEKSLTEDEATQFLKQ
3en4B           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
2bdwB           --------------------------------------YLVFDLVTGGELFEDIVAREFYSEADASHCIQ
2bdwA           --------------------------------------YLVFDLVTGGELFEDIVAREFYSEADASHCIQ
2v5qA           LLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVXXXXXXXXXXXXHKRRKALTEPEARYYLR
2hakA           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
1zmuB           LNSSSL-QKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
1zmuA           LNSSSL-QKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
2qr8A           ----------------------------------------------------------------------
1p4fA           ----------------------------------------------------------------------
2oidA           ------------------------------------------------------------------KIAQ
3ehaA           ------REDIEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKSLTEEEATEFLKQ
3eh9A           ------REDIEREVSILKEIQHPNVITLHEVYENKTDVILILELVAGGELFDFLAEKSLTEEEATEFLKQ
2w5hA           --------------------------------------YIVMEYCEGGDLASVIKERQYLDEEFVLRVMT
2rkuA           LLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVXXXXXXXXXXXXHKRRKALTEPEARYYLR
2ou7A           LLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVXXXXXXXXXXXXHKRRKALTEPEARYYLR
3fc2A           LLKPHQREKMSMEISIHRSLAHQHVVGFHGFFEDNDFVFVVXXXXXXXXXXXXHKRRKALTEPEARYYLR
3el8A           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3efwB           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
3efwA           LEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
1wvyA           ----------------------------------------------------------------------
1wvwA           ----------------------------------------------------------------------
2oidC           -----------KEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
1jktA           ----------------------------------------------------------------------
1jkkA           ----------------------------------------------------------------------
1ig1A           ----------------------------------------------------------------------
3geqB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3dgkA           ----------------------------------------------------------------------
3dfcB           ----------------------------------------------------------------------
1zmvB           LNSSSL-QKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
1zmvA           LNSSSL-QKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
2vd5A           --------------------------------------YLVMEYYVGGDLLTLLSKFGERIPAEMARFYL
1k9aE           T-----AQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGYIVTEYMAKGSLVDYLRSRGRLGGDCLLKFSL
1k9aD           T-----AQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGYIVTEYMAKGSLVDYLRSRGRLGGDCLLKFSL
2javA           ------KQMLVSEVNLLRELKH--PNIVRYYDRIIDTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVL
1zmwB           LNSSSL-QKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
1zmwA           LNSSSL-QKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
2jbpC           ---------------------------------------IVMECLDGGELFSRIQDRGAFTEREASEIMK
3hmiA           MEV----EEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLREREEVTAVVLLYMAT
2h9vA           --------------------------QLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDPEKWAKFYTAEV
3fpmA           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2f2uB           --------------------------QLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDPEKWAKFYTAEV
2f2uA           --------------------------QLFCAFQDDKYLYMVMEYMPGGDLVNLMSNYDPEKWAKFYTAEV
3dbeA           LLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMR
2oicC           -----LKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLSCLDGTPPLSWHMRCKIAQ
1mryA           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
2jc6C           --------------------------------------YLVMQLVSGGELFDRIVEKGFYTEKDASTLIR
2jc6A           --------------------------------------YLVMQLVSGGELFDRIVEKGFYTEKDASTLIR
3geqA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3g5dB           -------EAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
3g5dA           F---------LQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
3f3uB           ---PGSPEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
3el8B           -------EAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3f3tB           -------EAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
1k9aC           T-----AQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGYIVTEYMAKGSLVDYLRSRGRLGGDCLLKFSL
1k9aA           T-----AQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGYIVTEYMAKGSLVDYLRSRGRLGGDCLLKFSL
1fmkA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMAA
3d7uA           T-----AQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGYIVTEYMAKGSLVDYLRSRGRLGGDCLLKFSL
2v55C           --------------------------------------YMVMEYMPGGDLVNLMSNYDPEKWARFYTAEV
2v55A           --------------------------------------YMVMEYMPGGDLVNLMSNYDPEKWARFYTAEV
2r0iA           LNSSSL-QKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
1k9aB           T-----AQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGYIVTEYMAKGSLVDYLRSRGRLGGDCLLKFSL
2jbpF           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2jbpE           ---------------------------------------IVMECLDGGELFSRIQDRGAFTEREASEIMK
2jbpD           ---------------------------------------IVMECLDGGELFSRIQDRGAFTEREASEIMK
2etkB           --------------------------------------YMVMEYMPGGDLVNLMSNYDPEKWARFYTAEV
2etkA           --------------------------------------YMVMEYMPGGDLVNLMSNYDPEKWARFYTAEV
2qlqB           ----------------------------LYAVVSEEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
2o8yB           -----LKQQFDQEIKVAK-CQHENLVELLGFSSDGDDLCLVYVYPNGSLLDRLSCLDGPPLSWHRCKIAQ
3igoA           ---------ILREVELLKKLDHPNIMKLFEILEDSSSFYIVGELYTGGELFDEIIKRKRFSEHDAARIIK
2hakD           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
2hakC           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
3g6gB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
2vgoB           LEK--VEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFRSATMEELA-
2pzyB           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2onlD           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2onlC           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2h96A           --------------------------------------YIVMELMDANLCQVIQME---LDHERMSYLLY
2gmxB           --------------------------------------YIVMELMDANLCQVIQME---LDHERMSYLLY
2gmxA           --------------------------------------YIVMELMDANLCQVIQME---LDHERMSYLLY
2g01B           --------------------------------------YIVMELMDANLCQVIQME---LDHERMSYLLY
2g01A           --------------------------------------YIVMELMDANLCQVIQME---LDHERMSYLLY
3dfaA           ---------ILREVELLKKLDHPNIMKLFEILEDSSSFYIVGELYTGELFDEIIK-RKRFSEHDAARIIK
1tkiA           ----------------------------------------------------------------------
2qi8A           -------EAFLQEAQVMKKLRHEKLVQLYA--VVSEPIYIVMEYMKGCLLDFLKGEMGKLRLPQLVDMAA
2pzyD           ---------------------------------------IVMECLDGGELFSRIQDRFTEREASEIMKSI
1ol6A           LEKA--EHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAP---LGTVYRELQKLSKFDEQRTAT
2oiqA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
1k9aF           T-----AQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGYIVTEYMAKGSLVDYLRSRGRLGGDCLLKFSL
3cqwA           ----------------------------------------------------------------------
3cquA           ----------------------------------------------------------------------
2zv9A           MSV----QAFLEEANLMKTLQHDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKEGGKVLLPKLIDFSA
2o8yA           -----LKQQFDQEIKVAK-CQHENLVELLGFSSDGDDLCLVYVYPNGSLLDRLSCLDGPPLSWHRCKIAQ
3g6gA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
1bygA           -------QAFLAEASVMTQLRHSNLVQLLGVIVE-EGLYIVTEYMAKGSLVDYLRSRGRLGGDCLLKFSL
2pl0A           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
2of2A           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
1koaA           ----------------------------------------------------------------------
2jbpB           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2hw6A           --------------------------------------YLVFEKLQGGSILAHIQKQKHFNEREASRVVR
3en5B           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
1gzkA           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
3en4A           ---PMSPEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3d7uD           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3d7uB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3d7tA           T-----AQAFLAEASVMTQLRHSNLVQLLGVIVEEKGGYIVTEYMAKGSLVDYLRSRGRLGGDCLLKFSL
1qpjA           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
1qpdA           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
1qpcA           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
2ofuA           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
2jbpI           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
3gvuA           MEV----EEFLKEAAVMKEIKHPNLVQLLGVCTLEPPFYIVTEYMPYGNLLDYLREREEVTAVVLLYMAT
3f3vB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
3f3tA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
3e7oA           --------------------------------------YLVMELMDANLCQVIHME---LDHERMSYLLY
3bymA           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
1ym7D           ----------------------------------------ILDLMNGGDLHYHLSQHGVFSEADMRFYAA
1ym7C           ----------------------------------------ILDLMNGGDLHYHLSQHGVFSEADMRFYAA
1ym7A           ----------------------------------------ILDLMNGGDLHYHLSQHGVFSEADMRFYAA
2wntA           ---------------------------------DGKHVYLVTELMRGGELDKILRQKFSEREASFVLHTI
2qq7A           -----------QEAQVMKKLRHEKLVQLYAV-VSEEPIYIVMEYMKGCLLDFLKGEMGKLRLPQLVDMAA
1omwA           ----------------------------------------ILDLMNGGDLHYHLSQHGVFSEADMRFYAA
2jboA           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
3g6hB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVIEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3cikA           ----------------------------------------ILDLMNGGDLHYHLSQHGVFSEADMRFYAA
2bcjA           ----------------------------------------ILDLMNGGDLHYHLSQHGVFSEADMRFYAA
2pzyC           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2ptkA           -------EAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
1pmqA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
2hakG           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
3fmeA           ----------------------------------------------------------------LGKIAV
3f3wB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVMEYMKGCLLDFLKGEMGKLRLPQLVDMAA
3f3wA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVMEYMKGCLLDFLKGEMGKLRLPQLVDMAA
1yolB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMSA
1yolA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMSA
2wajA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
3fi2A           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
2fh9A           ---------------------------------------MVIEYA-GNELFDYIVQRDKMSEQEARRFFQ
2wntB           ---------------------------------DGKHVYLVTELMRGGELDKILRQKFSEREASFVLHTI
2qkwB           -------SQGIEEFETEIETLSFCRHPHLVSLIERNEMILIYKYMENGNLKRHLYGSDPTMSMSWEQICI
2i6lA           --------------------------------------YIVQEYMETDL--ANVLEQGPLLEEHARLFMY
3hgkC           -------SQGIEEFETEIETLSFCRHPHLVSLIERNEMILIYKYMENGNLKRHLYGSDPTMSMSWEQICI
3hgkB           -------SQGIEEFETEIETLSFCRHPHLVSLIERNEMILIYKYMENGNLKRHLYGSDPTMSMSWEQICI
3hgkA           -------SQGIEEFETEIETLSFCRHPHLVSLIERNEMILIYKYMENGNLKRHLYGSDPTMSMSWEQICI
3b2wA           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
2qi8B           --------AFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVMEYMKGCLLDFLKGEMGKLRLPQLVDMAA
2jbpH           ---------------------------------------IVMECLDGGELFSRIQDRGAFTEREASEIMK
3fv8A           --------------------------------------YLVMELMDA-NLQVIQME---LDHERMSYLLY
1zycD           --------------------------------------FIQMEYCENRTLYDLIHENLNQQRDEYWRLFR
1zycC           --------------------------------------FIQMEYCENRTLYDLIHENLNQQRDEYWRLFR
2zvaA           MSV----QAFLEEANLMKTLQHDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKEGGKVLLPKLIDFSA
2zv7A           MSV----QAFLEEANLMKTLQHDKLVRLYAVVTKEEPIYIITEFMAKGSLLDFLKEGGKVLLPKLIDFSA
1yomA           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMSA
2pzyA           ---------------------------------------IVMECLDGGELFSRIQDRATEREASEIMKSI
2hw7A           ---PGIRSRVFREVEMLYQCQGHRNVELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQ
3en7A           -------KPFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3bgzA           ISDWG--ERVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
1ua2A           L----------REIKLLQELSHPNIIGLLDAFGHKSNISLVFDFME-TDLEVIIKDNSVLTPSHIKAYML
2ofvB           LAEANLMKQLQHQ-----RLVR------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
3dlsF           ----------------------------------------------------------------------
3dlsE           ----------------------------------------------------------------------
3dlsD           ----------------------------------------------------------------------
3dlsC           ----------------------------------------------------------------------
3dlsB           ----------------------------------------------------------------------
3dlsA           ----------------------------------------------------------------------
3cy3A           IDWGELPTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2c3iB           ISDWGEGTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
1ny3A           ---------------------------------------IVMECLDGGELFSRIQDTE--REASEIMKSI
1kobA           ----------------------------------------------------------------------
3k2lA           ----------------------------------------------------------------VRKFAH
2jbpG           ---------------------------------------IVMECLDGGELFSRIQDRATEREASEIMKSI
2o0uA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
3hyhA           -----MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ
3famB           -----MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ
2eueB           -----MQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ
3daeB           L----AQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ
3daeA           L----AQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ
3d5xA           LLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMR
1cm8A           ---PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPYLVMPFM-GTDLGKLMKHE-KLGEDRIQFLVY
1zycA           --------------------------------------FIQMEYCENRTLYDLIHENLNQQRDEYWRLFR
1y8gB           LNSSSL-QKLFREVRI--KVLNHPNIVKLFEVIETEKTLYLVEYASGGEVFDYLVAHGRKEKEARAKFRQ
1y8gA           LNSSSL-QKLFREVRI--KVLNHPNIVKLFEVIETEKTLYLVEYASGGEVFDYLVAHGRKEKEARAKFRQ
2j0jA           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2g9xC           ----------------------------------------------------------------------
3fi3A           --------------------------------------YLVMELMDA-NLQVIQMELDHERMSYLLYQML
3d83A           --------------------------------------YLVT-HLMGADLNNIVKQK--LTDDHVQFLIY
3cy2A           IDWGELPTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
3cxwA           IDWGELPTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
3blrA           --------------------------------------------------------------SEIKRVMQ
1zycB           --------------------------------------FIQMEYCENRTLYDLIHENLNQQRDEYWRLFR
1qcfA           MSVEAF---LAEANVM--KTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSKQPL--PKLIDFSA
1pmeA           ----------------------------------------------------------------------
2jedB           ----------------------FCTFQT------KENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAA
2jedA           ----------------------FCTFQT------KENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAA
3hyhB           M-----QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ
2hwoA           -------KPFLQEAQVMKKLRHEKLVQLYAV---VSPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
2hk5A           MSVEAF---LAEANVM--KTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSKQPL--PKLIDFSA
3gc8B           ---------------------------------DFSEVYLVTTLM-GADLNNIVKCQA-LSDEHVQFLVY
3gc8A           ---------------------------------DFSEVYLVTTLM-GADLNNIVKCQA-LSDEHVQFLVY
3g33A           ----------------------------------------------------------------------
3famA           M-----QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEARRFFQ
2etmA           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
3blhA           FPITALREQLLKHENVVNLI-EICRTSI----------YLVFDFCEHDLAGLLSNVLVKFTLSEIKRVMQ
1zydA           --------------------------------------FIQMEYCENRTLYDLIHENLNQQRDEYWRLFR
2rioB           CDIALMEIKLLTESDDHPNVIRYYCSETTDRFL-----YIALELCN-LNLQDLVESYNPI--SLLRQIAS
2jbpA           ---------------------------------------IVMECLDGGELFSRIQDRGAFTEREASEIMK
2j0lA           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2ac5A           ---PGIRSRVFREVEMLYQCQGHRNVELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQ
1ukiA           --------------------------------------YIVMELMDANLCQVIQME---LDHERMSYLLY
1pmuA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
2objA           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2fysA           ----------------------------------------------------------------------
3fxxA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
3f2aA           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
3en7B           ----------------------------LYAVVSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3dcvA           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
3da6A           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
2bujA           -------------------------------------------------------------------LLL
2bikB           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2b9iA           ----------------------------------------------------------------------
2b9fA           ----------------------------------------------------------------------
2acxB           ----------------------------------------------------------------------
2acxA           ----------------------------------------------------------------------
2ac3A           ---PGIRSRVFREVEMLYQCQGHRNVELIEFFEEEDRFYLVFEKMRGGSILSHIHKRRHFNELEASVVVQ
1yomB           MS----PEAFLQEAQVMKKLRHEKLVQLYAV-VSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMSA
1xo2B           ----------------------------------------------------------------------
2r3qA           ----------------------------------------------------------------------
2r3iA           ----------------------------------------------------------------------
1jowB           ----------------------------------------------------------------------
2hwpB           ----------------------------LYAVVSEEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
1gz8A           ----------------------------------------------------------------------
3gc9B           ---------------------------------DFSEVYLVTTLM-GADLNNIVKSQA-LSDEHVQFLVY
1g3nA           ----------------------------------------------------------------------
2f2cB           ----------------------------------------------------------------------
2eufB           ----------------------------------------------------------------------
3dogC           ----------------------------------------------------------------------
1blxA           ----------------------------------------------------------------------
1bi8A           ----------------------------------------------------------------------
1bi7A           ----------------------------------------------------------------------
1zydB           --------------------------------------FIQMEYCENRTLYDLIHENLNQQRDEYWRLFR
2zdtA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
2z7sA           ----------------------------------------------------------------LAELAL
2z7rA           ----------------------------------------------------------------LAELAL
2z7qA           ----------------------------------------------------------------LAELAL
1pmvA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
1pmnA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
2p33A           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
1oguC           ----------------------------------------------------------------------
1mrvA           ----------------------------------------VMEYANGGELRVFTEERARFYGAEI-----
1jnkA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
2hwoB           ----------------------------LYAVVSEEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
3g9nA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
3g90X           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
3fbvI           CDIALMEIKLLTESDDHPNVIRYTTDRFLYIALELCQDLVESKNVSDENLK-LQKEYNPI--SLLRQIAS
3fbvD           CDIALMEIKLLTESDDHPNVIRYTTDRFLYIALELCQDLVESKNVSDENLK-LQKEYNPI--SLLRQIAS
3fbvA           CDIALMEIKLLTESDDHPNVIRYTTDRFLYIALELCQDLVESKNVSDENLK-LQKEYNPI--SLLRQIAS
2fa2B           ----------------------------------------------------------------------
2fa2A           ----------------------------------------------------------------------
2f49A           ----------------------------------------------------------------------
3el7A           SP-----EAFLQEAQVMKKLRHEKLVQLYAVVSEI---YIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3blqA           --------------------------------------------------------------SEIKRVMQ
3bhuC           ----------------------------------------------------------------------
3bhtC           ----------------------------------------------------------------------
2b9hA           ----------------------------------------------------------------------
1yxsA           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDVLILERMEPQDLFDFITERGALQEELARSFFW
1ywvA           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
1xwsA           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
1xqzA           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2w9zB           ----------------------------------------------------------------------
2w99B           ----------------------------------------------------------------------
2r9sA           --------------------------------------YLVMELMDA-NLQVIQMELDHERMSYLLYQML
2qq7B           ----------------------------LYAVVSEEPIYIVMEYMKGCLLDFLKGEMGKLRLPQLVDMAA
2j2iB           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2i6lB           LTDPQSVKHALREIKIIRRLDHDNIVKVFSGSQLTDSVYIVQEYMETDL--ANVLEQGPLLEEHARLFMY
3c4eC           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2bzkB           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2bzhB           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2bilB           IELPN-GTRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2w96B           ----------------------------------------------------------------------
1w98A           ----------------------------------------------------------------------
2qlqA           ----------------------------------SEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
1oiyA           ----------------------------------------------------------------------
1oiuC           ----------------------------------------------------------------------
1oi9A           ----------------------------------------------------------------------
1oguA           ----------------------------------------------------------------------
1jsuA           ----------------------------------------------------------------------
1jstA           ----------------------------------------------------------------------
2jgzA           ----------------------------------------------------------------------
2iw9C           ----------------------------------------------------------------------
2iw9A           ----------------------------------------------------------------------
2iw8C           ----------------------------------------------------------------------
2iw8A           ----------------------------------------------------------------------
2iw6C           ----------------------------------------------------------------------
2iw6A           ----------------------------------------------------------------------
2hw6B           --------------------------------------YLVFEKLQGGSILAHIQKQKHFNEREASRVVR
1h4lA           ----------------------------------------------------------------------
1h27C           ----------------------------------------------------------------------
1h26C           ----------------------------------------------------------------------
1h25C           ----------------------------------------------------------------------
1h24A           ----------------------------------------------------------------------
2g9xA           ----------------------------------------------------------------------
3eljA           --------------------------------------YIVMELMDANLCQVIQME---LDHERMSYLLY
1e9hA           ----------------------------------------------------------------------
3dogA           ----------------------------------------------------------------------
3ddqC           ----------------------------------------------------------------------
3ddqA           ----------------------------------------------------------------------
2cjmC           ----------------------------------------------------------------------
2cjmA           ----------------------------------------------------------------------
2cchA           ----------------------------------------------------------------------
3bhtA           ----------------------------------------------------------------------
2z8cA           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
1xjdA           ----------------------FCTFQT------KENLFFVMEYLNGGDLMYHIQSCHKFDLSRATFYAA
1ir3A           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
3fy2A           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
3etaB           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
1zxeD           ----------------------------------------IQEYCENRTLYDLIHENLNQQRDEYWRLFR
2w9fB           ----------------------------------------------------------------------
2rioA           CDIALMEIKLLTESDDHPNVIRYYCSETTDRFL-----YIALELCNLNLQDLVESKYNPI--SLLRQIAS
2qocA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
2qkrA           ---------------------------------------LVFEFMEKDLKKVLDENKTGLQDSQIKIYLY
3bu5A           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
3bu3A           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
2auhA           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
1yojB           ----------------------------LYAVVSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMSA
1kwpA           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2f9gA           ----------------------------------------------------------------------
3en6B           --------------------------------------YIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3en6A           ----------------------------LYAVVSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
3en5A           ----------------------------LYAVVSEEPIYIVTEYMKGSLLDFLKGEMGKLRLPQLVDMAA
2e9nA           VDCP---ENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
3cblA           LP-PDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGALRVKTLLQMVG
3bkbA           LP-PDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGALRVKTLLQMVG
2aypA           VDCP---ENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
3gc9A           ---------------------------------DFSEVYLVTTLM-GADLNNIVKSQA-LSDEHVQFLVY
3eidA           ----------------------------------------------------------------------
3d7zA           --------------------------------------YLVT-HLMGADLNNIVKQK--LTDDHVQFLIY
3bz3A           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2z7lA           ----------------------------------------------------------------------
1v0oB           ---------------------------------------------------------GGLESVTAKSFLL
1v0oA           ---------------------------------------------------------GGLESVTAKSFLL
1v0bA           ---------------------------------------------------------GGLESVTAKSFLL
1tvoA           ----------------------------------------------------------------------
2ojiA           ----------------------------------------------------------------------
2ojgA           ----------------------------------------------------------------------
2iwiB           -----------------------------------------------------ITEKGPL-GEGPSRCFF
2iwiA           -----------------------------------------------------ITEKGPL-GEGPSRCFF
1ia8A           VDMKRCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
1h0vA           ----------------------------------------------------------------------
2gphA           ----------------------------------------------------------------------
1golA           ----------------------------------------------------------------------
3g9lX           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
3etaA           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
3erkA           ----------------------------------------------------------------------
1erkA           ----------------------------------------------------------------------
3enmC           ----------------------------------------------------------------LGKIAV
2cgxA           VDMKRCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2cgvA           VDMKRCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2cguA           VDMKRCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2c3kA           VDMKRCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2c3jA           ------RENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2brnA           VDMKRCPENIKKEICINKMLNHENVVKFYGHRREGNIQYLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2a1aB           --------------------------------------FIQMEFCDKGTLEQWIEKR---RGEKLDKVLA
2a19B           --------------------------------------FIQMEFCDKGTLEQWIEKR---RGEKLDKVLA
1zysA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
1zy4A           --------------------------------------FIQMEYCENGTLYDLIHENLNQQRDEYWRLFR
2zduA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
1yhsA           ISDWG-ETRVPMEVVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLITERGALQEELARSFFW
2wmxA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2wmwA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2wmvA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2wmuA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2wmtA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2wmsA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2wmrA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
1unlA           ----------------------------------------------------------------------
1unhA           ----------------------------------------------------------------------
1ungB           ----------------------------------------------------------------------
1ungA           ----------------------------------------------------------------------
2r3kA           ----------------------------------------------------------------------
2r0uA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2qhnA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2pz5B           TEKD--LSDLVSEMEMMKMIGKHKNIITLLGACTQDGPYVIVEYASKGNLREYLRARRPPEQMTFKDLVS
2pz5A           TEKD--LSDLVSEMEMMKMIGKHKNIITLLGACTQDGPYVIVEYASKGNLREYLRARRPEEQMTFKDLVS
2pmiC           ----------------------------------------------------------------------
2pmiA           ----------------------------------------------------------------------
2pk9C           ----------------------------------------------------------------------
2pk9A           ----------------------------------------------------------------------
2ok1A           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
2ofvA           LAEANLMKQLQHQ-----RLVR------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
2o2uA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
1nvrA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
3jvsA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
3jvrA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2hogA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
3hmmA           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
2gdoA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
3g2fA           ------------------------------------------------------------------RLAH
3f9nA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2excX           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
3enmB           ----------------------------------------------------------------LGKIAV
2cgwA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
3cd3A           ---PDLKAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGALRVKTLLQMVG
2c3lA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
3byuA           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
2brmA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2brhA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
2brgA           --------------------------------------YLFLEYCSGGELFDRIEPDIGMPEPDAQRFFH
1sm2A           MS----EEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRQRGLFAAETLLGMCL
2r7iD           ---------------------------ITLADIVKDTPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
2qo9A           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
2pzrB           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPEEQMTFKDLV
2pzrA           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPEEQMTFKDLV
2pzpA           TEED--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPEEQMTFKDLVS
2og8B           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
1mqbB           ------------------------------------PMMIITEYMENGALDKFLREKGEFSVLQLVGMLR
2i40A           ----------------------------------------------------------------------
3enmD           ----------------------------------------------------------------LGKIAV
3enmA           ----------------------------------------------------------------LGKIAV
3e92A           ----------------------------------------------------------------------
2b1pA           --------------------------------------YLVMELMDANLCQVIQME---LDHERMSYLLY
1ykrA           ----------------------------------------------------------------------
2wipC           ----------------------------------------------------------------------
2wipA           ----------------------------------------------------------------------
2w06A           ----------------------------------------------------------------------
1vywC           ----------------------------------------------------------------------
1vywA           ----------------------------------------------------------------------
2vtrA           ----------------------------------------------------------------------
2vtpA           ----------------------------------------------------------------------
1uwhA           -PTPQQLQAFKNEVGVLRKT-RHVNILLFMGYSTAPQLAIVTQWCEGSSLYHIIETKFEM--IKLIDIAR
2r3jA           ----------------------------------------------------------------------
2r3hA           ----------------------------------------------------------------------
2pvyD           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRP-PGVPEEQMTF
2ow3B           ----------------------------------------------------------------------
2ow3A           ----------------------------------------------------------------------
1okvC           ----------------------------------------------------------------------
1okvA           ----------------------------------------------------------------------
1oirA           ----------------------------------------------------------------------
1o9uA           ----------------------------------------------------------------------
1kwpB           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
1jsvA           ----------------------------------------------------------------------
2jkqA           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2jkmA           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2jkkA           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2j0kB           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
1irkA           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
2ijmB           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2ijmA           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2hwpA           ----------------------------------SEPIYIVTEYMKGCLLDFLKGEMGKLRLPQLVDMAA
1hckA           ----------------------------------------------------------------------
1h0uA           ----------------------------------------------------------------------
1h01A           ----------------------------------------------------------------------
1gngB           ----------------------------------------------------------------------
1gngA           ----------------------------------------------------------------------
3gc7A           ----------------------------------------------------------------------
3f88A           ----------------------------------------------------------------------
3f7zB           ----------------------------------------------------------------------
3f7zA           ----------------------------------------------------------------------
3f5xA           ----------------------------------------------------------------------
1f5qC           ----------------------------------------------------------------------
1f5qA           ----------------------------------------------------------------------
2etmB           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
3eqrB           LSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAV
3eocC           ----------------------------------------------------------------------
3ej1C           ----------------------------------------------------------------------
3ej1A           ----------------------------------------------------------------------
1e1vA           ----------------------------------------------------------------------
2ds1A           ----------------------------------------------------------------------
1di8A           ----------------------------------------------------------------------
2clxA           ----------------------------------------------------------------------
2c6iA           ----------------------------------------------------------------------
2c68A           ----------------------------------------------------------------------
2c5yA           ----------------------------------------------------------------------
2c4gC           ----------------------------------------------------------------------
2c4gA           ----------------------------------------------------------------------
1buhA           ----------------------------------------------------------------------
2bkzC           ----------------------------------------------------------------------
2a4lA           ----------------------------------------------------------------------
1nxkB           ---------------------------------------LIVECLDGGELFSRIQDRGDQAFTEREASEI
3d4qA           ---------------------------------------IVTQWCEGSSLYHIIETKFEM--IKLIDIAR
1agwB           TEKD--LSDLISEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLQARRQLSSKDLVSCAY
1zxeC           ----------------------------------------IQEYCENRTLYDLIHENLNQQRDEYWRLFR
1yojA           ----------------------------LYAVVSEEPIYIVTEYMKGSLLDFLKGETGKLRLPQLVDMSA
2vtsA           ----------------------------------------------------------------------
2vtoA           ----------------------------------------------------------------------
1v0bB           ---------------------------------------------------------GGLESVTAKSFLL
1uv5A           ----------------------------------------------------------------------
1r0eA           ----------------------------------------------------------------------
2qokA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
1q5kB           ----------------------------------------------------------------------
1q5kA           ----------------------------------------------------------------------
1q4lB           ----------------------------------------------------------------------
1q4lA           ----------------------------------------------------------------------
1q41B           ----------------------------------------------------------------------
1q41A           ----------------------------------------------------------------------
1q3wB           ----------------------------------------------------------------------
1q3wA           ----------------------------------------------------------------------
1q3dB           ----------------------------------------------------------------------
1q3dA           ----------------------------------------------------------------------
1pyxB           ----------------------------------------------------------------------
1pyxA           ----------------------------------------------------------------------
2pwlA           TEKD--LSDLVSEMEMMKMIGKHKNIHLLGACTQDGPLYVIVEYASKGNLREYLRARRPMTFKDLVSCTY
2pvfA           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPMTFKDLVSCTY
1ob3A           ---------------------------------------------------------GGLESVTAKSFLL
2o5kA           ----------------------------------------------------------------------
2jldB           ----------------------------------------------------------------------
2jldA           ----------------------------------------------------------------------
1j1bB           ----------------------------------------------------------------------
1j1bA           ----------------------------------------------------------------------
2j0kA           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2i0yA           ------KEALMSELKIMSHLGQHENVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKRQLSSRDLLHFSS
2i0vA           ------KEALMSELKIMSHLGQHENVNLLGACTHGGPVLVITEYCCYGDLLNFLRRKRQLSSRDLLHFSS
1i09B           ----------------------------------------------------------------------
1i09A           ----------------------------------------------------------------------
1h8fB           ----------------------------------------------------------------------
1h8fA           ----------------------------------------------------------------------
3eidC           ----------------------------------------------------------------------
3du8A           ----------------------------------------------------------------------
2bajA           ----------------------------------------------------------------------
3b2tB           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPMTFKDLVSCTY
3b2tA           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPMTFKDLVSCTY
2zb0A           ----------------------------------------------------------------------
2zazA           ----------------------------------------------------------------------
1yqjA           ----------------------------------------------------------------------
1y91A           ----------------------------------------------------------------------
2wmqA           ----------------------------------------------------------------------
1wbsA           ----------------------------------------------------------------------
2pvyA           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRP-PGMDINRVPE
1oz1A           ----------------------------------------------------------------------
1ouyA           ----------------------------------------------------------------------
2ivsA           S--PSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLRALTM
1iasB           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
3hrbA           ----------------------------------------------------------------------
1h08A           ----------------------------------------------------------------------
3gfeA           ----------------------------------------------------------------------
3fz1A           ----------------------------------------------------------------------
1di9A           ----------------------------------------------------------------------
3d94A           ----SMRERIENEASVMKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPSLSKMIQ-MAG
3cokA           MYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRKPFSENEARHFMH
1bmkA           ----------------------------------------------------------------------
1zxeA           ----------------------------------------IQEYCENRTLYDLIHENLNQQRDEYWRLFR
1vyzA           ----------------------------------------------------------------------
1ukhA           --------------------------------------YIVMELMDANLCQVIQME---LDHERMSYLLY
1sm2B           MS----EEDFIEEAEVMMKLSHPKLVQLYGVCLEQAPICLVFEFMEHGCLSDYLRQRGLFAAETLLGMCL
2r7iC           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
2r7iA           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
2pwlB           TEKD--LSDLVSEMEMMKMIGKHKNIHLLGACTQDGPLYVIVEYASKGNLREYLRARRPMTFKDLVSCTY
2p3gX           ---------------------------------------IVMECLDGGELFSRIQDRGDQREASEIMKSI
2gtmA           --------------------------------------YLVT-HLMGADLNNIVK----LTDDHVQFLIY
3fzoA           LDN---KEKFMSEAVIMKNLDHPHIVKLIGI-IEEEPTWIIMEYPYGELGHYLERNKNSLKVLTLVLYSL
2fysB           ----------------------------------------------------------------------
3eknA           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
3e3bX           ----------------------------------------------------------------------
3db8A           LLKPHQKEKMSTEIAIHKSLDNPHVVGFHGFFEDDDFVYVVLEICRRRSLLELHKRRKAVTEPEARYFMR
3cokB           MYKAGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLVLEMCHNGEMNRYLKNRKPFSENEARHFMH
3clyA           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARREEQMTFKDLVSC
2c0tB           MSVEAF---LAEANVM--KTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSKQPL--PKLIDFSA
2c0tA           MSVEAF---LAEANVM--KTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSKQPL--PKLIDFSA
2c0iA           MSVEAF---LAEANVM--KTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSKQPL--PKLIDFSA
3bw5A           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
2zoqA           ----------------------------------------------------------------------
2qr7A           ----------------------------------------------------------------------
2psqB           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPMTFKDLVSCTY
2psqA           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPMTFKDLVSCTY
2og8A           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
1nxkD           ---------------------------------------LIVECLDGGELFSRIQDRFTEREAS-EIKSI
1nxkC           ---------------------------------------LIVECLDGGELFSRIQDRGDQAFTEREASEI
2jbpL           ---------------------------------------IVMECLDGGELFSRIQDRGAFTEREASEIMK
2io6A           VDEQNLREVYAHAVGQHSHVVRYFSAWA-----EDDHMLIQNEYCNGGSLADAISENYRIKEAELKDLLL
2in6A           VDEQNLREVYAHAVGQHSHVVRYFSAWA-----EDDHMLIQNEYCNGGSLADAISENYRIKEAELKDLLL
1h0wA           ----------------------------------------------------------------------
3e7oB           --------------------------------------YLVMELMDANLCQVIHME---LDHERMSYLLY
3coiA           ----------------------------------------------------------------IQYLVY
3bysA           MSPDAFLAELMKQLQHQRLVR-------LYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTKLLDMAA
3bizA           VDEQNLREVYAHAVGQHSHVVRYFSAWA-----EDDHMLIQNEYCNGGSLADAISENYRIKEAELKDLLL
2baqA           ----------------------------------------------------------------------
1ad5A           MSVEAF---LAEANVM--KTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSKQPL--PKLIDFSA
2zjwA           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
1urwA           ----------------------------------------------------------------------
2rkpA           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
2pzpB           TEED--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPMTFKDLVSCTY
2pvrA           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
1pjkA           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
1ob3B           ---------------------------------------------------------GGLESVTAKSFLL
1na7A           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
1jwhB           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
1jwhA           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
3ig7A           ----------------------------------------------------------------------
3h30A           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
3gxlA           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
1fvtA           ----------------------------------------------------------------------
2erkA           ----------------------------------------------------------------------
3eb0C           ----------------------------------------------------------------------
3eb0A           ----------------------------------------------------------------------
3bqcA           ---------------------------ITLADIVKDPPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
2balA           ----------------------------------------------------------------------
1zy4B           --------------------------------------FIQMEYCENGTLYDLIHENLNQQRDEYWRLFR
2wo6B           ------------------------------------------------------------RGVSLNKFAQ
2wo6A           ------------------------------------------------------------RGVSLNKFAQ
1wccA           ----------------------------------------------------------------------
2vx3D           ------------------------------------------------------------RGVSLNKFAQ
2vx3C           ------------------------------------------------------------RGVSLNKFAQ
2vx3B           ------------------------------------------------------------RGVSLNKFAQ
2vx3A           ------------------------------------------------------------RGVSLNKFAQ
2vtiA           ----------------------------------------------------------------------
2vthA           ----------------------------------------------------------------------
2uznA           ----------------------------------------------------------------------
2rg6A           ----------------------------------------------------------------------
2r7iB           ---------------------------ITLADIVKRTPALVFEHVNNTDFKQLYQT---LTDYDIRFYMY
2r3lA           ----------------------------------------------------------------------
2okrA           ----------------------------------------------------------------------
1nxkA           ---------------------------------------LIVECLDGGELFSRIQDRAFTEREASEIKSI
1ke6A           ----------------------------------------------------------------------
1jvpP           ----------------------------------------------------------------------
2jkoA           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
2jbpK           ---------------------------------------IVMECLDGGELFSRIQDRGAFTEREASEIMK
2j0mB           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
1giiA           ----------------------------------------------------------------------
2ghlA           ----------------------------------------------------------------------
2fb8A           ---------------------------------------IVTQWCEGSSLYHIIETKFEM--IKLIDIAR
3e93A           ----------------------------------------------------------------------
2e14A           ----------------------------------------------------------------------
1ckpA           ----------------------------------------------------------------------
3cg2A           ----------------------------------------------------------------------
3c4cA           ---------------------------------------IVTQWCEGSSLYHHLHSETKFEMKKLIDIAR
3bv2A           ----------------------------------------------------------------------
1zy5B           --------------------------------------FIQMEYCENGTLYDLIHENLNQQRDEYWRLFR
2wouA           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
2wotA           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
1vjyA           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
1uwjA           ---------------------------------------IVTQWCEGSSLYHIIETKFEM--IKLIDIAR
1py5A           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
1mqbA           ------------------------------------PMMIITEYMENGALDKFLREKGEFSVLQLVGMLR
1iasA           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
1h07A           ----------------------------------------------------------------------
2gsfA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
3ds6A           ----------------------------------------------------------------------
3cr0A           ----------------------------------ADHMLIQNEYCNGGSLADAISENYRIKEAELKDLLL
2bujB           -------------------------------------------------------------------LLL
1b6cB           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
1zxeE           ----------------------------------------IQEYCENRTLYDLIHENLNQQRDEYWRLFR
1zxeB           ----------------------------------------IQEYCENRTLYDLIHENLNQQRDEYWRLFR
1v1kA           ----------------------------------------------------------------------
2pmlX           -----------------------------------DEVYIIYEYMENDSILKFVLDKNPIQ--VIKCIIK
1oitA           ----------------------------------------------------------------------
1lezA           ----------------------------------------------------------------------
2ivvA           S--PSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRE---------SRLTM
2ivuA           S--PSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRERRALTMGDLISFAW
2ivtA           S--PSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVRALTMGDLAW
3eqpA           MD-DFIREVNAMHSLDHRNLIR------LYGVVLTPPMKMVTELAPGSLLDRLRKHQGHFLLGTLSRYAV
3eqpB           MD-DFIREVNAMHSLDHRNLIR------LYGVVLTPPMKMVTELAPGSLLDRLRKHQGHFLLGTLSRYAV
3c9wA           ----------------------------------------------------------------------
3c4cB           ---------------------------------------IVTQWCEGSSLYHHLHSETKFEMKKLIDIAR
1ywrA           ----------------------------------------------------------------------
2qluA           ----------------------------------------------------------------------
2qd9A           --------------------------------------YLVT-HLMGADLNNIVK----LTDDHVQFLIY
1lewA           ----------------------------------------------------------------------
3idpA           ---------------------------------------IVTQWCEGSSLYHIIETKFEM--IKLIDIAR
1i44A           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
1h00A           ----------------------------------------------------------------------
3gxjA           --------------------------------------WLVSDYHEHGSLFDYLNRYTVTVG--MIKLAL
3gcqA           --------------------------------------YLVT-HLMGADLNNIVKSQ-KLTDDHVQFLIY
3eqrA           MD-DFIREVNAMHSLDHRNLIR------LYGVVLTPPMKMVTELAPGSLLDRLRKHQGHFLLGTLSRYAV
2zb1A           ----------------------------------------------------------------------
2vtjA           ----------------------------------------------------------------------
2r3nA           ----------------------------------------------------------------------
2hakH           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
3gp0A           ---------------------------------DFSEVYLVTTLM-GADLNNIVKCQA-LSDEHVQFLVY
3g2fB           ------------------------------------------------------------------RLAH
3fqeA           ---PALKDELLAEANVMQQLDNPYIVRMIGI-CEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVH
2duvA           ----------------------------------------------------------------------
2z2wA           -----------------------------------DHMLIQNEYCNGGSLADAISENYRIKEAELKDLLL
1x8bA           -----------------------------------DHMLIQNEYCNGGSLADAISENYRIKEAELKDLLL
2rg5A           ----------------------------------------------------------------------
2pvyB           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARGDINRVPEEQMTF
2onlA           ----------------------------------------------------------------------
1mp8A           SD--SVREKFLQEALTMRQFDHPHIVKLIGV-ITENPVWIIMELCTLGELRSFLQVRKSLDLASLILYAY
3gcvA           --------------------------------------YLVT-HLMGADLNNIVKSQ-KLTDDHVQFLIY
3faaA           --------------------------------------WLVSDYHEHGSLFDYLN-RYTVTVEGMIKLAL
2c47C           -------------------------------------------------------------------IAI
2c47B           -------------------------------------------------------------------IAI
2c47A           -------------------------------------------------------------------IAI
3bi6A           -----------------------------------DHMLIQNEYCNGGSLADAISENYRIKEAELKDLLL
1zxeF           ----------------------------------------IQEYCENRTLYDLIHENLNQQRDEYWRLFR
1uwjB           ---------------------------------------IVTQWCEGSSLYHIIETKFEM--IKLIDIAR
1u54A           ----------------------------------------------GSLLDRLRKHQGHFLLGTLSRYAV
2jbpJ           ---------------------------------------IVMECLDGGELFSRIQDRATEREASEIMKSI
3bx5A           ----------------------------------------------------------------------
1u54B           MD-DFIREVNAMHSLDHRNLIR------LYGVVLTPPMKMVTELAPGSLLDRLRKHQGHFLLGTLSRYAV
1u46B           ------------------------------------PMKMVTELAPLGSLLDRLRKHQGLLG-TLSRYAV
2qo2A           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
2pvyC           TEKD--LSDLVSEMEMMKMIGKHKNINLLGACTQDGPLYVIVEYASKGNLREYLRARRPMTFKDLVSCTY
2ivsB           S--PSELRDLLSEFNVLKQVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLREKRALTMGDLISFAW
2c47D           -------------------------------------------------------------------IAI
2btrA           ----------------------------------------------------------------------
1zyjA           ----------------------------------------------------------------------
1u4dA           MD-DFIREVNAMHSLDHRNLIR------LYGVVLTPPMKMVTELAPGSLLDRLRKHQGHFLLGTLSRYAV
2okrD           ----------------------------------------------------------------------
3gcuA           ----------------------------------------------------------------------
3gcpA           --------------------------------------YLVT-HLMGADLNNIVKSQ-KLTDDHVQFLIY
2fvdA           ----------------------------------------------------------------------
3e3pB           ----------------------------------------------------------------------
3e3pA           ----------------------------------------------------------------------
3cc6A           LDN---KEKFMSEAVIMKNLDHPHIVKLIGI-IEEEPTWIIMEYPYGELGHYLERNKNSLKVLTLVLYSL
1p14A           ----SLRERIENEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSYLRSRPPPTLQEMIQMAA
3idpB           ---------------------------------------IVTQWCEGSSLYHIIETKFEM--IKLIDIAR
2cmwA           -------------------------------------------------------------------IAI
3bceA           NETPKANVEFMDEALIMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCV
2bakA           --------------------------------------YLVT-HLMGADLNNIVK----LTDDHVQFLIY
2b52A           ----------------------------------------------------------------------
1zz2A           ----------------------------------------------------------------------
1u59A           ----------------------------------------------GPLHKFLVGKREEIPVSNVAELLH
1u46A           MD-DFIREVNAMHSLDHRNLIR------LYGVVLTPPMKMVTELAPGSLLDRLRKHQGHFLLGTLSRYAV
2qolA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
2puuA           ----------------------------------------------------------------------
2ozaB           ----------------------------------------------------------------------
3hp5A           ----------------------------------------------------------------------
3hl7A           ----------------------------------------------------------------------
2hakB           LN-PTSLQKLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFR
2gtnA           ----------------------------------------------------------------------
2ewaA           ----------------------------------------------------------------------
3dzqA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
3ctqA           ----------------------------------------------------------------------
1yw2A           ----------------------------------------------------------------------
1xbcA           --LPALKDELLAEANVMQQLDNPYIVRMIGI-CEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVH
1xbbA           ---PALKDELLAEANVMQQLDNPYIVRMIGI-CEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVH
1xbaA           --LPALKDELLAEANVMQQLDNPYIVRMIGI-CEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVH
1r39A           ----------------------------------------------------------------------
2qooA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
2qobA           -------------------------------------PVMIVTEMENGSLDSFLRKHAQFTVIQLVGMLR
1p2aA           ----------------------------------------------------------------------
1kv1A           ----------------------------------------------------------------------
1gijA           ----------------------------------------------------------------------
1gihA           ----------------------------------------------------------------------
3fqhB           ---PALKDELLAEANVMQQLDNPYIVRMIGI-CEAESWMLVMEMAELGPLNKYLQQNRHVKDKNIIELVH
3dtcA           ----------------------------------------------------------------------
1ckjB           -------------------------------------------------------------------LAD
1ckjA           -------------------------------------------------------------------LAD
2w17A           ----------------------------------------------------------------------
2vv9A           ----------------------------------------------------------------------
2v62B           ----------------------------------------------GIDLQKISGQNGTFKKSTVLQLGI
2v62A           ----------------------------------------------GIDLQKISGQNGTFKKSTVLQLGI
2r4bB           ----------------------------------------------------------------------
2r4bA           ----------------------------------------------------------------------
2qoiA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
2qofA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
2qodA           ------------------------------------PVMIVTEYMENGSLDSFLRKHAQFTVIQLVGMLR
3gcsA           --------------------------------------YLVT-HLMGADLNNIVKSQ-KLTDDHVQFLIY
3et7A           LDN---KEKFMSEAVIMKNLDHPHIVKLIGI-IEEEPTWIIMEYPYGELGHYLERNKNSLKVLTLVLYSL
3bceB           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GTLTALAAIHQAGIVHRDFKPANVLMAPGGPRVIDFGIARALEGTAILTSRIAGTPAYMAPEQITGGPLG
3f69B           DACQALNFSHQNGIIHRDVKPANILIATNAVKVVDFGIARAISGNSVQT---IGTAQYLSPEQARGDSVD
2q0nA           AVLQALSVLHAQGVIHRDIKSDSILLTHDGRKLSDFGFC-AQVSKEVPRRKLVGTPYWMAPELISRLPYG
2j0iA           AVLQALSVLHAQGVIHRDIKSDSILLTHDGRKLSDFGFC-AQVSKEVPRRKLVGTPYWMAPELISRLPYG
2fumB           DACQALNFSHQNGIIHRDVKPANIMIATNAVKVMDFGIARAI-----------GTAQYLSPEQARGDSVD
2fumA           DACQALNFSHQNGIIHRDVKPANIMIATNAVKVMDFGIARAIAD---------GTAQYLSPEQARGDSVD
2cdzA           AVLQALSVLHAQGVIHRDIKSDSILLTHDGRKLSDFGFC-AQVSKEVPRRKLVGTPYWMAPELISRLPYG
3f69A           DACQALNFSHQNGIIHRDVKPANILIATNAVKVVDFGIARAI------------TAQYLSPEQARGDSVD
2bvaB           AVLQALSVLHAQGVIHRDIKSDSILLTHDGRKLSDFGFCAQVE---VPRRKLVGTPYWMAPELISRLPYG
2bvaA           AVLQALSVLHAQGVIHRDIKSDSILLTHDGRKLSDFGFCAQVE---VPRRKLVGTPYWMAPELISRLPYG
1mruB           DACQALNFSHQNGIIHRDVKPANIMIATNAVKVMDFGIARAI------------TAQYLSPEQARGDSVD
1mruA           DACQALNFSHQNGIIHRDVKPANIMIATNAVKVMDFGIARAI------------TAQYLSPEQARGDSVD
1yhvA           ECLQALEFLHSNQVIHRDIKSDNILLGDGSVKLTDFGFCAQITPEQSKRSEMVGTPYWMAPEVVTRKAYG
1o6yA           DACQALNFSHQNGIIHRDVKPANIMIATNAVKVMDFGIARAI-------------AQYLSPEQARGDSVD
1yhwA           ECLQALEFLHSNQVIHRDIKSDNILLGDGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYG
2f57B           SVLRALSYLHNQGVIHRDIKSDSILLTSDGRKLSDFGFC-AQVSKEVPKRKLVGTPYWMAPEVISRLPYG
2f57A           SVLRALSYLHNQGVIHRDIKSDSILLTSDGRKLSDFGFC-AQVSKEVPKRKLVGTPYWMAPEVISRLPYG
2fumD           DACQALNFSHQNGIIHRDVKPANIMIATNAVKVMDFG--------------IIGTAQYLSPEQARGDSVD
3ckxA           EILKGLDYLHSEKKIHRDIKAANVLLSEHGEKLADFGVAGQLTDTQIKRNFV-GTPFWMAPEVIKQSAYD
2c30A           AVLQALAYLHAQGVIHRDIKSDSILLTDGRVKLSDFGFCAQISKD-VPKRKLVGTPYWMAPEVISRSLYA
3fxzA           ECLQALEFLHSNQVIHRDIKSDNILLGDGSVKLTDFGFCAQITPEQSKRSMV-GTPYWMAPEVVTRKAYG
3f61A           DACQALNFSHQNGIIHRDVKPANIMIATNAVKVMDFGIA----------------AQYLSPEQARGDSVD
1f3mC           ECLQALEFLHSNQVIHRDIKSDNILLGDGSVKLTDFGFCAQI-------TTMVGTPYWMAPEVVTRKAYG
2vwiC           ATLEGLEYLHKNGQIHRDVKAGNILLGEDGSQIADFGVSAFLATGGDITRNKVGTPCWMAPEQVRGYDF-
1f3mD           ECLQALEFLHSNQVIHRDIKSDNILLGDGSVKLTDFGFCAQIT---------PGTPYWMAPEVVTRKAYG
1u5qA           GALQGLAYLHSHNMIHRDVKAGNILLSPGLVKLGDFGSA-----SIMAPANFVGTPYWMAPEVILAGQYD
3dakD           ATLEGLEYLHKNGQIHRDVKAGNILLGEDGSQIADFGVSAFLATGGDITRNFVGTPCWMAPEQVRGYDF-
3ggfA           EILKGLDYLHSEKKIHRDIKAANVLLSEQGDKLADFGVAR---------NTFVGTPFWMAPEVIQQSAYD
1fotA           EVCLALEYLHSKDIIYRDLKPENILLDKNGHKITDFGFAKYVPDVTYL----CGTPDYIAPEVVSTKPYN
2vz6B           QILEAVLHCHQMGVVHRDLKPENLLLASAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYG
2vz6A           QILEAVLHCHQMGVVHRDLKPENLLLASAAVKLADFGLAIEVEGEQQAWFGFAGTPGYLSPEVLRKDPYG
3ggfB           EILKGLDYLHSEKKIHRDIKAANVLLSEQGDKLADFGVANTF----------VGTPFWMAPEVIQQSAYD
2fumC           DACQALN