[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ54630.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3f69B.bssp"
#ERROR : Can't open dsspfile "3f69A.bssp"
#ERROR : Can't open dsspfile "2fumB.bssp"
#ERROR : Can't open dsspfile "2fumA.bssp"
#ERROR : Can't open dsspfile "1mruB.bssp"
#ERROR : Can't open dsspfile "1mruA.bssp"
#ERROR : Can't open dsspfile "2fumD.bssp"
#ERROR : Can't open dsspfile "1o6yA.bssp"
#ERROR : Can't open dsspfile "3f61A.bssp"
#ERROR : Can't open dsspfile "1yhwA.bssp"
#ERROR : Can't open dsspfile "2j4zB.bssp"
#ERROR : Can't open dsspfile "2j4zA.bssp"
#ERROR : Can't open dsspfile "1f3mC.bssp"
#ERROR : Can't open dsspfile "1yhvA.bssp"
#ERROR : Can't open dsspfile "3fxzA.bssp"
#ERROR : Can't open dsspfile "1mq4A.bssp"
#ERROR : Can't open dsspfile "3e5aA.bssp"
#ERROR : Can't open dsspfile "2q0nA.bssp"
#ERROR : Can't open dsspfile "2j0iA.bssp"
#ERROR : Can't open dsspfile "2fumC.bssp"
#ERROR : Can't open dsspfile "3h10B.bssp"
#ERROR : Can't open dsspfile "3h10A.bssp"
#ERROR : Can't open dsspfile "2cdzA.bssp"
#ERROR : Can't open dsspfile "1ol7A.bssp"
#ERROR : Can't open dsspfile "1ol5A.bssp"
#ERROR : Can't open dsspfile "3ha6A.bssp"
#ERROR : Can't open dsspfile "2w1eA.bssp"
#ERROR : Can't open dsspfile "1f3mD.bssp"
#ERROR : Can't open dsspfile "3ckxA.bssp"
#ERROR : Can't open dsspfile "2w1gA.bssp"
#ERROR : Can't open dsspfile "2np8A.bssp"
#ERROR : Can't open dsspfile "1muoA.bssp"
#ERROR : Can't open dsspfile "2c6eA.bssp"
#ERROR : Can't open dsspfile "2w1dA.bssp"
#ERROR : Can't open dsspfile "3fdnA.bssp"
#ERROR : Can't open dsspfile "2c30A.bssp"
#ERROR : Can't open dsspfile "2w1fA.bssp"
#ERROR : Can't open dsspfile "2c6dA.bssp"
#ERROR : Can't open dsspfile "2bmcF.bssp"
#ERROR : Can't open dsspfile "2bmcC.bssp"
#ERROR : Can't open dsspfile "2bmcB.bssp"
#ERROR : Can't open dsspfile "2bmcA.bssp"
#ERROR : Can't open dsspfile "2j50A.bssp"
#ERROR : Can't open dsspfile "3h10D.bssp"
#ERROR : Can't open dsspfile "2dwbA.bssp"
#ERROR : Can't open dsspfile "3h0zA.bssp"
#ERROR : Can't open dsspfile "3h0yA.bssp"
#ERROR : Can't open dsspfile "3dj5A.bssp"
#ERROR : Can't open dsspfile "3h4jB.bssp"
#ERROR : Can't open dsspfile "2zmcA.bssp"
#ERROR : Can't open dsspfile "1u5qA.bssp"
#ERROR : Can't open dsspfile "3dj7A.bssp"
#ERROR : Can't open dsspfile "3dbqA.bssp"
#ERROR : Can't open dsspfile "3d15A.bssp"
#ERROR : Can't open dsspfile "3d14A.bssp"
#ERROR : Can't open dsspfile "2vwiD.bssp"
#ERROR : Can't open dsspfile "3d2iA.bssp"
#ERROR : Can't open dsspfile "2bvaB.bssp"
#ERROR : Can't open dsspfile "2c6eB.bssp"
#ERROR : Can't open dsspfile "3gfwA.bssp"
#ERROR : Can't open dsspfile "3dakD.bssp"
#ERROR : Can't open dsspfile "2bvaA.bssp"
#ERROR : Can't open dsspfile "2jamB.bssp"
#ERROR : Can't open dsspfile "2jamA.bssp"
#ERROR : Can't open dsspfile "2vwiC.bssp"
#ERROR : Can't open dsspfile "3h4jA.bssp"
#ERROR : Can't open dsspfile "2f57B.bssp"
#ERROR : Can't open dsspfile "2f57A.bssp"
#ERROR : Can't open dsspfile "2zmdA.bssp"
#ERROR : Can't open dsspfile "3h0zC.bssp"
#ERROR : Can't open dsspfile "3dakC.bssp"
#ERROR : Can't open dsspfile "3cohA.bssp"
#ERROR : Can't open dsspfile "2oibD.bssp"
#ERROR : Can't open dsspfile "3h9fA.bssp"
#ERROR : Can't open dsspfile "2qnjB.bssp"
#ERROR : Can't open dsspfile "3ckwA.bssp"
#ERROR : Can't open dsspfile "2v7oA.bssp"
#ERROR : Can't open dsspfile "3cekA.bssp"
#ERROR : Can't open dsspfile "3ggfB.bssp"
#ERROR : Can't open dsspfile "3ggfA.bssp"
#ERROR : Can't open dsspfile "2bdwB.bssp"
#ERROR : Can't open dsspfile "2bdwA.bssp"
#ERROR : Can't open dsspfile "2vgpB.bssp"
#ERROR : Can't open dsspfile "2vgoA.bssp"
#ERROR : Can't open dsspfile "1ol6A.bssp"
#ERROR : Can't open dsspfile "2bfxA.bssp"
#ERROR : Can't open dsspfile "2qnjA.bssp"
#ERROR : Can't open dsspfile "2phkA.bssp"
#ERROR : Can't open dsspfile "1phkA.bssp"
#ERROR : Can't open dsspfile "2hakE.bssp"
#ERROR : Can't open dsspfile "3dakA.bssp"
#ERROR : Can't open dsspfile "2bfyB.bssp"
#ERROR : Can't open dsspfile "2bfyA.bssp"
#ERROR : Can't open dsspfile "2wqeA.bssp"
#ERROR : Can't open dsspfile "3d2kA.bssp"
#ERROR : Can't open dsspfile "2welA.bssp"
#ERROR : Can't open dsspfile "2vn9A.bssp"
#ERROR : Can't open dsspfile "1uwhA.bssp"
#ERROR : Can't open dsspfile "1ql6A.bssp"
#ERROR : Can't open dsspfile "2nruB.bssp"
#ERROR : Can't open dsspfile "2nruA.bssp"
#ERROR : Can't open dsspfile "3efwB.bssp"
#ERROR : Can't open dsspfile "3efwA.bssp"
#ERROR : Can't open dsspfile "2clqA.bssp"
#ERROR : Can't open dsspfile "2vz6B.bssp"
#ERROR : Can't open dsspfile "3bhhD.bssp"
#ERROR : Can't open dsspfile "3bhhC.bssp"
#ERROR : Can't open dsspfile "3bhhB.bssp"
#ERROR : Can't open dsspfile "3bhhA.bssp"
#ERROR : Can't open dsspfile "3dajA.bssp"
#ERROR : Can't open dsspfile "2nryA.bssp"
#ERROR : Can't open dsspfile "3eqiA.bssp"
#ERROR : Can't open dsspfile "3eqfA.bssp"
#ERROR : Can't open dsspfile "3d4qA.bssp"
#ERROR : Can't open dsspfile "2vgoB.bssp"
#ERROR : Can't open dsspfile "3f3zA.bssp"
#ERROR : Can't open dsspfile "3hrfA.bssp"
#ERROR : Can't open dsspfile "3fe3A.bssp"
#ERROR : Can't open dsspfile "2biyA.bssp"
#ERROR : Can't open dsspfile "2vz6A.bssp"
#ERROR : Can't open dsspfile "2uztA.bssp"
#ERROR : Can't open dsspfile "2oicD.bssp"
#ERROR : Can't open dsspfile "2f7xE.bssp"
#ERROR : Can't open dsspfile "1uwjA.bssp"
#ERROR : Can't open dsspfile "2qg5D.bssp"
#ERROR : Can't open dsspfile "2qg5B.bssp"
#ERROR : Can't open dsspfile "2qg5A.bssp"
#ERROR : Can't open dsspfile "2nryC.bssp"
#ERROR : Can't open dsspfile "3e8nA.bssp"
#ERROR : Can't open dsspfile "3dakB.bssp"
#ERROR : Can't open dsspfile "3h0zB.bssp"
#ERROR : Can't open dsspfile "2vgpA.bssp"
#ERROR : Can't open dsspfile "2v5qA.bssp"
#ERROR : Can't open dsspfile "2oicA.bssp"
#ERROR : Can't open dsspfile "2nryD.bssp"
#ERROR : Can't open dsspfile "2evaA.bssp"
#ERROR : Can't open dsspfile "2bfxB.bssp"
#ERROR : Can't open dsspfile "1uwjB.bssp"
#ERROR : Can't open dsspfile "1okyA.bssp"
#ERROR : Can't open dsspfile "2oibC.bssp"
#ERROR : Can't open dsspfile "2hakA.bssp"
#ERROR : Can't open dsspfile "1a06A.bssp"
#ERROR : Can't open dsspfile "3hrcA.bssp"
#ERROR : Can't open dsspfile "3c0iA.bssp"
#ERROR : Can't open dsspfile "3c0hA.bssp"
#ERROR : Can't open dsspfile "3c0gB.bssp"
#ERROR : Can't open dsspfile "3c0gA.bssp"
#ERROR : Can't open dsspfile "1uu7A.bssp"
#ERROR : Can't open dsspfile "1h1wA.bssp"
#ERROR : Can't open dsspfile "2clqB.bssp"
#ERROR : Can't open dsspfile "2rkuA.bssp"
#ERROR : Can't open dsspfile "2ou7A.bssp"
#ERROR : Can't open dsspfile "3fc2A.bssp"
#ERROR : Can't open dsspfile "3eqcA.bssp"
#ERROR : Can't open dsspfile "2vrxB.bssp"
#ERROR : Can't open dsspfile "3i79A.bssp"
#ERROR : Can't open dsspfile "2w5bA.bssp"
#ERROR : Can't open dsspfile "2vwiB.bssp"
#ERROR : Can't open dsspfile "1zmwB.bssp"
#ERROR : Can't open dsspfile "1zmwA.bssp"
#ERROR : Can't open dsspfile "1s9jA.bssp"
#ERROR : Can't open dsspfile "3daeB.bssp"
#ERROR : Can't open dsspfile "3daeA.bssp"
#ERROR : Can't open dsspfile "2yzaA.bssp"
#ERROR : Can't open dsspfile "1uu9A.bssp"
#ERROR : Can't open dsspfile "1uu8A.bssp"
#ERROR : Can't open dsspfile "1okzA.bssp"
#ERROR : Can't open dsspfile "1j3hB.bssp"
#ERROR : Can't open dsspfile "1j3hA.bssp"
#ERROR : Can't open dsspfile "3h9oA.bssp"
#ERROR : Can't open dsspfile "2hakD.bssp"
#ERROR : Can't open dsspfile "2hakC.bssp"
#ERROR : Can't open dsspfile "2fb8A.bssp"
#ERROR : Can't open dsspfile "1zrzA.bssp"
#ERROR : Can't open dsspfile "1z5mA.bssp"
#ERROR : Can't open dsspfile "1xh8A.bssp"
#ERROR : Can't open dsspfile "1xh6A.bssp"
#ERROR : Can't open dsspfile "1uu3A.bssp"
#ERROR : Can't open dsspfile "1stcE.bssp"
#ERROR : Can't open dsspfile "2r7bA.bssp"
#ERROR : Can't open dsspfile "1q8uA.bssp"
#ERROR : Can't open dsspfile "1q8tA.bssp"
#ERROR : Can't open dsspfile "2jfmA.bssp"
#ERROR : Can't open dsspfile "2gnlA.bssp"
#ERROR : Can't open dsspfile "2gnjA.bssp"
#ERROR : Can't open dsspfile "3e8eI.bssp"
#ERROR : Can't open dsspfile "3e8cE.bssp"
#ERROR : Can't open dsspfile "3e8cB.bssp"
#ERROR : Can't open dsspfile "3dv3A.bssp"
#ERROR : Can't open dsspfile "3dneA.bssp"
#ERROR : Can't open dsspfile "3dndA.bssp"
#ERROR : Can't open dsspfile "1ctpE.bssp"
#ERROR : Can't open dsspfile "1cmkE.bssp"
#ERROR : Can't open dsspfile "1cdkA.bssp"
#ERROR : Can't open dsspfile "2c1aA.bssp"
#ERROR : Can't open dsspfile "2oicC.bssp"
#ERROR : Can't open dsspfile "2fh9A.bssp"
#ERROR : Can't open dsspfile "1xh7A.bssp"
#ERROR : Can't open dsspfile "2weiA.bssp"
#ERROR : Can't open dsspfile "2r5tA.bssp"
#ERROR : Can't open dsspfile "1q8wA.bssp"
#ERROR : Can't open dsspfile "2oibB.bssp"
#ERROR : Can't open dsspfile "1koaA.bssp"
#ERROR : Can't open dsspfile "2j51A.bssp"
#ERROR : Can't open dsspfile "3hdnA.bssp"
#ERROR : Can't open dsspfile "3hdmA.bssp"
#ERROR : Can't open dsspfile "2gngA.bssp"
#ERROR : Can't open dsspfile "2gnfA.bssp"
#ERROR : Can't open dsspfile "3d5uA.bssp"
#ERROR : Can't open dsspfile "3bwjA.bssp"
#ERROR : Can't open dsspfile "1xh9A.bssp"
#ERROR : Can't open dsspfile "1smhA.bssp"
#ERROR : Can't open dsspfile "3hx4A.bssp"
#ERROR : Can't open dsspfile "3comB.bssp"
#ERROR : Can't open dsspfile "3comA.bssp"
#ERROR : Can't open dsspfile "1s9iA.bssp"
#ERROR : Can't open dsspfile "2oidD.bssp"
#ERROR : Can't open dsspfile "3dy7A.bssp"
#ERROR : Can't open dsspfile "2w5aA.bssp"
#ERROR : Can't open dsspfile "2vo0A.bssp"
#ERROR : Can't open dsspfile "2uw4A.bssp"
#ERROR : Can't open dsspfile "2uvxA.bssp"
#ERROR : Can't open dsspfile "1q62A.bssp"
#ERROR : Can't open dsspfile "1q61A.bssp"
#ERROR : Can't open dsspfile "1q24A.bssp"
#ERROR : Can't open dsspfile "2jdtA.bssp"
#ERROR : Can't open dsspfile "2jc6C.bssp"
#ERROR : Can't open dsspfile "3dlsC.bssp"
#ERROR : Can't open dsspfile "3dlsB.bssp"
#ERROR : Can't open dsspfile "1zwsA.bssp"
#ERROR : Can't open dsspfile "2vo6A.bssp"
#ERROR : Can't open dsspfile "2uvzA.bssp"
#ERROR : Can't open dsspfile "2uvyA.bssp"
#ERROR : Can't open dsspfile "1u7eA.bssp"
#ERROR : Can't open dsspfile "1szmB.bssp"
#ERROR : Can't open dsspfile "1szmA.bssp"
#ERROR : Can't open dsspfile "1o6lA.bssp"
#ERROR : Can't open dsspfile "1o6kA.bssp"
#ERROR : Can't open dsspfile "2jdoA.bssp"
#ERROR : Can't open dsspfile "2jc6A.bssp"
#ERROR : Can't open dsspfile "2iw9C.bssp"
#ERROR : Can't open dsspfile "3idpB.bssp"
#ERROR : Can't open dsspfile "2h6dA.bssp"
#ERROR : Can't open dsspfile "3fhiA.bssp"
#ERROR : Can't open dsspfile "3e8dB.bssp"
#ERROR : Can't open dsspfile "3e8dA.bssp"
#ERROR : Can't open dsspfile "3e88A.bssp"
#ERROR : Can't open dsspfile "3e87A.bssp"
#ERROR : Can't open dsspfile "3dogC.bssp"
#ERROR : Can't open dsspfile "3db6A.bssp"
#ERROR : Can't open dsspfile "3d0eA.bssp"
#ERROR : Can't open dsspfile "2ckeB.bssp"
#ERROR : Can't open dsspfile "2ckeA.bssp"
#ERROR : Can't open dsspfile "3c4cB.bssp"
#ERROR : Can't open dsspfile "2a2aB.bssp"
#ERROR : Can't open dsspfile "2a2aA.bssp"
#ERROR : Can't open dsspfile "1ydrE.bssp"
#ERROR : Can't open dsspfile "1sykB.bssp"
#ERROR : Can't open dsspfile "1sykA.bssp"
#ERROR : Can't open dsspfile "1rejA.bssp"
#ERROR : Can't open dsspfile "2qvsE.bssp"
#ERROR : Can't open dsspfile "2qurA.bssp"
#ERROR : Can't open dsspfile "1jbpE.bssp"
#ERROR : Can't open dsspfile "2iw8C.bssp"
#ERROR : Can't open dsspfile "3idbA.bssp"
#ERROR : Can't open dsspfile "3hyhA.bssp"
#ERROR : Can't open dsspfile "2gu8A.bssp"
#ERROR : Can't open dsspfile "1fmoE.bssp"
#ERROR : Can't open dsspfile "3fjqE.bssp"
#ERROR : Can't open dsspfile "3dlsA.bssp"
#ERROR : Can't open dsspfile "1bkxA.bssp"
#ERROR : Can't open dsspfile "1apmE.bssp"
#ERROR : Can't open dsspfile "1v0bA.bssp"
#ERROR : Can't open dsspfile "1oiuC.bssp"
#ERROR : Can't open dsspfile "2jflA.bssp"
#ERROR : Can't open dsspfile "3e92A.bssp"
#ERROR : Can't open dsspfile "3ddqC.bssp"
#ERROR : Can't open dsspfile "3d83A.bssp"
#ERROR : Can't open dsspfile "1wmkH.bssp"
#ERROR : Can't open dsspfile "1wmkB.bssp"
#ERROR : Can't open dsspfile "1wmkE.bssp"
#ERROR : Can't open dsspfile "1wmkA.bssp"
#ERROR : Can't open dsspfile "1tkiA.bssp"
#ERROR : Can't open dsspfile "2qr8A.bssp"
#ERROR : Can't open dsspfile "2qcsA.bssp"
#ERROR : Can't open dsspfile "2pziA.bssp"
#ERROR : Can't open dsspfile "1oguC.bssp"
#ERROR : Can't open dsspfile "1l3rE.bssp"
#ERROR : Can't open dsspfile "2j90A.bssp"
#ERROR : Can't open dsspfile "2cpkE.bssp"
#ERROR : Can't open dsspfile "3bhuC.bssp"
#ERROR : Can't open dsspfile "3bhtC.bssp"
#ERROR : Can't open dsspfile "2a27A.bssp"
#ERROR : Can't open dsspfile "1vzoA.bssp"
#ERROR : Can't open dsspfile "2uv2A.bssp"
#ERROR : Can't open dsspfile "2g9xC.bssp"
#ERROR : Can't open dsspfile "3d5wA.bssp"
#ERROR : Can't open dsspfile "2w5hA.bssp"
#ERROR : Can't open dsspfile "2r0iA.bssp"
#ERROR : Can't open dsspfile "1h26C.bssp"
#ERROR : Can't open dsspfile "3c4cA.bssp"
#ERROR : Can't open dsspfile "2v55C.bssp"
#ERROR : Can't open dsspfile "2v55A.bssp"
#ERROR : Can't open dsspfile "2oicB.bssp"
#ERROR : Can't open dsspfile "1ob3A.bssp"
#ERROR : Can't open dsspfile "3idpA.bssp"
#ERROR : Can't open dsspfile "2etkB.bssp"
#ERROR : Can't open dsspfile "2etkA.bssp"
#ERROR : Can't open dsspfile "2vd5B.bssp"
#ERROR : Can't open dsspfile "1unlA.bssp"
#ERROR : Can't open dsspfile "2i6lB.bssp"
#ERROR : Can't open dsspfile "1fotA.bssp"
#ERROR : Can't open dsspfile "2vwiA.bssp"
#ERROR : Can't open dsspfile "2j0lA.bssp"
#ERROR : Can't open dsspfile "1h25C.bssp"
#ERROR : Can't open dsspfile "1zmuB.bssp"
#ERROR : Can't open dsspfile "1s9iB.bssp"
#ERROR : Can't open dsspfile "2oibA.bssp"
#ERROR : Can't open dsspfile "3igoA.bssp"
#ERROR : Can't open dsspfile "2hakG.bssp"
#ERROR : Can't open dsspfile "2h9vA.bssp"
#ERROR : Can't open dsspfile "2f2uB.bssp"
#ERROR : Can't open dsspfile "2f2uA.bssp"
#ERROR : Can't open dsspfile "3dlsF.bssp"
#ERROR : Can't open dsspfile "3dlsE.bssp"
#ERROR : Can't open dsspfile "1rdqE.bssp"
#ERROR : Can't open dsspfile "2pziB.bssp"
#ERROR : Can't open dsspfile "2oidC.bssp"
#ERROR : Can't open dsspfile "2j90B.bssp"
#ERROR : Can't open dsspfile "3coiA.bssp"
#ERROR : Can't open dsspfile "2i6lA.bssp"
#ERROR : Can't open dsspfile "2cn5A.bssp"
#ERROR : Can't open dsspfile "3c51B.bssp"
#ERROR : Can't open dsspfile "1zmvB.bssp"
#ERROR : Can't open dsspfile "2j7tA.bssp"
#ERROR : Can't open dsspfile "3dlsD.bssp"
#ERROR : Can't open dsspfile "2w4oA.bssp"
#ERROR : Can't open dsspfile "1v0oB.bssp"
#ERROR : Can't open dsspfile "2jbpC.bssp"
#ERROR : Can't open dsspfile "2fysA.bssp"
#ERROR : Can't open dsspfile "1ykrA.bssp"
#ERROR : Can't open dsspfile "1vywC.bssp"
#ERROR : Can't open dsspfile "1vywA.bssp"
#ERROR : Can't open dsspfile "1v0oA.bssp"
#ERROR : Can't open dsspfile "2r3qA.bssp"
#ERROR : Can't open dsspfile "2r3iA.bssp"
#ERROR : Can't open dsspfile "1pmqA.bssp"
#ERROR : Can't open dsspfile "1okvC.bssp"
#ERROR : Can't open dsspfile "1okvA.bssp"
#ERROR : Can't open dsspfile "2oidB.bssp"
#ERROR : Can't open dsspfile "2hw6B.bssp"
#ERROR : Can't open dsspfile "1gz8A.bssp"
#ERROR : Can't open dsspfile "3gc8B.bssp"
#ERROR : Can't open dsspfile "3gc8A.bssp"
#ERROR : Can't open dsspfile "3gc7A.bssp"
#ERROR : Can't open dsspfile "2g2iA.bssp"
#ERROR : Can't open dsspfile "3f5xA.bssp"
#ERROR : Can't open dsspfile "3dfaA.bssp"
#ERROR : Can't open dsspfile "3dbeA.bssp"
#ERROR : Can't open dsspfile "3d7zA.bssp"
#ERROR : Can't open dsspfile "3c4yA.bssp"
#ERROR : Can't open dsspfile "2c4gC.bssp"
#ERROR : Can't open dsspfile "2c4gA.bssp"
#ERROR : Can't open dsspfile "2bkzC.bssp"
#ERROR : Can't open dsspfile "2baqA.bssp"
#ERROR : Can't open dsspfile "2bajA.bssp"
#ERROR : Can't open dsspfile "3b2wA.bssp"
#ERROR : Can't open dsspfile "1zmuA.bssp"
#ERROR : Can't open dsspfile "1pmuA.bssp"
#ERROR : Can't open dsspfile "1oz1A.bssp"
#ERROR : Can't open dsspfile "2o0uA.bssp"
#ERROR : Can't open dsspfile "2gtmA.bssp"
#ERROR : Can't open dsspfile "2g2fB.bssp"
#ERROR : Can't open dsspfile "3e7oA.bssp"
#ERROR : Can't open dsspfile "3dqxA.bssp"
#ERROR : Can't open dsspfile "1bi8A.bssp"
#ERROR : Can't open dsspfile "2zdtA.bssp"
#ERROR : Can't open dsspfile "2zb0A.bssp"
#ERROR : Can't open dsspfile "1yqjA.bssp"
#ERROR : Can't open dsspfile "1wbsA.bssp"
#ERROR : Can't open dsspfile "1pmvA.bssp"
#ERROR : Can't open dsspfile "1pmnA.bssp"
#ERROR : Can't open dsspfile "2pl0A.bssp"
#ERROR : Can't open dsspfile "2p33A.bssp"
#ERROR : Can't open dsspfile "1ouyA.bssp"
#ERROR : Can't open dsspfile "2oidA.bssp"
#ERROR : Can't open dsspfile "2of2A.bssp"
#ERROR : Can't open dsspfile "1jnkA.bssp"
#ERROR : Can't open dsspfile "2hz4B.bssp"
#ERROR : Can't open dsspfile "2hz4A.bssp"
#ERROR : Can't open dsspfile "3gfeA.bssp"
#ERROR : Can't open dsspfile "3famA.bssp"
#ERROR : Can't open dsspfile "1di9A.bssp"
#ERROR : Can't open dsspfile "2cl1A.bssp"
#ERROR : Can't open dsspfile "3c51A.bssp"
#ERROR : Can't open dsspfile "3c50B.bssp"
#ERROR : Can't open dsspfile "3c50A.bssp"
#ERROR : Can't open dsspfile "3c4zA.bssp"
#ERROR : Can't open dsspfile "3c4yB.bssp"
#ERROR : Can't open dsspfile "3c4xB.bssp"
#ERROR : Can't open dsspfile "3c4xA.bssp"
#ERROR : Can't open dsspfile "3c4wB.bssp"
#ERROR : Can't open dsspfile "3c4wA.bssp"
#ERROR : Can't open dsspfile "1bi7A.bssp"
#ERROR : Can't open dsspfile "1qpjA.bssp"
#ERROR : Can't open dsspfile "1qpcA.bssp"
#ERROR : Can't open dsspfile "2ofuA.bssp"
#ERROR : Can't open dsspfile "2jbpD.bssp"
#ERROR : Can't open dsspfile "2iw6C.bssp"
#ERROR : Can't open dsspfile "2h96A.bssp"
#ERROR : Can't open dsspfile "2gmxB.bssp"
#ERROR : Can't open dsspfile "2gmxA.bssp"
#ERROR : Can't open dsspfile "2g2iB.bssp"
#ERROR : Can't open dsspfile "2g01B.bssp"
#ERROR : Can't open dsspfile "2g01A.bssp"
#ERROR : Can't open dsspfile "3famB.bssp"
#ERROR : Can't open dsspfile "3e93A.bssp"
#ERROR : Can't open dsspfile "2c3iB.bssp"
#ERROR : Can't open dsspfile "3bymA.bssp"
#ERROR : Can't open dsspfile "1zmvA.bssp"
#ERROR : Can't open dsspfile "1qpdA.bssp"
#ERROR : Can't open dsspfile "2o8yB.bssp"
#ERROR : Can't open dsspfile "2j0jA.bssp"
#ERROR : Can't open dsspfile "3eljA.bssp"
#ERROR : Can't open dsspfile "3dk6A.bssp"
#ERROR : Can't open dsspfile "3cqwA.bssp"
#ERROR : Can't open dsspfile "3cquA.bssp"
#ERROR : Can't open dsspfile "2b9iA.bssp"
#ERROR : Can't open dsspfile "2onlD.bssp"
#ERROR : Can't open dsspfile "2onlC.bssp"
#ERROR : Can't open dsspfile "2jkqA.bssp"
#ERROR : Can't open dsspfile "2jbpE.bssp"
#ERROR : Can't open dsspfile "2ijmB.bssp"
#ERROR : Can't open dsspfile "2ijmA.bssp"
#ERROR : Can't open dsspfile "2hznA.bssp"
#ERROR : Can't open dsspfile "2hz4C.bssp"
#ERROR : Can't open dsspfile "3hyhB.bssp"
#ERROR : Can't open dsspfile "3hkoA.bssp"
#ERROR : Can't open dsspfile "1fgiA.bssp"
#ERROR : Can't open dsspfile "2fa2B.bssp"
#ERROR : Can't open dsspfile "2fa2A.bssp"
#ERROR : Can't open dsspfile "2f49A.bssp"
#ERROR : Can't open dsspfile "2eueB.bssp"
#ERROR : Can't open dsspfile "2etmA.bssp"
#ERROR : Can't open dsspfile "2clxA.bssp"
#ERROR : Can't open dsspfile "2b9hA.bssp"
#ERROR : Can't open dsspfile "3b2tA.bssp"
#ERROR : Can't open dsspfile "2w9zB.bssp"
#ERROR : Can't open dsspfile "2w99B.bssp"
#ERROR : Can't open dsspfile "2w7xA.bssp"
#ERROR : Can't open dsspfile "2vd5A.bssp"
#ERROR : Can't open dsspfile "1ukhA.bssp"
#ERROR : Can't open dsspfile "2qohB.bssp"
#ERROR : Can't open dsspfile "2qohA.bssp"
#ERROR : Can't open dsspfile "2qkrA.bssp"
#ERROR : Can't open dsspfile "1p4fA.bssp"
#ERROR : Can't open dsspfile "2ozaA.bssp"
#ERROR : Can't open dsspfile "2iw8A.bssp"
#ERROR : Can't open dsspfile "3eqrB.bssp"
#ERROR : Can't open dsspfile "3ehaA.bssp"
#ERROR : Can't open dsspfile "1bmkA.bssp"
#ERROR : Can't open dsspfile "2a4lA.bssp"
#ERROR : Can't open dsspfile "1y57A.bssp"
#ERROR : Can't open dsspfile "2w96B.bssp"
#ERROR : Can't open dsspfile "1w98A.bssp"
#ERROR : Can't open dsspfile "2vtrA.bssp"
#ERROR : Can't open dsspfile "2srcA.bssp"
#ERROR : Can't open dsspfile "1jstA.bssp"
#ERROR : Can't open dsspfile "2jgzA.bssp"
#ERROR : Can't open dsspfile "2hw6A.bssp"
#ERROR : Can't open dsspfile "1hckA.bssp"
#ERROR : Can't open dsspfile "2h8hA.bssp"
#ERROR : Can't open dsspfile "1h27C.bssp"
#ERROR : Can't open dsspfile "1h24A.bssp"
#ERROR : Can't open dsspfile "2g9xA.bssp"
#ERROR : Can't open dsspfile "3fpmA.bssp"
#ERROR : Can't open dsspfile "1e9hA.bssp"
#ERROR : Can't open dsspfile "2ds1A.bssp"
#ERROR : Can't open dsspfile "2cchA.bssp"
#ERROR : Can't open dsspfile "2b9fA.bssp"
#ERROR : Can't open dsspfile "2zm3B.bssp"
#ERROR : Can't open dsspfile "2zduA.bssp"
#ERROR : Can't open dsspfile "2psqB.bssp"
#ERROR : Can't open dsspfile "2jbpB.bssp"
#ERROR : Can't open dsspfile "2i40A.bssp"
#ERROR : Can't open dsspfile "3hztA.bssp"
#ERROR : Can't open dsspfile "2g2hA.bssp"
#ERROR : Can't open dsspfile "2g2fA.bssp"
#ERROR : Can't open dsspfile "2f4jA.bssp"
#ERROR : Can't open dsspfile "3dgkA.bssp"
#ERROR : Can't open dsspfile "3ddqA.bssp"
#ERROR : Can't open dsspfile "1buhA.bssp"
#ERROR : Can't open dsspfile "3bhtA.bssp"
#ERROR : Can't open dsspfile "2zoqA.bssp"
#ERROR : Can't open dsspfile "2hziA.bssp"
#ERROR : Can't open dsspfile "2hz0A.bssp"
#ERROR : Can't open dsspfile "2hyyA.bssp"
#ERROR : Can't open dsspfile "2hiwA.bssp"
#ERROR : Can't open dsspfile "1g3nA.bssp"
#ERROR : Can't open dsspfile "2g1tD.bssp"
#ERROR : Can't open dsspfile "2g1tC.bssp"
#ERROR : Can't open dsspfile "2g1tB.bssp"
#ERROR : Can't open dsspfile "2g1tA.bssp"
#ERROR : Can't open dsspfile "2fysB.bssp"
#ERROR : Can't open dsspfile "2fvdA.bssp"
#ERROR : Can't open dsspfile "3cy3A.bssp"
#ERROR : Can't open dsspfile "3cs9D.bssp"
#ERROR : Can't open dsspfile "2c6iA.bssp"
#ERROR : Can't open dsspfile "2c68A.bssp"
#ERROR : Can't open dsspfile "1blxA.bssp"
#ERROR : Can't open dsspfile "3bgzA.bssp"
#ERROR : Can't open dsspfile "2balA.bssp"
#ERROR : Can't open dsspfile "1agwB.bssp"
#ERROR : Can't open dsspfile "1y8gB.bssp"
#ERROR : Can't open dsspfile "1y8gA.bssp"
#ERROR : Can't open dsspfile "1xo2B.bssp"
#ERROR : Can't open dsspfile "2w9fB.bssp"
#ERROR : Can't open dsspfile "2pzyB.bssp"
#ERROR : Can't open dsspfile "1opjB.bssp"
#ERROR : Can't open dsspfile "1opjA.bssp"
#ERROR : Can't open dsspfile "1m52B.bssp"
#ERROR : Can't open dsspfile "1m52A.bssp"
#ERROR : Can't open dsspfile "1iepA.bssp"
#ERROR : Can't open dsspfile "1h01A.bssp"
#ERROR : Can't open dsspfile "3fv8A.bssp"
#ERROR : Can't open dsspfile "1fpuA.bssp"
#ERROR : Can't open dsspfile "1f5qC.bssp"
#ERROR : Can't open dsspfile "3eocC.bssp"
#ERROR : Can't open dsspfile "3ej1C.bssp"
#ERROR : Can't open dsspfile "3ej1A.bssp"
#ERROR : Can't open dsspfile "3ds6A.bssp"
#ERROR : Can't open dsspfile "3dqwD.bssp"
#ERROR : Can't open dsspfile "3dqwC.bssp"
#ERROR : Can't open dsspfile "3dqwA.bssp"
#ERROR : Can't open dsspfile "1yrpA.bssp"
#ERROR : Can't open dsspfile "1yi6A.bssp"
#ERROR : Can't open dsspfile "1v0bB.bssp"
#ERROR : Can't open dsspfile "1tvoA.bssp"
#ERROR : Can't open dsspfile "2r3kA.bssp"
#ERROR : Can't open dsspfile "1qcfA.bssp"
#ERROR : Can't open dsspfile "2ojiA.bssp"
#ERROR : Can't open dsspfile "2ojgA.bssp"
#ERROR : Can't open dsspfile "1jsvA.bssp"
#ERROR : Can't open dsspfile "1jqhB.bssp"
#ERROR : Can't open dsspfile "1jqhA.bssp"
#ERROR : Can't open dsspfile "2jkmA.bssp"
#ERROR : Can't open dsspfile "2iw9A.bssp"
#ERROR : Can't open dsspfile "2hyyB.bssp"
#ERROR : Can't open dsspfile "2hk5A.bssp"
#ERROR : Can't open dsspfile "1h0uA.bssp"
#ERROR : Can't open dsspfile "2gqgB.bssp"
#ERROR : Can't open dsspfile "2gqgA.bssp"
#ERROR : Can't open dsspfile "1golA.bssp"
#ERROR : Can't open dsspfile "2eufB.bssp"
#ERROR : Can't open dsspfile "2etmB.bssp"
#ERROR : Can't open dsspfile "3erkA.bssp"
#ERROR : Can't open dsspfile "1erkA.bssp"
#ERROR : Can't open dsspfile "3eidA.bssp"
#ERROR : Can't open dsspfile "1e1vA.bssp"
#ERROR : Can't open dsspfile "3cy2A.bssp"
#ERROR : Can't open dsspfile "3cxwA.bssp"
#ERROR : Can't open dsspfile "3c4fA.bssp"
#ERROR : Can't open dsspfile "1agwA.bssp"
#ERROR : Can't open dsspfile "2z60A.bssp"
#ERROR : Can't open dsspfile "1wvyA.bssp"
#ERROR : Can't open dsspfile "1wvwA.bssp"
#ERROR : Can't open dsspfile "1oirA.bssp"
#ERROR : Can't open dsspfile "2objA.bssp"
#ERROR : Can't open dsspfile "1jktA.bssp"
#ERROR : Can't open dsspfile "1jkkA.bssp"
#ERROR : Can't open dsspfile "2jbpF.bssp"
#ERROR : Can't open dsspfile "2j0kA.bssp"
#ERROR : Can't open dsspfile "1ig1A.bssp"
#ERROR : Can't open dsspfile "3hmiA.bssp"
#ERROR : Can't open dsspfile "3gc9B.bssp"
#ERROR : Can't open dsspfile "3gc9A.bssp"
#ERROR : Can't open dsspfile "1f5qA.bssp"
#ERROR : Can't open dsspfile "3f2aA.bssp"
#ERROR : Can't open dsspfile "3eidC.bssp"
#ERROR : Can't open dsspfile "3eh9A.bssp"
#ERROR : Can't open dsspfile "3dxnA.bssp"
#ERROR : Can't open dsspfile "3dfcB.bssp"
#ERROR : Can't open dsspfile "3dcvA.bssp"
#ERROR : Can't open dsspfile "1cm8A.bssp"
#ERROR : Can't open dsspfile "2bikB.bssp"
#ERROR : Can't open dsspfile "2vtiA.bssp"
#ERROR : Can't open dsspfile "1ungA.bssp"
#ERROR : Can't open dsspfile "1ukiA.bssp"
#ERROR : Can't open dsspfile "1pmeA.bssp"
#ERROR : Can't open dsspfile "1oitA.bssp"
#ERROR : Can't open dsspfile "1kobA.bssp"
#ERROR : Can't open dsspfile "1jvpP.bssp"
#ERROR : Can't open dsspfile "2jkkA.bssp"
#ERROR : Can't open dsspfile "2j0mB.bssp"
#ERROR : Can't open dsspfile "2j0kB.bssp"
#ERROR : Can't open dsspfile "2iw6A.bssp"
#ERROR : Can't open dsspfile "2hyyD.bssp"
#ERROR : Can't open dsspfile "3f5pB.bssp"
#ERROR : Can't open dsspfile "2erkA.bssp"
#ERROR : Can't open dsspfile "3eqrA.bssp"
#ERROR : Can't open dsspfile "3dqxB.bssp"
#ERROR : Can't open dsspfile "3dk6B.bssp"
#ERROR : Can't open dsspfile "2bakA.bssp"
#ERROR : Can't open dsspfile "1ywvA.bssp"
#ERROR : Can't open dsspfile "1xwsA.bssp"
#ERROR : Can't open dsspfile "1xqzA.bssp"
#ERROR : Can't open dsspfile "2wajA.bssp"
#ERROR : Can't open dsspfile "2r3jA.bssp"
#ERROR : Can't open dsspfile "2r3hA.bssp"
#ERROR : Can't open dsspfile "1kswA.bssp"
#ERROR : Can't open dsspfile "2jbpH.bssp"
#ERROR : Can't open dsspfile "2jboA.bssp"
#ERROR : Can't open dsspfile "2javA.bssp"
#ERROR : Can't open dsspfile "2j2iB.bssp"
#ERROR : Can't open dsspfile "3g9nA.bssp"
#ERROR : Can't open dsspfile "3g33A.bssp"
#ERROR : Can't open dsspfile "3f6xD.bssp"
#ERROR : Can't open dsspfile "3f6xC.bssp"
#ERROR : Can't open dsspfile "3f6xA.bssp"
#ERROR : Can't open dsspfile "3f5pS.bssp"
#ERROR : Can't open dsspfile "3f5pI.bssp"
#ERROR : Can't open dsspfile "3f5pA.bssp"
#ERROR : Can't open dsspfile "3eqpA.bssp"
#ERROR : Can't open dsspfile "3eqpB.bssp"
#ERROR : Can't open dsspfile "2dq7X.bssp"
#ERROR : Can't open dsspfile "3d94A.bssp"
#ERROR : Can't open dsspfile "3c4eC.bssp"
#ERROR : Can't open dsspfile "2bzhB.bssp"
#ERROR : Can't open dsspfile "2bilB.bssp"
#ERROR : Can't open dsspfile "1yhsA.bssp"
#ERROR : Can't open dsspfile "2w0jA.bssp"
#ERROR : Can't open dsspfile "2r9sA.bssp"
#ERROR : Can't open dsspfile "1r39A.bssp"
#ERROR : Can't open dsspfile "1mryA.bssp"
#ERROR : Can't open dsspfile "1iasB.bssp"
#ERROR : Can't open dsspfile "2hakH.bssp"
#ERROR : Can't open dsspfile "2hakB.bssp"
#ERROR : Can't open dsspfile "1h4lA.bssp"
#ERROR : Can't open dsspfile "1h0vA.bssp"
#ERROR : Can't open dsspfile "3g90X.bssp"
#ERROR : Can't open dsspfile "2fgiA.bssp"
#ERROR : Can't open dsspfile "3f5pE.bssp"
#ERROR : Can't open dsspfile "2e14A.bssp"
#ERROR : Can't open dsspfile "2duvA.bssp"
#ERROR : Can't open dsspfile "2c5yA.bssp"
#ERROR : Can't open dsspfile "2zm3A.bssp"
#ERROR : Can't open dsspfile "1yxsA.bssp"
#ERROR : Can't open dsspfile "2wntB.bssp"
#ERROR : Can't open dsspfile "2wipC.bssp"
#ERROR : Can't open dsspfile "2wipA.bssp"
#ERROR : Can't open dsspfile "2uznA.bssp"
#ERROR : Can't open dsspfile "2r3lA.bssp"
#ERROR : Can't open dsspfile "2pzyC.bssp"
#ERROR : Can't open dsspfile "2pwlA.bssp"
#ERROR : Can't open dsspfile "1oi9A.bssp"
#ERROR : Can't open dsspfile "1k3aA.bssp"
#ERROR : Can't open dsspfile "2jbpI.bssp"
#ERROR : Can't open dsspfile "2i0eB.bssp"
#ERROR : Can't open dsspfile "2i0eA.bssp"
#ERROR : Can't open dsspfile "2hziB.bssp"
#ERROR : Can't open dsspfile "3hngA.bssp"
#ERROR : Can't open dsspfile "1h08A.bssp"
#ERROR : Can't open dsspfile "1gjoA.bssp"
#ERROR : Can't open dsspfile "3gcuA.bssp"
#ERROR : Can't open dsspfile "3fz1A.bssp"
#ERROR : Can't open dsspfile "3f5pM.bssp"
#ERROR : Can't open dsspfile "3f5pC.bssp"
#ERROR : Can't open dsspfile "3dtcA.bssp"
#ERROR : Can't open dsspfile "3dogA.bssp"
#ERROR : Can't open dsspfile "3dk3B.bssp"
#ERROR : Can't open dsspfile "3dk3A.bssp"
#ERROR : Can't open dsspfile "3cs9A.bssp"
#ERROR : Can't open dsspfile "3bqrA.bssp"
#ERROR : Can't open dsspfile "2w06A.bssp"
#ERROR : Can't open dsspfile "2vtsA.bssp"
#ERROR : Can't open dsspfile "2vtpA.bssp"
#ERROR : Can't open dsspfile "2v7aB.bssp"
#ERROR : Can't open dsspfile "2v7aA.bssp"
#ERROR : Can't open dsspfile "1u4dA.bssp"
#ERROR : Can't open dsspfile "2pmiC.bssp"
#ERROR : Can't open dsspfile "2pmiA.bssp"
#ERROR : Can't open dsspfile "2ozaB.bssp"
#ERROR : Can't open dsspfile "1oiyA.bssp"
#ERROR : Can't open dsspfile "1oguA.bssp"
#ERROR : Can't open dsspfile "1m7nA.bssp"
#ERROR : Can't open dsspfile "2jkoA.bssp"
#ERROR : Can't open dsspfile "3hrbA.bssp"
#ERROR : Can't open dsspfile "2gphA.bssp"
#ERROR : Can't open dsspfile "2f9gA.bssp"
#ERROR : Can't open dsspfile "2dylA.bssp"
#ERROR : Can't open dsspfile "1di8A.bssp"
#ERROR : Can't open dsspfile "3da6A.bssp"
#ERROR : Can't open dsspfile "2cjmC.bssp"
#ERROR : Can't open dsspfile "3bv3A.bssp"
#ERROR : Can't open dsspfile "2b52A.bssp"
#ERROR : Can't open dsspfile "2zazA.bssp"
#ERROR : Can't open dsspfile "1wccA.bssp"
#ERROR : Can't open dsspfile "2r3nA.bssp"
#ERROR : Can't open dsspfile "2pwlB.bssp"
#ERROR : Can't open dsspfile "2okrA.bssp"
#ERROR : Can't open dsspfile "1lezA.bssp"
#ERROR : Can't open dsspfile "1giiA.bssp"
#ERROR : Can't open dsspfile "2excX.bssp"
#ERROR : Can't open dsspfile "2ewaA.bssp"
#ERROR : Can't open dsspfile "3d5xA.bssp"
#ERROR : Can't open dsspfile "3bz3A.bssp"
#ERROR : Can't open dsspfile "3byuA.bssp"
#ERROR : Can't open dsspfile "3bv2A.bssp"
#ERROR : Can't open dsspfile "2zm3D.bssp"
#ERROR : Can't open dsspfile "1unhA.bssp"
#ERROR : Can't open dsspfile "2pzyD.bssp"
#ERROR : Can't open dsspfile "2pzpA.bssp"
#ERROR : Can't open dsspfile "2pvfA.bssp"
#ERROR : Can't open dsspfile "1h07A.bssp"
#ERROR : Can't open dsspfile "1gzkA.bssp"
#ERROR : Can't open dsspfile "2vthA.bssp"
#ERROR : Can't open dsspfile "2pzyA.bssp"
#ERROR : Can't open dsspfile "1p4oB.bssp"
#ERROR : Can't open dsspfile "1p4oA.bssp"
#ERROR : Can't open dsspfile "2oj9A.bssp"
#ERROR : Can't open dsspfile "2oiqB.bssp"
#ERROR : Can't open dsspfile "2ofvB.bssp"
#ERROR : Can't open dsspfile "2o2uA.bssp"
#ERROR : Can't open dsspfile "1gijA.bssp"
#ERROR : Can't open dsspfile "3gcpA.bssp"
#ERROR : Can't open dsspfile "3gc0A.bssp"
#ERROR : Can't open dsspfile "3g6hA.bssp"
#ERROR : Can't open dsspfile "3fy2A.bssp"
#ERROR : Can't open dsspfile "1fvtA.bssp"
#ERROR : Can't open dsspfile "1zz2A.bssp"
#ERROR : Can't open dsspfile "1vyzA.bssp"
#ERROR : Can't open dsspfile "2vtoA.bssp"
#ERROR : Can't open dsspfile "2pzpB.bssp"
#ERROR : Can't open dsspfile "2ok1A.bssp"
#ERROR : Can't open dsspfile "1lewA.bssp"
#ERROR : Can't open dsspfile "1jsuA.bssp"
#ERROR : Can't open dsspfile "2i0yA.bssp"
#ERROR : Can't open dsspfile "2i0vA.bssp"
#ERROR : Can't open dsspfile "3hp2A.bssp"
#ERROR : Can't open dsspfile "3hllA.bssp"
#ERROR : Can't open dsspfile "3hl7A.bssp"
#ERROR : Can't open dsspfile "3gqlC.bssp"
#ERROR : Can't open dsspfile "2ghlA.bssp"
#ERROR : Can't open dsspfile "3fbvI.bssp"
#ERROR : Can't open dsspfile "3fbvD.bssp"
#ERROR : Can't open dsspfile "3fbvA.bssp"
#ERROR : Can't open dsspfile "3clyA.bssp"
#ERROR : Can't open dsspfile "3c9wA.bssp"
#ERROR : Can't open dsspfile "3c5uA.bssp"
#ERROR : Can't open dsspfile "3bhyA.bssp"
#ERROR : Can't open dsspfile "2bdfB.bssp"
#ERROR : Can't open dsspfile "3b2tB.bssp"
#ERROR : Can't open dsspfile "2vv9A.bssp"
#ERROR : Can't open dsspfile "1v1kA.bssp"
#ERROR : Can't open dsspfile "2psqA.bssp"
#ERROR : Can't open dsspfile "1ny3A.bssp"
#ERROR : Can't open dsspfile "1ke6A.bssp"
#ERROR : Can't open dsspfile "2gfsA.bssp"
#ERROR : Can't open dsspfile "3gbzA.bssp"
#ERROR : Can't open dsspfile "3g6gB.bssp"
#ERROR : Can't open dsspfile "1ckpA.bssp"
#ERROR : Can't open dsspfile "2cjmA.bssp"
#ERROR : Can't open dsspfile "2btrA.bssp"
#ERROR : Can't open dsspfile "3blhA.bssp"
#ERROR : Can't open dsspfile "1ywrA.bssp"
#ERROR : Can't open dsspfile "1y91A.bssp"
#ERROR : Can't open dsspfile "1u46A.bssp"
#ERROR : Can't open dsspfile "2qkwB.bssp"
#ERROR : Can't open dsspfile "2pzrB.bssp"
#ERROR : Can't open dsspfile "2pzrA.bssp"
#ERROR : Can't open dsspfile "2pz5B.bssp"
#ERROR : Can't open dsspfile "2pz5A.bssp"
#ERROR : Can't open dsspfile "2pk9A.bssp"
#ERROR : Can't open dsspfile "2onlA.bssp"
#ERROR : Can't open dsspfile "2okrD.bssp"
#ERROR : Can't open dsspfile "2oiqA.bssp"
#ERROR : Can't open dsspfile "2og8B.bssp"
#ERROR : Can't open dsspfile "3ig7A.bssp"
#ERROR : Can't open dsspfile "3gqlB.bssp"
#ERROR : Can't open dsspfile "1gihA.bssp"
#ERROR : Can't open dsspfile "3d7tB.bssp"
#ERROR : Can't open dsspfile "3bx5A.bssp"
#ERROR : Can't open dsspfile "2acxB.bssp"
#ERROR : Can't open dsspfile "2acxA.bssp"
#ERROR : Can't open dsspfile "2wntA.bssp"
#ERROR : Can't open dsspfile "2w05A.bssp"
#ERROR : Can't open dsspfile "2vu3A.bssp"
#ERROR : Can't open dsspfile "1ungB.bssp"
#ERROR : Can't open dsspfile "2ofvA.bssp"
#ERROR : Can't open dsspfile "2jbpG.bssp"
#ERROR : Can't open dsspfile "2jbpA.bssp"
#ERROR : Can't open dsspfile "3hgkC.bssp"
#ERROR : Can't open dsspfile "3hgkB.bssp"
#ERROR : Can't open dsspfile "3hgkA.bssp"
#ERROR : Can't open dsspfile "3ha8A.bssp"
#ERROR : Can't open dsspfile "1h0wA.bssp"
#ERROR : Can't open dsspfile "3geqB.bssp"
#ERROR : Can't open dsspfile "3g9lX.bssp"
#ERROR : Can't open dsspfile "3en4B.bssp"
#ERROR : Can't open dsspfile "3ctqA.bssp"
#ERROR : Can't open dsspfile "2bdjA.bssp"
#ERROR : Can't open dsspfile "2bdfA.bssp"
#ERROR : Can't open dsspfile "1zycD.bssp"
#ERROR : Can't open dsspfile "1yw2A.bssp"
#ERROR : Can't open dsspfile "1wfcA.bssp"
#ERROR : Can't open dsspfile "2vtjA.bssp"
#ERROR : Can't open dsspfile "2qd9A.bssp"
#ERROR : Can't open dsspfile "2pvyD.bssp"
#ERROR : Can't open dsspfile "2hyyC.bssp"
#ERROR : Can't open dsspfile "3hmmA.bssp"
#ERROR : Can't open dsspfile "2gtnA.bssp"
#ERROR : Can't open dsspfile "3gcvA.bssp"
#ERROR : Can't open dsspfile "3g2fA.bssp"
#ERROR : Can't open dsspfile "3el8A.bssp"
#ERROR : Can't open dsspfile "3dk7B.bssp"
#ERROR : Can't open dsspfile "3dk7A.bssp"
#ERROR : Can't open dsspfile "3cg2A.bssp"
#ERROR : Can't open dsspfile "2b1pA.bssp"
#ERROR : Can't open dsspfile "2zm3C.bssp"
#ERROR : Can't open dsspfile "2z7lA.bssp"
#ERROR : Can't open dsspfile "1x8bA.bssp"
#ERROR : Can't open dsspfile "2r2pA.bssp"
#ERROR : Can't open dsspfile "2qr7A.bssp"
#ERROR : Can't open dsspfile "2og8A.bssp"
#ERROR : Can't open dsspfile "1mp8A.bssp"
#ERROR : Can't open dsspfile "1k9aE.bssp"
#ERROR : Can't open dsspfile "1k9aD.bssp"
#ERROR : Can't open dsspfile "1k9aA.bssp"
#ERROR : Can't open dsspfile "3gxlA.bssp"
#ERROR : Can't open dsspfile "3gvuA.bssp"
#ERROR : Can't open dsspfile "3gqlA.bssp"
#ERROR : Can't open dsspfile "2ghmA.bssp"
#ERROR : Can't open dsspfile "3gcqA.bssp"
#ERROR : Can't open dsspfile "3g6gA.bssp"
#ERROR : Can't open dsspfile "3f5pD.bssp"
#ERROR : Can't open dsspfile "3bysA.bssp"
#ERROR : Can't open dsspfile "3bi6A.bssp"
#ERROR : Can't open dsspfile "1aq1A.bssp"
#ERROR : Can't open dsspfile "1zydB.bssp"
#ERROR : Can't open dsspfile "2zb1A.bssp"
#ERROR : Can't open dsspfile "2vtnA.bssp"
#ERROR : Can't open dsspfile "2ptkA.bssp"
#ERROR : Can't open dsspfile "1ob3B.bssp"
#ERROR : Can't open dsspfile "2j9mA.bssp"
#ERROR : Can't open dsspfile "2iwiB.bssp"
#ERROR : Can't open dsspfile "3gqiA.bssp"
#ERROR : Can't open dsspfile "1g5sA.bssp"
#ERROR : Can't open dsspfile "1fpuB.bssp"
#ERROR : Can't open dsspfile "3fi2A.bssp"
#ERROR : Can't open dsspfile "3en5B.bssp"
#ERROR : Can't open dsspfile "2e2bB.bssp"
#ERROR : Can't open dsspfile "2e2bA.bssp"
#ERROR : Can't open dsspfile "1ad5A.bssp"
#ERROR : Can't open dsspfile "1zycA.bssp"
#ERROR : Can't open dsspfile "2vtqA.bssp"
#ERROR : Can't open dsspfile "2q0bA.bssp"
#ERROR : Can't open dsspfile "2py3B.bssp"
#ERROR : Can't open dsspfile "2pvyA.bssp"
#ERROR : Can't open dsspfile "1kv1A.bssp"
#ERROR : Can't open dsspfile "3geqA.bssp"
#ERROR : Can't open dsspfile "3fxxA.bssp"
#ERROR : Can't open dsspfile "3blrA.bssp"
#ERROR : Can't open dsspfile "2z2wA.bssp"
#ERROR : Can't open dsspfile "1q41B.bssp"
#ERROR : Can't open dsspfile "1q41A.bssp"
#ERROR : Can't open dsspfile "1q3dA.bssp"
#ERROR : Can't open dsspfile "2q0bB.bssp"
#ERROR : Can't open dsspfile "2py3A.bssp"
#ERROR : Can't open dsspfile "1lufA.bssp"
#ERROR : Can't open dsspfile "1i09A.bssp"
#ERROR : Can't open dsspfile "3f3vB.bssp"
#ERROR : Can't open dsspfile "3f3tA.bssp"
#ERROR : Can't open dsspfile "3ezvA.bssp"
#ERROR : Can't open dsspfile "3etaA.bssp"
#ERROR : Can't open dsspfile "3du8A.bssp"
#ERROR : Can't open dsspfile "2c0tB.bssp"
#ERROR : Can't open dsspfile "2c0tA.bssp"
#ERROR : Can't open dsspfile "2c0iA.bssp"
#ERROR : Can't open dsspfile "2btsA.bssp"
#ERROR : Can't open dsspfile "3blqA.bssp"
#ERROR : Can't open dsspfile "2vwxA.bssp"
#ERROR : Can't open dsspfile "2rioB.bssp"
#ERROR : Can't open dsspfile "2qokA.bssp"
#ERROR : Can't open dsspfile "2pv8A.bssp"
#ERROR : Can't open dsspfile "1k9aB.bssp"
#ERROR : Can't open dsspfile "1fmkA.bssp"
#ERROR : Can't open dsspfile "3en4A.bssp"
#ERROR : Can't open dsspfile "3e7oB.bssp"
#ERROR : Can't open dsspfile "3d7uA.bssp"
#ERROR : Can't open dsspfile "3cblA.bssp"
#ERROR : Can't open dsspfile "3bkbA.bssp"
#ERROR : Can't open dsspfile "1zycC.bssp"
#ERROR : Can't open dsspfile "1zycB.bssp"
#ERROR : Can't open dsspfile "2vx3C.bssp"
#ERROR : Can't open dsspfile "2vx3B.bssp"
#ERROR : Can't open dsspfile "2vttA.bssp"
#ERROR : Can't open dsspfile "1vjyA.bssp"
#ERROR : Can't open dsspfile "2rioA.bssp"
#ERROR : Can't open dsspfile "1r78A.bssp"
#ERROR : Can't open dsspfile "2qocA.bssp"
#ERROR : Can't open dsspfile "1jpaB.bssp"
#ERROR : Can't open dsspfile "1jowB.bssp"
#ERROR : Can't open dsspfile "2iwiA.bssp"
#ERROR : Can't open dsspfile "2hw7A.bssp"
#ERROR : Can't open dsspfile "3gcsA.bssp"
#ERROR : Can't open dsspfile "3faaA.bssp"
#ERROR : Can't open dsspfile "2wo6B.bssp"
#ERROR : Can't open dsspfile "2reiA.bssp"
#ERROR : Can't open dsspfile "2o8yA.bssp"
#ERROR : Can't open dsspfile "1k9aF.bssp"
#ERROR : Can't open dsspfile "3f88A.bssp"
#ERROR : Can't open dsspfile "3f7zB.bssp"
#ERROR : Can't open dsspfile "2f2cB.bssp"
#ERROR : Can't open dsspfile "2bujB.bssp"
#ERROR : Can't open dsspfile "2ac5A.bssp"
#ERROR : Can't open dsspfile "2a19B.bssp"
#ERROR : Can't open dsspfile "2z8cA.bssp"
#ERROR : Can't open dsspfile "2w17A.bssp"
#ERROR : Can't open dsspfile "2vx3D.bssp"
#ERROR : Can't open dsspfile "1u4dB.bssp"
#ERROR : Can't open dsspfile "2ogvA.bssp"
#ERROR : Can't open dsspfile "1mrvA.bssp"
#ERROR : Can't open dsspfile "1k9aC.bssp"
#ERROR : Can't open dsspfile "1ir3A.bssp"
#ERROR : Can't open dsspfile "3g6hB.bssp"
#ERROR : Can't open dsspfile "3g2fB.bssp"
#ERROR : Can't open dsspfile "3f6xB.bssp"
#ERROR : Can't open dsspfile "3f3uB.bssp"
#ERROR : Can't open dsspfile "3el8B.bssp"
#ERROR : Can't open dsspfile "3d7uD.bssp"
#ERROR : Can't open dsspfile "3d7uB.bssp"
#ERROR : Can't open dsspfile "3cs9B.bssp"
#ERROR : Can't open dsspfile "2wouA.bssp"
#ERROR : Can't open dsspfile "2wotA.bssp"
#ERROR : Can't open dsspfile "2wo6A.bssp"
#ERROR : Can't open dsspfile "1urwA.bssp"
#ERROR : Can't open dsspfile "2rg6A.bssp"
#ERROR : Can't open dsspfile "1py5A.bssp"
#ERROR : Can't open dsspfile "1iasA.bssp"
#ERROR : Can't open dsspfile "3h9rA.bssp"
#ERROR : Can't open dsspfile "2cn8A.bssp"
#ERROR : Can't open dsspfile "2bujA.bssp"
#ERROR : Can't open dsspfile "2bheA.bssp"
#ERROR : Can't open dsspfile "1b6cB.bssp"
#ERROR : Can't open dsspfile "2b55A.bssp"
#ERROR : Can't open dsspfile "2ac3A.bssp"
#ERROR : Can't open dsspfile "1zydA.bssp"
#ERROR : Can't open dsspfile "2z7qA.bssp"
#ERROR : Can't open dsspfile "2vx3A.bssp"
#ERROR : Can't open dsspfile "1u54B.bssp"
#ERROR : Can't open dsspfile "2qo9A.bssp"
#ERROR : Can't open dsspfile "1h00A.bssp"
#ERROR : Can't open dsspfile "3gp0A.bssp"
#ERROR : Can't open dsspfile "3f3wB.bssp"
#ERROR : Can't open dsspfile "3f3wA.bssp"
#ERROR : Can't open dsspfile "2e9nA.bssp"
#ERROR : Can't open dsspfile "3dpkA.bssp"
#ERROR : Can't open dsspfile "3cr0A.bssp"
#ERROR : Can't open dsspfile "3bu3A.bssp"
#ERROR : Can't open dsspfile "2aypA.bssp"
#ERROR : Can't open dsspfile "2auhA.bssp"
#ERROR : Can't open dsspfile "2a1aB.bssp"
#ERROR : Can't open dsspfile "2z7rA.bssp"
#ERROR : Can't open dsspfile "2vx0A.bssp"
#ERROR : Can't open dsspfile "1u59A.bssp"
#ERROR : Can't open dsspfile "1r0eA.bssp"
#ERROR : Can't open dsspfile "1q3dB.bssp"
#ERROR : Can't open dsspfile "1pyxB.bssp"
#ERROR : Can't open dsspfile "1pyxA.bssp"
#ERROR : Can't open dsspfile "2pvyC.bssp"
#ERROR : Can't open dsspfile "2pk9C.bssp"
#ERROR : Can't open dsspfile "2p5aA.bssp"
#ERROR : Can't open dsspfile "3hp5A.bssp"
#ERROR : Can't open dsspfile "3fi3A.bssp"
#ERROR : Can't open dsspfile "3cs9C.bssp"
#ERROR : Can't open dsspfile "3cd3A.bssp"
#ERROR : Can't open dsspfile "1yomB.bssp"
#ERROR : Can't open dsspfile "1t46A.bssp"
#ERROR : Can't open dsspfile "2qo2A.bssp"
#ERROR : Can't open dsspfile "2qlqB.bssp"
#ERROR : Can't open dsspfile "1q5kA.bssp"
#ERROR : Can't open dsspfile "1q3wA.bssp"
#ERROR : Can't open dsspfile "1kv2A.bssp"
#ERROR : Can't open dsspfile "1irkA.bssp"
#ERROR : Can't open dsspfile "2hz0B.bssp"
#ERROR : Can't open dsspfile "2gsfA.bssp"
#ERROR : Can't open dsspfile "3dzqA.bssp"
#ERROR : Can't open dsspfile "2bzkB.bssp"
#ERROR : Can't open dsspfile "1bygA.bssp"
#ERROR : Can't open dsspfile "3beaA.bssp"
#ERROR : Can't open dsspfile "1zysA.bssp"
#ERROR : Can't open dsspfile "2zv9A.bssp"
#ERROR : Can't open dsspfile "2z7sA.bssp"
#ERROR : Can't open dsspfile "1ym7D.bssp"
#ERROR : Can't open dsspfile "1ym7C.bssp"
#ERROR : Can't open dsspfile "1ym7A.bssp"
#ERROR : Can't open dsspfile "1q4lB.bssp"
#ERROR : Can't open dsspfile "1q4lA.bssp"
#ERROR : Can't open dsspfile "1q3wB.bssp"
#ERROR : Can't open dsspfile "2puuA.bssp"
#ERROR : Can't open dsspfile "1p2aA.bssp"
#ERROR : Can't open dsspfile "1omwA.bssp"
#ERROR : Can't open dsspfile "2in6A.bssp"
#ERROR : Can't open dsspfile "3gxjA.bssp"
#ERROR : Can't open dsspfile "3cikA.bssp"
#ERROR : Can't open dsspfile "2c3lA.bssp"
#ERROR : Can't open dsspfile "2brmA.bssp"
#ERROR : Can't open dsspfile "2bcjA.bssp"
#ERROR : Can't open dsspfile "1yomA.bssp"
#ERROR : Can't open dsspfile "2rg5A.bssp"
#ERROR : Can't open dsspfile "2qi8A.bssp"
#ERROR : Can't open dsspfile "2pvyB.bssp"
#ERROR : Can't open dsspfile "1pkgA.bssp"
#ERROR : Can't open dsspfile "2jbpK.bssp"
#ERROR : Can't open dsspfile "2io6A.bssp"
#ERROR : Can't open dsspfile "1ia8A.bssp"
#ERROR : Can't open dsspfile "3bizA.bssp"
#ERROR : Can't open dsspfile "1uv5A.bssp"
#ERROR : Can't open dsspfile "1u46B.bssp"
#ERROR : Can't open dsspfile "1i44A.bssp"
#ERROR : Can't open dsspfile "1h8fB.bssp"
#ERROR : Can't open dsspfile "1h8fA.bssp"
#ERROR : Can't open dsspfile "2h34A.bssp"
#ERROR : Can't open dsspfile "3g5dA.bssp"
#ERROR : Can't open dsspfile "1u54A.bssp"
#ERROR : Can't open dsspfile "2r4bA.bssp"
#ERROR : Can't open dsspfile "2qooA.bssp"
#ERROR : Can't open dsspfile "2qolA.bssp"
#ERROR : Can't open dsspfile "2ow3A.bssp"
#ERROR : Can't open dsspfile "1o9uA.bssp"
#ERROR : Can't open dsspfile "1kwpB.bssp"
#ERROR : Can't open dsspfile "2jldA.bssp"
#ERROR : Can't open dsspfile "2jbpL.bssp"
#ERROR : Can't open dsspfile "2i1mA.bssp"
#ERROR : Can't open dsspfile "2gdoA.bssp"
#ERROR : Can't open dsspfile "3g5dB.bssp"
#ERROR : Can't open dsspfile "3f7zA.bssp"
#ERROR : Can't open dsspfile "3ezrA.bssp"
#ERROR : Can't open dsspfile "1zyjA.bssp"
#ERROR : Can't open dsspfile "1t45A.bssp"
#ERROR : Can't open dsspfile "2qoiA.bssp"
#ERROR : Can't open dsspfile "2qofA.bssp"
#ERROR : Can't open dsspfile "2qodA.bssp"
#ERROR : Can't open dsspfile "2ptjA.bssp"
#ERROR : Can't open dsspfile "2npqA.bssp"
#ERROR : Can't open dsspfile "3g0fB.bssp"
#ERROR : Can't open dsspfile "3g0fA.bssp"
#ERROR : Can't open dsspfile "3g0eA.bssp"
#ERROR : Can't open dsspfile "3fc1X.bssp"
#ERROR : Can't open dsspfile "3etaB.bssp"
#ERROR : Can't open dsspfile "3dkoA.bssp"
#ERROR : Can't open dsspfile "2cgxA.bssp"
#ERROR : Can't open dsspfile "2cgvA.bssp"
#ERROR : Can't open dsspfile "2cguA.bssp"
#ERROR : Can't open dsspfile "2c3kA.bssp"
#ERROR : Can't open dsspfile "2brnA.bssp"
#ERROR : Can't open dsspfile "1q5kB.bssp"
#ERROR : Can't open dsspfile "2o5kA.bssp"
#ERROR : Can't open dsspfile "1nvrA.bssp"
#ERROR : Can't open dsspfile "2jldB.bssp"
#ERROR : Can't open dsspfile "2j5eA.bssp"
#ERROR : Can't open dsspfile "1j1bB.bssp"
#ERROR : Can't open dsspfile "1j1bA.bssp"
#ERROR : Can't open dsspfile "1i09B.bssp"
#ERROR : Can't open dsspfile "2hogA.bssp"
#ERROR : Can't open dsspfile "2fsoX.bssp"
#ERROR : Can't open dsspfile "2fslX.bssp"
#ERROR : Can't open dsspfile "3f3tB.bssp"
#ERROR : Can't open dsspfile "3eknA.bssp"
#ERROR : Can't open dsspfile "3eb0A.bssp"
#ERROR : Can't open dsspfile "3d7tA.bssp"
#ERROR : Can't open dsspfile "2c3jA.bssp"
#ERROR : Can't open dsspfile "3eb0C.bssp"
#ERROR : Can't open dsspfile "2cgwA.bssp"
#ERROR : Can't open dsspfile "3bceB.bssp"
#ERROR : Can't open dsspfile "2r4bB.bssp"
#ERROR : Can't open dsspfile "2ptoA.bssp"
#ERROR : Can't open dsspfile "2p3gX.bssp"
#ERROR : Can't open dsspfile "2itxA.bssp"
#ERROR : Can't open dsspfile "3e63A.bssp"
#ERROR : Can't open dsspfile "3e62A.bssp"
#ERROR : Can't open dsspfile "1zy4B.bssp"
#ERROR : Can't open dsspfile "1xkkA.bssp"
#ERROR : Can't open dsspfile "2vwvA.bssp"
#ERROR : Can't open dsspfile "2pkjA.bssp"
#ERROR : Can't open dsspfile "2ow3B.bssp"
#ERROR : Can't open dsspfile "2gs6A.bssp"
#ERROR : Can't open dsspfile "1gngB.bssp"
#ERROR : Can't open dsspfile "1gngA.bssp"
#ERROR : Can't open dsspfile "2fsmX.bssp"
#ERROR : Can't open dsspfile "3enmB.bssp"
#ERROR : Can't open dsspfile "1zy4A.bssp"
#ERROR : Can't open dsspfile "1mqbA.bssp"
#ERROR : Can't open dsspfile "1m17A.bssp"
#ERROR : Can't open dsspfile "1m14A.bssp"
#ERROR : Can't open dsspfile "1jpaA.bssp"
#ERROR : Can't open dsspfile "2j6mA.bssp"
#ERROR : Can't open dsspfile "2itwA.bssp"
#ERROR : Can't open dsspfile "2helA.bssp"
#ERROR : Can't open dsspfile "2gs2A.bssp"
#ERROR : Can't open dsspfile "3gniB.bssp"
#ERROR : Can't open dsspfile "3enmD.bssp"
#ERROR : Can't open dsspfile "3enmC.bssp"
#ERROR : Can't open dsspfile "3enmA.bssp"
#ERROR : Can't open dsspfile "3bceA.bssp"
#ERROR : Can't open dsspfile "2b7aB.bssp"
#ERROR : Can't open dsspfile "2b7aA.bssp"
#ERROR : Can't open dsspfile "2vwwA.bssp"
#ERROR : Can't open dsspfile "1rjbA.bssp"
#ERROR : Can't open dsspfile "2rgpA.bssp"
#ERROR : Can't open dsspfile "2qluA.bssp"
#ERROR : Can't open dsspfile "2brhA.bssp"
#ERROR : Can't open dsspfile "2rf9B.bssp"
#ERROR : Can't open dsspfile "2rf9A.bssp"
#ERROR : Can't open dsspfile "2j5fA.bssp"
#ERROR : Can't open dsspfile "2gs7A.bssp"
#ERROR : Can't open dsspfile "3el7A.bssp"
#ERROR : Can't open dsspfile "3ekkA.bssp"
#ERROR : Can't open dsspfile "1zy5B.bssp"
#ERROR : Can't open dsspfile "2zv7A.bssp"
#ERROR : Can't open dsspfile "1z57A.bssp"
#ERROR : Can't open dsspfile "1yolB.bssp"
#ERROR : Can't open dsspfile "1yolA.bssp"
#ERROR : Can't open dsspfile "2qq7A.bssp"
#ERROR : Can't open dsspfile "1nxkB.bssp"
#ERROR : Can't open dsspfile "1mqbB.bssp"
#ERROR : Can't open dsspfile "2gs7B.bssp"
#ERROR : Can't open dsspfile "2rfeA.bssp"
#ERROR : Can't open dsspfile "2qi8B.bssp"
#ERROR : Can't open dsspfile "2jiuB.bssp"
#ERROR : Can't open dsspfile "2jiuA.bssp"
#ERROR : Can't open dsspfile "2jitB.bssp"
#ERROR : Can't open dsspfile "2jitA.bssp"
#ERROR : Can't open dsspfile "3gt8C.bssp"
#ERROR : Can't open dsspfile "2fstX.bssp"
#ERROR : Can't open dsspfile "3belA.bssp"
#ERROR : Can't open dsspfile "2zvaA.bssp"
#ERROR : Can't open dsspfile "2qobA.bssp"
#ERROR : Can't open dsspfile "2pv5A.bssp"
#ERROR : Can't open dsspfile "2ivtA.bssp"
#ERROR : Can't open dsspfile "3en7A.bssp"
#ERROR : Can't open dsspfile "3bu5A.bssp"
#ERROR : Can't open dsspfile "3bceC.bssp"
#ERROR : Can't open dsspfile "2wmvA.bssp"
#ERROR : Can't open dsspfile "2qhnA.bssp"
#ERROR : Can't open dsspfile "1oiqA.bssp"
#ERROR : Can't open dsspfile "2ityA.bssp"
#ERROR : Can't open dsspfile "2itqA.bssp"
#ERROR : Can't open dsspfile "2itpA.bssp"
#ERROR : Can't open dsspfile "2henA.bssp"
#ERROR : Can't open dsspfile "3f9nA.bssp"
#ERROR : Can't open dsspfile "1ua2A.bssp"
#ERROR : Can't open dsspfile "1t4hA.bssp"
#ERROR : Can't open dsspfile "2rfeD.bssp"
#ERROR : Can't open dsspfile "2rfeB.bssp"
#ERROR : Can't open dsspfile "2rfdB.bssp"
#ERROR : Can't open dsspfile "2rfdA.bssp"
#ERROR : Can't open dsspfile "2qonA.bssp"
#ERROR : Can't open dsspfile "2qo7A.bssp"
#ERROR : Can't open dsspfile "1pyeA.bssp"
#ERROR : Can't open dsspfile "1nxkD.bssp"
#ERROR : Can't open dsspfile "1nxkC.bssp"
#ERROR : Can't open dsspfile "1kwpA.bssp"
#ERROR : Can't open dsspfile "2itvA.bssp"
#ERROR : Can't open dsspfile "2ittA.bssp"
#ERROR : Can't open dsspfile "3gt8D.bssp"
#ERROR : Can't open dsspfile "3gt8B.bssp"
#ERROR : Can't open dsspfile "3gt8A.bssp"
#ERROR : Can't open dsspfile "3fzoA.bssp"
#ERROR : Can't open dsspfile "3fpqB.bssp"
#ERROR : Can't open dsspfile "3fpqA.bssp"
#ERROR : Can't open dsspfile "1ckiB.bssp"
#ERROR : Can't open dsspfile "1ckiA.bssp"
#ERROR : Can't open dsspfile "1xbbA.bssp"
#ERROR : Can't open dsspfile "2r0uA.bssp"
#ERROR : Can't open dsspfile "1pkgB.bssp"
#ERROR : Can't open dsspfile "2itoA.bssp"
#ERROR : Can't open dsspfile "2itnA.bssp"
#ERROR : Can't open dsspfile "3en7B.bssp"
#ERROR : Can't open dsspfile "2rfeC.bssp"
#ERROR : Can't open dsspfile "2qlqA.bssp"
#ERROR : Can't open dsspfile "1nxkA.bssp"
#ERROR : Can't open dsspfile "2jivB.bssp"
#ERROR : Can't open dsspfile "2jivA.bssp"
#ERROR : Can't open dsspfile "2hwpB.bssp"
#ERROR : Can't open dsspfile "3en6A.bssp"
#ERROR : Can't open dsspfile "3en5A.bssp"
#ERROR : Can't open dsspfile "2eb2A.bssp"
#ERROR : Can't open dsspfile "1ckjB.bssp"
#ERROR : Can't open dsspfile "1ckjA.bssp"
#ERROR : Can't open dsspfile "3bbtD.bssp"
#ERROR : Can't open dsspfile "1zxeD.bssp"
#ERROR : Can't open dsspfile "2wmrA.bssp"
#ERROR : Can't open dsspfile "1zxeC.bssp"
#ERROR : Can't open dsspfile "2qoqA.bssp"
#ERROR : Can't open dsspfile "2itzA.bssp"
#ERROR : Can't open dsspfile "2ituA.bssp"
#ERROR : Can't open dsspfile "3fqeA.bssp"
#ERROR : Can't open dsspfile "2qq7B.bssp"
#ERROR : Can't open dsspfile "3k2lA.bssp"
#ERROR : Can't open dsspfile "2ivuA.bssp"
#ERROR : Can't open dsspfile "2hwoB.bssp"
#ERROR : Can't open dsspfile "2hwoA.bssp"
#ERROR : Can't open dsspfile "3e3pB.bssp"
#ERROR : Can't open dsspfile "3e3pA.bssp"
#ERROR : Can't open dsspfile "3cc6A.bssp"
#ERROR : Can't open dsspfile "2c47D.bssp"
#ERROR : Can't open dsspfile "1yojB.bssp"
#ERROR : Can't open dsspfile "1t53A.bssp"
#ERROR : Can't open dsspfile "2jbpJ.bssp"
#ERROR : Can't open dsspfile "2hwpA.bssp"
#ERROR : Can't open dsspfile "3fmeA.bssp"
#ERROR : Can't open dsspfile "3ewhA.bssp"
#ERROR : Can't open dsspfile "2c47C.bssp"
#ERROR : Can't open dsspfile "3bbwA.bssp"
#ERROR : Can't open dsspfile "3bbwB.bssp"
#ERROR : Can't open dsspfile "3bbtB.bssp"
#ERROR : Can't open dsspfile "3jvrA.bssp"
#ERROR : Can't open dsspfile "3fzpA.bssp"
#ERROR : Can't open dsspfile "3et7A.bssp"
#ERROR : Can't open dsspfile "2wmxA.bssp"
#ERROR : Can't open dsspfile "2wmwA.bssp"
#ERROR : Can't open dsspfile "2wmtA.bssp"
#ERROR : Can't open dsspfile "3fzsA.bssp"
#ERROR : Can't open dsspfile "3cokA.bssp"
#ERROR : Can't open dsspfile "1yojA.bssp"
#ERROR : Can't open dsspfile "2wmuA.bssp"
#ERROR : Can't open dsspfile "2wmsA.bssp"
#ERROR : Can't open dsspfile "2wmqA.bssp"
#ERROR : Can't open dsspfile "3jvsA.bssp"
#ERROR : Can't open dsspfile "2ivvA.bssp"
#ERROR : Can't open dsspfile "2ivsB.bssp"
#ERROR : Can't open dsspfile "2ivsA.bssp"
#ERROR : Can't open dsspfile "3fztA.bssp"
#ERROR : Can't open dsspfile "2c47B.bssp"
#ERROR : Can't open dsspfile "2c47A.bssp"
#ERROR : Can't open dsspfile "2brgA.bssp"
#ERROR : Can't open dsspfile "1xbcA.bssp"
#ERROR : Can't open dsspfile "2oh4A.bssp"
#ERROR : Can't open dsspfile "2jedB.bssp"
#ERROR : Can't open dsspfile "2jedA.bssp"
#ERROR : Can't open dsspfile "3h3cA.bssp"
#ERROR : Can't open dsspfile "3cokB.bssp"

## Summary of PDB Search
:603
    7e-29  39%  3f69B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    2e-26  39%  3f69A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    4e-26  39%  2fumB  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    5e-26  38%  2fumA  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-25  38%  1mruB  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-25  38%  1mruA  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    5e-25  38%  2fumD  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    1e-24  38%  1o6yA  [d.144.1] PROBABLE SERINE/THREONINE-PROTEIN KINASE
    2e-24  39%  3f61A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNB
    3e-23  30%  1yhwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    9e-23  32%  2j4zB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    9e-23  32%  2j4zA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    9e-23  32%  1f3mC  [d.144.1] SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
    2e-22  30%  1yhvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    3e-22  30%  3fxzA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 1
    4e-22  32%  1mq4A  [d.144.1] AURORA-RELATED KINASE 1
    4e-22  32%  3e5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    8e-22  33%  2q0nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    8e-22  33%  2j0iA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    8e-22  37%  2fumC  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNB
    1e-21  31%  3h10B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-21  31%  3h10A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-21  32%  2cdzA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 4
    2e-21  31%  1ol7A  [d.144.1] SERINE/THREONINE KINASE 6
    2e-21  31%  1ol5A  [d.144.1] SERINE/THREONINE KINASE 6
    2e-21  31%  3ha6A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    7e-21  32%  2w1eA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    7e-21  31%  1f3mD  [d.144.1] SERINE/THREONINE-PROTEIN KINASE PAK-ALPHA
    9e-21  29%  3ckxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    1e-20  32%  2w1gA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-20  31%  2np8A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-20  32%  1muoA  [d.144.1] AURORA-RELATED KINASE 1
    2e-20  32%  2c6eA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-20  33%  2w1dA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-20  32%  3fdnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-20  30%  2c30A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 6
    3e-20  32%  2w1fA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-20  32%  2c6dA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    4e-20  32%  2bmcF  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    4e-20  32%  2bmcC  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    4e-20  32%  2bmcB  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    4e-20  32%  2bmcA  [x.x.x] SERINE THREONINE-PROTEIN KINASE 6
    1e-19  32%  2j50A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-19  31%  3h10D  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-19  32%  2dwbA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-19  32%  3h0zA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-19  32%  3h0yA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-19  32%  3dj5A  [x.x.x] SERINE/THREONINE KINASE 6
    4e-19  30%  3h4jB  [x.x.x] SNF1-LIKE PROTEIN KINASE SSP2
    6e-19  28%  2zmcA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    6e-19  30%  1u5qA  [d.144.1] SERINE/THREONINE PROTEIN KINASE TAO2
    6e-19  31%  3dj7A  [x.x.x] SERINE/THREONINE KINASE 6
    6e-19  28%  3dbqA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    6e-19  31%  3d15A  [x.x.x] SERINE/THREONINE KINASE 6
    6e-19  31%  3d14A  [x.x.x] SERINE/THREONINE KINASE 6
    8e-19  31%  2vwiD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    8e-19  31%  3d2iA  [x.x.x] SERINE/THREONINE KINASE 6
    8e-19  33%  2bvaB  [x.x.x] P21-ACTIVATED KINASE 4
    1e-18  32%  2c6eB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-18  28%  3gfwA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    1e-18  31%  3dakD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    1e-18  31%  2bvaA  [x.x.x] P21-ACTIVATED KINASE 4
    2e-18  28%  2jamB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-18  28%  2jamA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-18  30%  2vwiC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    4e-18  31%  3h4jA  [x.x.x] SNF1-LIKE PROTEIN KINASE SSP2
    4e-18  31%  2f57B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 7
    4e-18  31%  2f57A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PAK 7
    7e-18  28%  2zmdA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    7e-18  32%  3h0zC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    7e-18  31%  3dakC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    7e-18  31%  3cohA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    1e-17  31%  2oibD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-17  28%  3h9fA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    3e-17  26%  2qnjB  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    3e-17  35%  3ckwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 24
    3e-17  27%  2v7oA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    5e-17  28%  3cekA  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE TTK
    6e-17  29%  3ggfB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MST4
    6e-17  29%  3ggfA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MST4
    8e-17  26%  2bdwB  [x.x.x] HYPOTHETICAL PROTEIN K11E8.1D
    8e-17  26%  2bdwA  [x.x.x] HYPOTHETICAL PROTEIN K11E8.1D
    1e-16  29%  2vgpB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    1e-16  29%  2vgoA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    1e-16  30%  1ol6A  [d.144.1] SERINE/THREONINE KINASE 6
    1e-16  29%  2bfxA  [x.x.x] LOC398457 PROTEIN
    2e-16  26%  2qnjA  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    2e-16  31%  2phkA  [d.144.1] PHOSPHORYLASE KINASE
    2e-16  31%  1phkA  [x.x.x] PHOSPHORYLASE KINASE
    2e-16  26%  2hakE  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    2e-16  31%  3dakA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    2e-16  29%  2bfyB  [x.x.x] LOC398457 PROTEIN
    2e-16  29%  2bfyA  [x.x.x] LOC398457 PROTEIN
    2e-16  32%  2wqeA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    2e-16  32%  3d2kA  [x.x.x] SERINE/THREONINE KINASE 6
    3e-16  25%  2welA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    3e-16  25%  2vn9A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    3e-16  31%  1uwhA  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    3e-16  31%  1ql6A  [d.144.1] PHOSPHORYLASE KINASE
    3e-16  34%  2nruB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    3e-16  34%  2nruA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    3e-16  32%  3efwB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-16  32%  3efwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    3e-16  29%  2clqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 5
    4e-16  26%  2vz6B  [x.x.x] CALCIUM CALMODULIN DEPENDENT PROTEIN KINASE TYPE
    4e-16  27%  3bhhD  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-16  27%  3bhhC  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-16  27%  3bhhB  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    4e-16  27%  3bhhA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    7e-16  31%  3dajA  [x.x.x] SERINE/THREONINE KINASE 6
    9e-16  31%  2nryA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    9e-16  31%  3eqiA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    9e-16  31%  3eqfA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    1e-15  30%  3d4qA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    1e-15  29%  2vgoB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    1e-15  28%  3f3zA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE WITH
    2e-15  36%  3hrfA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    2e-15  26%  3fe3A  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 3
    2e-15  37%  2biyA  [x.x.x] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    2e-15  26%  2vz6A  [x.x.x] CALCIUM CALMODULIN DEPENDENT PROTEIN KINASE TYPE
    2e-15  31%  2uztA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-15  30%  2oicD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-15  31%  2f7xE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    3e-15  30%  1uwjA  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    4e-15  28%  2qg5D  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    4e-15  28%  2qg5B  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    4e-15  28%  2qg5A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    4e-15  30%  2nryC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    4e-15  31%  3e8nA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    4e-15  30%  3dakB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    6e-15  31%  3h0zB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 6
    7e-15  28%  2vgpA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    7e-15  26%  2v5qA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    7e-15  32%  2oicA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    7e-15  31%  2nryD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    7e-15  29%  2evaA  [x.x.x] TAK1 KINASE - TAB1 CHIMERA FUSION PROTEIN
    7e-15  28%  2bfxB  [x.x.x] LOC398457 PROTEIN
    9e-15  30%  1uwjB  [d.144.1] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    9e-15  38%  1okyA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
    9e-15  32%  2oibC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    9e-15  25%  2hakA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    9e-15  26%  1a06A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE
    1e-14  37%  3hrcA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    1e-14  26%  3c0iA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    1e-14  26%  3c0hA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    1e-14  26%  3c0gB  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    1e-14  26%  3c0gA  [x.x.x] PERIPHERAL PLASMA MEMBRANE PROTEIN CASK
    2e-14  38%  1uu7A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    2e-14  37%  1h1wA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    2e-14  28%  2clqB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 5
    2e-14  26%  2rkuA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    2e-14  26%  2ou7A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    2e-14  26%  3fc2A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK1
    2e-14  31%  3eqcA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    3e-14  28%  2vrxB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 12-A
    3e-14  24%  3i79A  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    4e-14  27%  2w5bA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    4e-14  29%  2vwiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    5e-14  25%  1zmwB  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    5e-14  25%  1zmwA  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    5e-14  31%  1s9jA  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    5e-14  29%  3daeB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    5e-14  29%  3daeA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    6e-14  27%  2yzaA  [x.x.x] 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC
    6e-14  38%  1uu9A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    6e-14  38%  1uu8A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    6e-14  38%  1okzA  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE 1
    6e-14  30%  1j3hB  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    6e-14  30%  1j3hA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    6e-14  38%  3h9oA  [x.x.x] 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    8e-14  24%  2hakD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    8e-14  24%  2hakC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    8e-14  30%  2fb8A  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    1e-13  24%  1zrzA  [x.x.x] PROTEIN KINASE C, IOTA
    1e-13  39%  1z5mA  [x.x.x] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    1e-13  30%  1xh8A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  30%  1xh6A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  39%  1uu3A  [d.144.1] 3-PHOSPHOINOSITIDE DEPENDENT PROTEIN KINASE-1
    1e-13  30%  1stcE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-13  39%  2r7bA  [x.x.x] PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
    1e-13  30%  1q8uA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  30%  1q8tA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  26%  2jfmA  [x.x.x] STE20-LIKE SERINE-THREONINE KINASE
    1e-13  30%  2gnlA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  30%  2gnjA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-13  30%  3e8eI  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-13  30%  3e8cE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-13  30%  3e8cB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-13  31%  3dv3A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    1e-13  30%  3dneA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-13  30%  3dndA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-13  30%  1ctpE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-13  30%  1cmkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    1e-13  30%  1cdkA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-13  30%  2c1aA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE
    1e-13  31%  2oicC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-13  29%  2fh9A  [x.x.x] SNF1 KINASE
    2e-13  31%  1xh7A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  25%  2weiA  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1, PUTATIVE
    2e-13  28%  2r5tA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    2e-13  31%  1q8wA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  31%  2oibB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    2e-13  24%  1koaA  [x.x.x] TWITCHIN
    2e-13  27%  2j51A  [x.x.x] STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
    2e-13  28%  3hdnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    2e-13  28%  3hdmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE SGK1
    2e-13  30%  2gngA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  30%  2gnfA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  25%  3d5uA  [x.x.x] POLO-LIKE KINASE 1
    2e-13  31%  3bwjA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  30%  1xh9A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  30%  1smhA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-13  25%  3hx4A  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    2e-13  31%  3comB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    2e-13  31%  3comA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 4
    3e-13  31%  1s9iA  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    3e-13  29%  2oidD  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    3e-13  30%  3dy7A  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN KINASE
    4e-13  28%  2w5aA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    4e-13  30%  2vo0A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-13  30%  2uw4A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-13  30%  2uvxA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-13  30%  1q62A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-13  30%  1q61A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-13  30%  1q24A  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    4e-13  30%  2jdtA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE
    4e-13  24%  2jc6C  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    5e-13  28%  3dlsC  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    5e-13  27%  3dlsB  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    7e-13  24%  1zwsA  [x.x.x] DAP-KINASE RELATED PROTEIN 1
    7e-13  31%  2vo6A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-13  31%  2uvzA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-13  31%  2uvyA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-13  29%  1u7eA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-13  31%  1szmB  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-13  31%  1szmA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    7e-13  28%  1o6lA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    7e-13  28%  1o6kA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    7e-13  28%  2jdoA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    7e-13  23%  2jc6A  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    7e-13  28%  2iw9C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-13  29%  3idpB  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    7e-13  27%  2h6dA  [x.x.x] 5'-AMP-ACTIVATED PROTEIN KINASE CATALYTIC
    7e-13  29%  3fhiA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    7e-13  28%  3e8dB  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    7e-13  28%  3e8dA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    7e-13  28%  3e88A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    7e-13  28%  3e87A  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    7e-13  27%  3dogC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-13  25%  3db6A  [x.x.x] POLO-LIKE KINASE 1
    7e-13  28%  3d0eA  [x.x.x] RAC-BETA SERINE/THREONINE-PROTEIN KINASE
    7e-13  24%  2ckeB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    7e-13  24%  2ckeA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    7e-13  32%  3c4cB  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    7e-13  24%  2a2aB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    7e-13  24%  2a2aA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    9e-13  29%  1ydrE  [d.144.1] C-AMP-DEPENDENT PROTEIN KINASE
    9e-13  29%  1sykB  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    9e-13  29%  1sykA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    9e-13  29%  1rejA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    9e-13  29%  2qvsE  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    9e-13  29%  2qurA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    9e-13  29%  1jbpE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    9e-13  27%  2iw8C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-13  29%  3idbA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC SUBUNIT
    9e-13  28%  3hyhA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    9e-13  29%  2gu8A  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    9e-13  29%  1fmoE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    9e-13  29%  3fjqE  [d.144.1 (1atpE)] CAMP-DEPENDENT PROTEIN KINASE CATALYTIC
    9e-13  28%  3dlsA  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    9e-13  29%  1bkxA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    9e-13  29%  1apmE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE
    1e-12  29%  1v0bA  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    1e-12  27%  1oiuC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-12  27%  2jflA  [x.x.x] STE20-LIKE SERINE/THREONINE-PROTEIN KINASE
    1e-12  34%  3e92A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-12  27%  3ddqC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-12  34%  3d83A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-12  24%  1wmkH  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-12  24%  1wmkB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-12  24%  1wmkE  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-12  24%  1wmkA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-12  27%  1tkiA  [d.144.1] TITIN
    2e-12  27%  2qr8A  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-3
    2e-12  30%  2qcsA  [x.x.x] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  31%  2pziA  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNG
    2e-12  28%  1oguC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-12  30%  1l3rE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    2e-12  25%  2j90A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    2e-12  30%  2cpkE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, CATALYTIC SUBUNIT
    2e-12  28%  3bhuC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-12  28%  3bhtC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-12  24%  2a27A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 2
    2e-12  27%  1vzoA  [d.144.1] RIBOSOMAL PROTEIN S6 KINASE ALPHA 5
    2e-12  26%  2uv2A  [x.x.x] STE20-LIKE SERINE-THREONINE KINASE
    2e-12  29%  2g9xC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-12  34%  3d5wA  [x.x.x] POLO-LIKE KINASE 1
    3e-12  28%  2w5hA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    3e-12  25%  2r0iA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK2
    3e-12  29%  1h26C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-12  32%  3c4cA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    3e-12  30%  2v55C  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    3e-12  30%  2v55A  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    3e-12  30%  2oicB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    3e-12  29%  1ob3A  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    3e-12  29%  3idpA  [x.x.x] B-RAF PROTO-ONCOGENE SERINE/THREONINE-PROTEIN
    3e-12  30%  2etkB  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    3e-12  30%  2etkA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 1
    4e-12  28%  2vd5B  [x.x.x] DMPK PROTEIN
    4e-12  28%  1unlA  [d.144.1] CYCLIN-DEPENDENT KINASE 5
    4e-12  33%  2i6lB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 6
    4e-12  26%  1fotA  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE TYPE 1
    6e-12  29%  2vwiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE OSR1
    6e-12  25%  2j0lA  [x.x.x] FOCAL ADHESION KINASE 1
    6e-12  29%  1h25C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    7e-12  24%  1zmuB  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    7e-12  31%  1s9iB  [d.144.1] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    7e-12  29%  2oibA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    7e-12  26%  3igoA  [x.x.x] CALMODULIN-DOMAIN PROTEIN KINASE 1
    7e-12  26%  2hakG  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    7e-12  28%  2h9vA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    7e-12  28%  2f2uB  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    7e-12  28%  2f2uA  [x.x.x] RHO-ASSOCIATED PROTEIN KINASE 2
    7e-12  27%  3dlsF  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    7e-12  27%  3dlsE  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    1e-11  29%  1rdqE  [d.144.1] CAMP-DEPENDENT PROTEIN KINASE, ALPHA-CATALYTIC
    1e-11  32%  2pziB  [x.x.x] PROBABLE SERINE/THREONINE-PROTEIN KINASE PKNG
    1e-11  30%  2oidC  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-11  22%  2j90B  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    1e-11  30%  3coiA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 13
    1e-11  34%  2i6lA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 6
    1e-11  27%  2cn5A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    1e-11  33%  3c51B  [x.x.x] RHODOPSIN KINASE
    2e-11  23%  1zmvB  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    2e-11  30%  2j7tA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 10
    2e-11  27%  3dlsD  [x.x.x] PAS DOMAIN-CONTAINING SERINE/THREONINE-PROTEIN
    2e-11  28%  2w4oA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE
    2e-11  30%  1v0oB  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    2e-11  28%  2jbpC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-11  28%  2fysA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    3e-11  29%  1ykrA  [d.144.1 (1finA)] CELL DIVISION PROTEIN KINASE 2
    3e-11  29%  1vywC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-11  29%  1vywA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-11  29%  1v0oA  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    3e-11  31%  2r3qA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-11  31%  2r3iA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-11  30%  1pmqA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-11  29%  1okvC  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-11  29%  1okvA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-11  30%  2oidB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    3e-11  31%  2hw6B  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    3e-11  31%  1gz8A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-11  37%  3gc8B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    3e-11  37%  3gc8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    3e-11  34%  3gc7A  [d.144.1 (1oveA)] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-11  26%  2g2iA  [x.x.x] ABL TYROSINE KINASE
    3e-11  29%  3f5xA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-11  24%  3dfaA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE CGD3_920
    3e-11  24%  3dbeA  [x.x.x] POLO-LIKE KINASE 1
    3e-11  34%  3d7zA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-11  31%  3c4yA  [x.x.x] RHODOPSIN KINASE
    3e-11  29%  2c4gC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-11  29%  2c4gA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-11  29%  2bkzC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-11  34%  2baqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-11  34%  2bajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-11  27%  3b2wA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    4e-11  23%  1zmuA  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    4e-11  30%  1pmuA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    4e-11  32%  1oz1A  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-11  31%  2o0uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    4e-11  32%  2gtmA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-11  25%  2g2fB  [x.x.x] ABL KINASE
    4e-11  28%  3e7oA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 9
    4e-11  26%  3dqxA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-11  30%  1bi8A  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    5e-11  30%  2zdtA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    5e-11  34%  2zb0A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-11  34%  1yqjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-11  34%  1wbsA  [d.144.1 (1bl6A)] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-11  30%  1pmvA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    5e-11  30%  1pmnA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 10
    5e-11  27%  2pl0A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    5e-11  30%  2p33A  [x.x.x] C-JUN N-TERMINAL KINASE 3
    5e-11  34%  1ouyA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-11  31%  2oidA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    5e-11  27%  2of2A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    5e-11  30%  1jnkA  [x.x.x] C-JUN N-TERMINAL KINASE
    5e-11  25%  2hz4B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-11  25%  2hz4A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-11  34%  3gfeA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-11  28%  3famA  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    5e-11  34%  1di9A  [d.144.1] P38 KINASE
    5e-11  31%  2cl1A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    5e-11  31%  3c51A  [x.x.x] RHODOPSIN KINASE
    5e-11  31%  3c50B  [x.x.x] RHODOPSIN KINASE
    5e-11  31%  3c50A  [x.x.x] RHODOPSIN KINASE
    5e-11  31%  3c4zA  [x.x.x] RHODOPSIN KINASE
    5e-11  31%  3c4yB  [x.x.x] RHODOPSIN KINASE
    5e-11  31%  3c4xB  [x.x.x] RHODOPSIN KINASE
    5e-11  31%  3c4xA  [x.x.x] RHODOPSIN KINASE
    5e-11  31%  3c4wB  [x.x.x] RHODOPSIN KINASE
    5e-11  31%  3c4wA  [x.x.x] RHODOPSIN KINASE
    5e-11  28%  1bi7A  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    6e-11  27%  1qpjA  [d.144.1] LCK TYROSINE KINASE
    6e-11  27%  1qpcA  [d.144.1] LCK KINASE
    6e-11  27%  2ofuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    6e-11  27%  2jbpD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    6e-11  30%  2iw6C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-11  29%  2h96A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    6e-11  29%  2gmxB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    6e-11  29%  2gmxA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    6e-11  26%  2g2iB  [x.x.x] ABL TYROSINE KINASE
    6e-11  29%  2g01B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    6e-11  29%  2g01A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    6e-11  28%  3famB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    6e-11  33%  3e93A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-11  29%  2c3iB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    6e-11  27%  3bymA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    8e-11  23%  1zmvA  [x.x.x] MAP/MICROTUBULE AFFINITY REGULATING KINASE 2
    8e-11  27%  1qpdA  [d.144.1] LCK KINASE
    8e-11  31%  2o8yB  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    8e-11  25%  2j0jA  [x.x.x] FOCAL ADHESION KINASE 1
    8e-11  29%  3eljA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 8
    8e-11  26%  3dk6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    8e-11  27%  3cqwA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    8e-11  27%  3cquA  [x.x.x] RAC-ALPHA SERINE/THREONINE-PROTEIN KINASE
    8e-11  27%  2b9iA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-10  28%  2onlD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-10  28%  2onlC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-10  25%  2jkqA  [x.x.x] FOCAL ADHESION KINASE 1
    1e-10  27%  2jbpE  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-10  25%  2ijmB  [x.x.x] FOCAL ADHESION KINASE 1
    1e-10  25%  2ijmA  [x.x.x] FOCAL ADHESION KINASE 1
    1e-10  26%  2hznA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-10  25%  2hz4C  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-10  28%  3hyhB  [x.x.x] CARBON CATABOLITE-DEREPRESSING PROTEIN KINASE
    1e-10  29%  3hkoA  [x.x.x] CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE WITH
    1e-10  26%  1fgiA  [d.144.1] FGF RECEPTOR 1
    1e-10  27%  2fa2B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-10  27%  2fa2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-10  27%  2f49A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-10  28%  2eueB  [x.x.x] CARBON CATABOLITE DEREPRESSING PROTEIN KINASE
    1e-10  25%  2etmA  [x.x.x] FOCAL ADHESION KINASE 1
    1e-10  31%  2clxA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-10  27%  2b9hA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    1e-10  26%  3b2tA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-10  31%  2w9zB  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    1e-10  31%  2w99B  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    1e-10  28%  2w7xA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    1e-10  28%  2vd5A  [x.x.x] DMPK PROTEIN
    1e-10  27%  1ukhA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 8 ISOFORM 4
    1e-10  26%  2qohB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-10  26%  2qohA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    1e-10  32%  2qkrA  [x.x.x] CDC2-LIKE CDK2/CDC28 LIKE PROTEIN KINASE
    1e-10  22%  1p4fA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE 1
    1e-10  27%  2ozaA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-10  29%  2iw8A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-10  26%  3eqrB  [x.x.x] ACTIVATED CDC42 KINASE 1
    1e-10  22%  3ehaA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    1e-10  33%  1bmkA  [d.144.1] PROTEIN (MAP KINASE P38)
    1e-10  31%  2a4lA  [x.x.x] HOMO SAPIENS CYCLIN-DEPENDENT KINASE 2
    2e-10  24%  1y57A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-10  31%  2w96B  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    2e-10  29%  1w98A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-10  31%  2vtrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-10  24%  2srcA  [x.x.x] TYROSINE-PROTEIN KINASE SRC
    2e-10  29%  1jstA  [d.144.1] CYCLIN-DEPENDENT KINASE-2
    2e-10  29%  2jgzA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-10  29%  2hw6A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    2e-10  31%  1hckA  [d.144.1 (1pw2A)] HUMAN CYCLIN-DEPENDENT KINASE 2
    2e-10  24%  2h8hA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-10  29%  1h27C  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-10  29%  1h24A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-10  29%  2g9xA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-10  28%  3fpmA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-10  29%  1e9hA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-10  31%  2ds1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-10  29%  2cchA  [d.144.1 (1e9hC)] CELL DIVISION PROTEIN KINASE 2
    2e-10  27%  2b9fA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    2e-10  22%  2zm3B  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    2e-10  31%  2zduA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    2e-10  26%  2psqB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    2e-10  27%  2jbpB  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-10  30%  2i40A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-10  24%  3hztA  [x.x.x] CALCIUM-DEPENDENT PROTEIN KINASE 3
    2e-10  25%  2g2hA  [x.x.x] ABL TYROSINE
    2e-10  25%  2g2fA  [x.x.x] ABL KINASE
    2e-10  25%  2f4jA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-10  21%  3dgkA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    2e-10  30%  3ddqA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-10  31%  1buhA  [d.144.1] PROTEIN (CDK2 HUMAN)
    2e-10  30%  3bhtA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-10  29%  2zoqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 3
    3e-10  25%  2hziA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-10  25%  2hz0A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-10  25%  2hyyA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-10  25%  2hiwA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-10  27%  1g3nA  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    3e-10  25%  2g1tD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-10  25%  2g1tC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-10  25%  2g1tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-10  25%  2g1tA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-10  27%  2fysB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    3e-10  31%  2fvdA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-10  29%  3cy3A  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    3e-10  25%  3cs9D  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-10  30%  2c6iA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-10  30%  2c68A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-10  27%  1blxA  [d.144.1] CYCLIN-DEPENDENT KINASE 6
    3e-10  29%  3bgzA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    3e-10  34%  2balA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-10  25%  1agwB  [d.144.1] FGF RECEPTOR 1
    4e-10  24%  1y8gB  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 2
    4e-10  24%  1y8gA  [x.x.x] MAP/MICROTUBULE AFFINITY-REGULATING KINASE 2
    4e-10  27%  1xo2B  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    4e-10  31%  2w9fB  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    4e-10  28%  2pzyB  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    4e-10  25%  1opjB  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-10  25%  1opjA  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-10  25%  1m52B  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-10  25%  1m52A  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-10  25%  1iepA  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
    4e-10  31%  1h01A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-10  31%  3fv8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    4e-10  25%  1fpuA  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
    4e-10  29%  1f5qC  [d.144.1] CYCLIN DEPENDENT KINASE 2
    4e-10  30%  3eocC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-10  30%  3ej1C  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-10  30%  3ej1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-10  34%  3ds6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-10  24%  3dqwD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-10  24%  3dqwC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-10  24%  3dqwA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-10  23%  1yrpA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    5e-10  24%  1yi6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-10  30%  1v0bB  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    5e-10  28%  1tvoA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    5e-10  31%  2r3kA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-10  28%  1qcfA  [b.34.2 - d.93.1 - d.144.1] HAEMATOPOETIC CELL KINASE (HCK)
    5e-10  28%  2ojiA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    5e-10  28%  2ojgA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    5e-10  31%  1jsvA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-10  23%  1jqhB  [d.144.1] IGF-1 RECEPTOR KINASE
    5e-10  23%  1jqhA  [d.144.1] IGF-1 RECEPTOR KINASE
    5e-10  26%  2jkmA  [x.x.x] FOCAL ADHESION KINASE 1
    5e-10  31%  2iw9A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-10  24%  2hyyB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-10  28%  2hk5A  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    5e-10  31%  1h0uA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-10  25%  2gqgB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-10  25%  2gqgA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    5e-10  28%  1golA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    5e-10  30%  2eufB  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    5e-10  26%  2etmB  [x.x.x] FOCAL ADHESION KINASE 1
    5e-10  28%  3erkA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    5e-10  28%  1erkA  [x.x.x] EXTRACELLULAR REGULATED KINASE 2
    5e-10  31%  3eidA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-10  31%  1e1vA  [d.144.1] CYCLIN-DEPENDENT PROTEIN KINASE 2
    5e-10  29%  3cy2A  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    5e-10  29%  3cxwA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    5e-10  27%  3c4fA  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    5e-10  26%  1agwA  [d.144.1] FGF RECEPTOR 1
    7e-10  25%  2z60A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    7e-10  21%  1wvyA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    7e-10  21%  1wvwA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    7e-10  31%  1oirA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    7e-10  29%  2objA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-10  21%  1jktA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE
    7e-10  21%  1jkkA  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE
    7e-10  28%  2jbpF  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    7e-10  25%  2j0kA  [x.x.x] FOCAL ADHESION KINASE 1
    7e-10  21%  1ig1A  [d.144.1] DEATH-ASSOCIATED PROTEIN KINASE
    7e-10  24%  3hmiA  [x.x.x] TYROSINE-PROTEIN KINASE ABL2
    7e-10  38%  3gc9B  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    7e-10  38%  3gc9A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    7e-10  29%  1f5qA  [d.144.1] CYCLIN DEPENDENT KINASE 2
    7e-10  29%  3f2aA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-10  30%  3eidC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-10  22%  3eh9A  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    7e-10  23%  3dxnA  [x.x.x] CALMODULIN-LIKE DOMAIN PROTEIN KINASE ISOFORM 3
    7e-10  21%  3dfcB  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 1
    7e-10  29%  3dcvA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    7e-10  35%  1cm8A  [d.144.1] PHOSPHORYLATED MAP KINASE P38-GAMMA
    7e-10  29%  2bikB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    9e-10  32%  2vtiA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-10  27%  1ungA  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    9e-10  31%  1ukiA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 8 ISOFORM 4
    9e-10  28%  1pmeA  [x.x.x] ERK2
    9e-10  32%  1oitA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    9e-10  23%  1kobA  [d.144.1] TWITCHIN
    9e-10  32%  1jvpP  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    9e-10  26%  2jkkA  [x.x.x] FOCAL ADHESION KINASE 1
    9e-10  25%  2j0mB  [x.x.x] FOCAL ADHESION KINASE 1
    9e-10  26%  2j0kB  [x.x.x] FOCAL ADHESION KINASE 1
    9e-10  31%  2iw6A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    9e-10  25%  2hyyD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    9e-10  22%  3f5pB  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    9e-10  27%  2erkA  [x.x.x] EXTRACELLULAR SIGNAL-REGULATED KINASE 2
    9e-10  28%  3eqrA  [x.x.x] ACTIVATED CDC42 KINASE 1
    9e-10  26%  3dqxB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-10  25%  3dk6B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    9e-10  32%  2bakA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-09  29%  1ywvA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-09  29%  1xwsA  [d.144.1] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-09  29%  1xqzA  [d.144.1] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-09  31%  2wajA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-09  31%  2r3jA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-09  31%  2r3hA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-09  23%  1kswA  [b.34.2 - d.93.1 - d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN
    1e-09  26%  2jbpH  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-09  28%  2jboA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-09  28%  2javA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE NEK2
    1e-09  29%  2j2iB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-09  30%  3g9nA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    1e-09  30%  3g33A  [x.x.x] CELL DIVISION PROTEIN KINASE 4
    1e-09  25%  3f6xD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-09  26%  3f6xC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-09  26%  3f6xA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-09  21%  3f5pS  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    1e-09  21%  3f5pI  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    1e-09  22%  3f5pA  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    1e-09  28%  3eqpA  [x.x.x] ACTIVATED CDC42 KINASE 1
    1e-09  28%  3eqpB  [x.x.x] ACTIVATED CDC42 KINASE 1
    1e-09  24%  2dq7X  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FYN
    1e-09  22%  3d94A  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR BETA CHAIN
    1e-09  29%  3c4eC  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    1e-09  29%  2bzhB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    1e-09  29%  2bilB  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    2e-09  29%  1yhsA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    2e-09  28%  2w0jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    2e-09  30%  2r9sA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    2e-09  33%  1r39A  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-09  26%  1mryA  [d.144.1] RAC-BETA SERINE/THREONINE KINASE
    2e-09  33%  1iasB  [d.144.1] TGF-BETA RECEPTOR TYPE I
    2e-09  27%  2hakH  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    2e-09  27%  2hakB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE MARK1
    2e-09  29%  1h4lA  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    2e-09  30%  1h0vA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-09  30%  3g90X  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    2e-09  26%  2fgiA  [d.144.1] PROTEIN (FIBROBLAST GROWTH FACTOR (FGF) RECEPTOR
    2e-09  22%  3f5pE  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    2e-09  28%  2e14A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    2e-09  31%  2duvA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-09  31%  2c5yA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-09  22%  2zm3A  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    2e-09  28%  1yxsA  [x.x.x] PROTO-ONCOGENE SERINE/THREONINE-PROTEIN KINASE
    2e-09  28%  2wntB  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE
    2e-09  29%  2wipC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-09  29%  2wipA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-09  32%  2uznA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-09  31%  2r3lA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-09  28%  2pzyC  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-09  26%  2pwlA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    2e-09  30%  1oi9A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-09  21%  1k3aA  [d.144.1] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    2e-09  27%  2jbpI  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-09  25%  2i0eB  [x.x.x] PROTEIN KINASE C-BETA II
    2e-09  25%  2i0eA  [x.x.x] PROTEIN KINASE C-BETA II
    2e-09  24%  2hziB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-09  27%  3hngA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 1
    2e-09  31%  1h08A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-09  25%  1gjoA  [d.144.1] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    2e-09  34%  3gcuA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-09  31%  3fz1A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-09  21%  3f5pM  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    2e-09  22%  3f5pC  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    2e-09  28%  3dtcA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE 9
    2e-09  30%  3dogA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-09  23%  3dk3B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-09  23%  3dk3A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-09  24%  3cs9A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-09  23%  3bqrA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    3e-09  31%  2w06A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-09  32%  2vtsA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-09  31%  2vtpA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-09  24%  2v7aB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  24%  2v7aA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    3e-09  27%  1u4dA  [d.144.1] ACTIVATED CDC42 KINASE 1
    3e-09  33%  2pmiC  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    3e-09  33%  2pmiA  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    3e-09  33%  2ozaB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  30%  1oiyA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-09  30%  1oguA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-09  22%  1m7nA  [d.144.1] INSULIN-LIKE GROWTH FACTOR I RECEPTOR
    3e-09  26%  2jkoA  [x.x.x] FOCAL ADHESION KINASE 1
    3e-09  34%  3hrbA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  27%  2gphA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    3e-09  27%  2f9gA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE FUS3
    3e-09  35%  2dylA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    3e-09  31%  1di8A  [d.144.1] CYCLIN-DEPENDENT KINASE 2
    3e-09  31%  3da6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-09  29%  2cjmC  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-09  34%  3bv3A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  31%  2b52A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-09  34%  2zazA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  32%  1wccA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-09  31%  2r3nA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    3e-09  26%  2pwlB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    3e-09  34%  2okrA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  33%  1lezA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  33%  1giiA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-09  31%  2excX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-09  34%  2ewaA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-09  24%  3d5xA  [x.x.x] POLO-LIKE KINASE 1
    3e-09  25%  3bz3A  [x.x.x] FOCAL ADHESION KINASE 1
    3e-09  27%  3byuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    3e-09  34%  3bv2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-09  20%  2zm3D  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    5e-09  29%  1unhA  [d.144.1] CYCLIN-DEPENDENT KINASE 5
    5e-09  28%  2pzyD  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    5e-09  25%  2pzpA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    5e-09  26%  2pvfA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    5e-09  31%  1h07A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-09  27%  1gzkA  [d.144.1] RAC-BETA SERINE/THREONINE PROTEIN KINASE
    6e-09  32%  2vthA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    6e-09  27%  2pzyA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    6e-09  22%  1p4oB  [d.144.1] INSULIN-LIKE GROWTH FACTOR I RECEPTOR PROTEIN
    6e-09  22%  1p4oA  [d.144.1] INSULIN-LIKE GROWTH FACTOR I RECEPTOR PROTEIN
    6e-09  22%  2oj9A  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR PRECURSOR
    6e-09  25%  2oiqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-09  29%  2ofvB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    6e-09  31%  2o2uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    6e-09  32%  1gijA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    6e-09  33%  3gcpA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-09  28%  3gc0A  [x.x.x] KINASE, CMGC CDK
    6e-09  25%  3g6hA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-09  24%  3fy2A  [x.x.x] EPHRIN TYPE-A RECEPTOR 3
    6e-09  31%  1fvtA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    8e-09  34%  1zz2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-09  31%  1vyzA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    8e-09  31%  2vtoA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    8e-09  25%  2pzpB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    8e-09  31%  2ok1A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    8e-09  33%  1lewA  [d.144.1] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-09  28%  1jsuA  [d.144.1] CYCLIN-DEPENDENT KINASE-2
    8e-09  26%  2i0yA  [x.x.x] CFMS TYROSINE KINASE
    8e-09  26%  2i0vA  [x.x.x] CFMS TYROSINE KINASE
    8e-09  34%  3hp2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-09  34%  3hllA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-09  34%  3hl7A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-09  27%  3gqlC  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    8e-09  32%  2ghlA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-09  30%  3fbvI  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    8e-09  30%  3fbvD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    8e-09  30%  3fbvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    8e-09  26%  3clyA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    8e-09  27%  3c9wA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    8e-09  34%  3c5uA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    8e-09  24%  3bhyA  [x.x.x] DEATH-ASSOCIATED PROTEIN KINASE 3
    8e-09  24%  2bdfB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    8e-09  25%  3b2tB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-08  31%  2vv9A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-08  31%  1v1kA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-08  26%  2psqA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-08  27%  1ny3A  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    1e-08  32%  1ke6A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-08  32%  2gfsA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  30%  3gbzA  [x.x.x] KINASE, CMGC CDK
    1e-08  25%  3g6gB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  32%  1ckpA  [d.144.1] PROTEIN (CYCLIN-DEPENDENT PROTEIN KINASE 2)
    1e-08  31%  2cjmA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-08  31%  2btrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-08  30%  3blhA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    1e-08  33%  1ywrA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  30%  1y91A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-08  28%  1u46A  [d.144.1] ACTIVATED CDC42 KINASE 1
    1e-08  38%  2qkwB  [x.x.x] PROTEIN KINASE
    1e-08  25%  2pzrB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-08  25%  2pzrA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-08  25%  2pz5B  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-08  25%  2pz5A  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    1e-08  29%  2pk9A  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    1e-08  35%  2onlA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  35%  2okrD  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  26%  2oiqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  28%  2og8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    1e-08  31%  3ig7A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-08  27%  3gqlB  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    1e-08  31%  1gihA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-08  25%  3d7tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-08  35%  3bx5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-08  24%  2acxB  [x.x.x] G PROTEIN-COUPLED RECEPTOR KINASE 6
    1e-08  26%  2acxA  [x.x.x] G PROTEIN-COUPLED RECEPTOR KINASE 6
    2e-08  30%  2wntA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE
    2e-08  32%  2w05A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-08  31%  2vu3A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-08  29%  1ungB  [d.144.1] CELL DIVISION PROTEIN KINASE 5
    2e-08  28%  2ofvA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    2e-08  26%  2jbpG  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-08  26%  2jbpA  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-08  38%  3hgkC  [x.x.x] PROTEIN KINASE
    2e-08  38%  3hgkB  [x.x.x] PROTEIN KINASE
    2e-08  38%  3hgkA  [x.x.x] PROTEIN KINASE
    2e-08  34%  3ha8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  31%  1h0wA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-08  25%  3geqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-08  29%  3g9lX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    2e-08  25%  3en4B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-08  33%  3ctqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  24%  2bdjA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-08  24%  2bdfA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-08  29%  1zycD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    2e-08  33%  1yw2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  33%  1wfcA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE P38
    2e-08  31%  2vtjA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-08  31%  2qd9A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  25%  2pvyD  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    2e-08  26%  2hyyC  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-08  33%  3hmmA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    2e-08  33%  2gtnA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  33%  3gcvA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  34%  3g2fA  [x.x.x] BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE-2
    2e-08  25%  3el8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-08  23%  3dk7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-08  23%  3dk7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-08  33%  3cg2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-08  31%  2b1pA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    3e-08  21%  2zm3C  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    3e-08  27%  2z7lA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 1
    3e-08  27%  1x8bA  [x.x.x] WEE1-LIKE PROTEIN KINASE
    3e-08  23%  2r2pA  [x.x.x] EPHRIN TYPE-A RECEPTOR 5
    3e-08  26%  2qr7A  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-3
    3e-08  28%  2og8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    3e-08  25%  1mp8A  [d.144.1] FOCAL ADHESION KINASE 1
    3e-08  26%  1k9aE  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    3e-08  26%  1k9aD  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    3e-08  27%  1k9aA  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    3e-08  35%  3gxlA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    3e-08  25%  3gvuA  [x.x.x] TYROSINE-PROTEIN KINASE ABL2
    3e-08  26%  3gqlA  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    3e-08  33%  2ghmA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-08  34%  3gcqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-08  26%  3g6gA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-08  21%  3f5pD  [x.x.x] INSULIN-LIKE GROWTH FACTOR 1 RECEPTOR
    3e-08  28%  3bysA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK
    3e-08  27%  3bi6A  [x.x.x] WEE1-LIKE PROTEIN KINASE
    3e-08  32%  1aq1A  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE 2
    4e-08  29%  1zydB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    4e-08  33%  2zb1A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-08  31%  2vtnA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-08  25%  2ptkA  [x.x.x] TYROSINE-PROTEIN KINASE TRANSFORMING PROTEIN SRC
    4e-08  29%  1ob3B  [d.144.1] CELL DIVISION CONTROL PROTEIN 2 HOMOLOG
    4e-08  31%  2j9mA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    4e-08  29%  2iwiB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PIM-2
    4e-08  27%  3gqiA  [x.x.x] BASIC FIBROBLAST GROWTH FACTOR RECEPTOR 1
    4e-08  31%  1g5sA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-08  27%  1fpuB  [d.144.1] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL
    4e-08  30%  3fi2A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    4e-08  25%  3en5B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    4e-08  27%  2e2bB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-08  26%  2e2bA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-08  30%  1ad5A  [b.34.2 - d.93.1 - d.144.1] HAEMATOPOETIC CELL KINASE HCK
    5e-08  29%  1zycA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    5e-08  30%  2vtqA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    5e-08  25%  2q0bA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    5e-08  25%  2py3B  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    5e-08  25%  2pvyA  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    5e-08  32%  1kv1A  [d.144.1] P38 MAP KINASE
    5e-08  25%  3geqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    5e-08  24%  3fxxA  [x.x.x] EPHRIN TYPE-A RECEPTOR 3
    5e-08  29%  3blrA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    7e-08  25%  2z2wA  [x.x.x] WEE1-LIKE PROTEIN KINASE
    7e-08  28%  1q41B  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-08  28%  1q41A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-08  28%  1q3dA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-08  25%  2q0bB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    7e-08  25%  2py3A  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    7e-08  25%  1lufA  [d.144.1] MUSCLE-SPECIFIC TYROSINE KINASE RECEPTOR MUSK
    7e-08  29%  1i09A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-08  24%  3f3vB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-08  24%  3f3tA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-08  31%  3ezvA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  23%  3etaA  [x.x.x] INSULIN RECEPTOR, KINASE DOMAIN
    7e-08  28%  3du8A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-08  29%  2c0tB  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    7e-08  29%  2c0tA  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    7e-08  29%  2c0iA  [x.x.x] TYROSINE-PROTEIN KINASE HCK
    7e-08  30%  2btsA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    7e-08  29%  3blqA  [x.x.x] CELL DIVISION PROTEIN KINASE 9
    9e-08  25%  2vwxA  [x.x.x] EPHRIN TYPE-B RECEPTOR 4
    9e-08  29%  2rioB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    9e-08  24%  2qokA  [x.x.x] EPHRIN RECEPTOR
    9e-08  33%  2pv8A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-08  26%  1k9aB  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    9e-08  25%  1fmkA  [x.x.x] TYROSINE-PROTEIN KINASE SRC
    9e-08  25%  3en4A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-08  29%  3e7oB  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 9
    9e-08  26%  3d7uA  [x.x.x] TYROSINE-PROTEIN KINASE CSK
    9e-08  25%  3cblA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FES/FPS
    9e-08  25%  3bkbA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FES/FPS
    1e-07  29%  1zycC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    1e-07  29%  1zycB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    1e-07  34%  2vx3C  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    1e-07  34%  2vx3B  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    1e-07  31%  2vttA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    1e-07  33%  1vjyA  [d.144.1] TGF-BETA RECEPTOR TYPE I
    1e-07  28%  2rioA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE/ENDORIBONUCLEASE
    1e-07  31%  1r78A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    1e-07  23%  2qocA  [x.x.x] EPHRIN RECEPTOR
    1e-07  25%  1jpaB  [d.144.1] NEURAL KINASE, NUK=EPH/ELK/ECK FAMILY RECEPTOR-
    1e-07  29%  1jowB  [d.144.1] CELL DIVISION PROTEIN KINASE 6
    1e-07  31%  2iwiA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PIM-2
    1e-07  31%  2hw7A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE-PROTEIN
    1e-07  32%  3gcsA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    1e-07  33%  3faaA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    1e-07  34%  2wo6B  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    1e-07  25%  2reiA  [x.x.x] EPHRIN TYPE-A RECEPTOR 7
    1e-07  31%  2o8yA  [x.x.x] INTERLEUKIN-1 RECEPTOR-ASSOCIATED KINASE 4
    1e-07  26%  1k9aF  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    1e-07  29%  3f88A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    1e-07  29%  3f7zB  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    1e-07  31%  2f2cB  [x.x.x] CELL DIVISION PROTEIN KINASE 6
    1e-07  32%  2bujB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 16
    1e-07  31%  2ac5A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    1e-07  28%  2a19B  [x.x.x] INTERFERON-INDUCED, DOUBLE-STRANDED RNA-
    2e-07  23%  2z8cA  [x.x.x] INSULIN RECEPTOR
    2e-07  32%  2w17A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-07  34%  2vx3D  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    2e-07  28%  1u4dB  [d.144.1] ACTIVATED CDC42 KINASE 1
    2e-07  25%  2ogvA  [x.x.x] MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR
    2e-07  26%  1mrvA  [d.144.1] RAC-BETA SERINE/THREONINE KINASE
    2e-07  26%  1k9aC  [b.34.2 - d.93.1 - d.144.1] CARBOXYL-TERMINAL SRC KINASE
    2e-07  23%  1ir3A  [d.144.1] INSULIN RECEPTOR
    2e-07  24%  3g6hB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  34%  3g2fB  [x.x.x] BONE MORPHOGENETIC PROTEIN RECEPTOR TYPE-2
    2e-07  25%  3f6xB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  25%  3f3uB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  26%  3el8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  25%  3d7uD  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  25%  3d7uB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-07  28%  3cs9B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    2e-07  33%  2wouA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    2e-07  33%  2wotA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    2e-07  34%  2wo6A  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    2e-07  31%  1urwA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    2e-07  34%  2rg6A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-07  33%  1py5A  [d.144.1] TGF-BETA RECEPTOR TYPE I
    2e-07  33%  1iasA  [d.144.1] TGF-BETA RECEPTOR TYPE I
    2e-07  27%  3h9rA  [x.x.x] ACTIVIN RECEPTOR TYPE-1
    2e-07  28%  2cn8A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK2
    2e-07  29%  2bujA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE 16
    2e-07  31%  2bheA  [d.144.1 (1dm2A)] CELL DIVISION PROTEIN KINASE 2
    2e-07  33%  1b6cB  [d.144.1] TGF-B SUPERFAMILY RECEPTOR TYPE I
    2e-07  31%  2b55A  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-07  31%  2ac3A  [x.x.x] MAP KINASE-INTERACTING SERINE/THREONINE KINASE 2
    3e-07  29%  1zydA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    3e-07  25%  2z7qA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    3e-07  33%  2vx3A  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    3e-07  27%  1u54B  [d.144.1] ACTIVATED CDC42 KINASE 1
    3e-07  24%  2qo9A  [x.x.x] EPHRIN RECEPTOR
    3e-07  31%  1h00A  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    3e-07  35%  3gp0A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 11
    3e-07  24%  3f3wB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-07  24%  3f3wA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-07  22%  2e9nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-07  24%  3dpkA  [x.x.x] MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR
    3e-07  27%  3cr0A  [x.x.x] WEE1-LIKE PROTEIN KINASE
    3e-07  23%  3bu3A  [d.144.1 (1rqqA)] INSULIN RECEPTOR SUBUNIT BETA
    3e-07  22%  2aypA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-07  23%  2auhA  [x.x.x] INSULIN RECEPTOR
    3e-07  27%  2a1aB  [x.x.x] INTERFERON-INDUCED, DOUBLE-STRANDED RNA-
    4e-07  26%  2z7rA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    4e-07  23%  2vx0A  [x.x.x] EPHRIN TYPE-B RECEPTOR 4
    4e-07  25%  1u59A  [d.144.1] TYROSINE-PROTEIN KINASE ZAP-70
    4e-07  28%  1r0eA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    4e-07  28%  1q3dB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    4e-07  28%  1pyxB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    4e-07  28%  1pyxA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    4e-07  25%  2pvyC  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    4e-07  38%  2pk9C  [x.x.x] CYCLIN-DEPENDENT PROTEIN KINASE PHO85
    4e-07  30%  2p5aA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-07  34%  3hp5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    4e-07  30%  3fi3A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 10
    4e-07  28%  3cs9C  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    4e-07  24%  3cd3A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE FES/FPS
    6e-07  23%  1yomB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-07  22%  1t46A  [d.144.1] HOMO SAPIENS V-KIT HARDY-ZUCKERMAN 4 FELINE
    6e-07  23%  2qo2A  [x.x.x] EPHRIN RECEPTOR
    6e-07  26%  2qlqB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    6e-07  28%  1q5kA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    6e-07  28%  1q3wA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    6e-07  32%  1kv2A  [d.144.1] P38 MAP KINASE
    6e-07  23%  1irkA  [x.x.x] INSULIN RECEPTOR TYROSINE KINASE DOMAIN
    6e-07  25%  2hz0B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE ABL1
    6e-07  24%  2gsfA  [x.x.x] EPHRIN TYPE-A RECEPTOR 3
    6e-07  24%  3dzqA  [x.x.x] EPH RECEPTOR A3
    6e-07  29%  2bzkB  [x.x.x] PROTO-ONCOGENE SERINE THREONINE PROTEIN KINASE
    6e-07  25%  1bygA  [d.144.1] PROTEIN (C-TERMINAL SRC KINASE)
    6e-07  24%  3beaA  [x.x.x] MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR
    7e-07  22%  1zysA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    7e-07  25%  2zv9A  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    7e-07  24%  2z7sA  [x.x.x] RIBOSOMAL PROTEIN S6 KINASE ALPHA-1
    7e-07  23%  1ym7D  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    7e-07  23%  1ym7C  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    7e-07  23%  1ym7A  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    7e-07  28%  1q4lB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-07  28%  1q4lA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-07  28%  1q3wB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    7e-07  33%  2puuA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    7e-07  30%  1p2aA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    7e-07  23%  1omwA  [a.91.1 - d.144.1 - b.55.1] G-PROTEIN COUPLED RECEPTOR KINASE
    7e-07  26%  2in6A  [x.x.x] WEE1-LIKE PROTEIN KINASE
    7e-07  29%  3gxjA  [x.x.x] TGF-BETA RECEPTOR TYPE-1
    7e-07  23%  3cikA  [x.x.x] BETA-ADRENERGIC RECEPTOR KINASE 1
    7e-07  22%  2c3lA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    7e-07  23%  2brmA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    7e-07  23%  2bcjA  [x.x.x] G-PROTEIN COUPLED RECEPTOR KINASE 2
    9e-07  25%  1yomA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-07  35%  2rg5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    9e-07  26%  2qi8A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-07  25%  2pvyB  [x.x.x] FIBROBLAST GROWTH FACTOR RECEPTOR 2
    9e-07  23%  1pkgA  [d.144.1] C-KIT PROTEIN
    9e-07  32%  2jbpK  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    9e-07  28%  2io6A  [x.x.x] WEE1-LIKE PROTEIN KINASE
    9e-07  22%  1ia8A  [d.144.1] CHK1 CHECKPOINT KINASE
    9e-07  28%  3bizA  [x.x.x] WEE1-LIKE PROTEIN KINASE
    1e-06  28%  1uv5A  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    1e-06  26%  1u46B  [d.144.1] ACTIVATED CDC42 KINASE 1
    1e-06  24%  1i44A  [d.144.1] INSULIN RECEPTOR
    1e-06  28%  1h8fB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    1e-06  28%  1h8fA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    1e-06  30%  2h34A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PKNE
    1e-06  26%  3g5dA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-06  24%  1u54A  [d.144.1] ACTIVATED CDC42 KINASE 1
    2e-06  26%  2r4bA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    2e-06  24%  2qooA  [x.x.x] EPHRIN RECEPTOR
    2e-06  23%  2qolA  [x.x.x] EPHRIN RECEPTOR
    2e-06  29%  2ow3A  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    2e-06  30%  1o9uA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    2e-06  28%  1kwpB  [d.144.1] MAP KINASE ACTIVATED PROTEIN KINASE 2
    2e-06  28%  2jldA  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    2e-06  27%  2jbpL  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-06  26%  2i1mA  [x.x.x] MACROPHAGE COLONY-STIMULATING FACTOR 1 RECEPTOR
    2e-06  22%  2gdoA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  25%  3g5dB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-06  29%  3f7zA  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    2e-06  28%  3ezrA  [x.x.x] CELL DIVISION PROTEIN KINASE 2
    2e-06  32%  1zyjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  23%  1t45A  [d.144.1] HOMO SAPIENS V-KIT HARDY-ZUCKERMAN 4 FELINE
    2e-06  24%  2qoiA  [x.x.x] EPHRIN RECEPTOR
    2e-06  24%  2qofA  [x.x.x] EPHRIN RECEPTOR
    2e-06  24%  2qodA  [x.x.x] EPHRIN RECEPTOR
    2e-06  33%  2ptjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  32%  2npqA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  23%  3g0fB  [x.x.x] MAST/STEM CELL GROWTH FACTOR RECEPTOR
    2e-06  23%  3g0fA  [x.x.x] MAST/STEM CELL GROWTH FACTOR RECEPTOR
    2e-06  23%  3g0eA  [x.x.x] MAST/STEM CELL GROWTH FACTOR RECEPTOR
    2e-06  33%  3fc1X  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-06  23%  3etaB  [x.x.x] INSULIN RECEPTOR, KINASE DOMAIN
    2e-06  23%  3dkoA  [x.x.x] EPHRIN TYPE-A RECEPTOR 7
    2e-06  23%  2cgxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  23%  2cgvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  23%  2cguA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  23%  2c3kA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-06  23%  2brnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  28%  1q5kB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-06  28%  2o5kA  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-06  22%  1nvrA  [d.144.1] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  28%  2jldB  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-06  24%  2j5eA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-06  28%  1j1bB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-06  28%  1j1bA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-06  28%  1i09B  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    3e-06  22%  2hogA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    3e-06  35%  2fsoX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-06  31%  2fslX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-06  25%  3f3tB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-06  23%  3eknA  [x.x.x] INSULIN RECEPTOR
    3e-06  27%  3eb0A  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    3e-06  26%  3d7tA  [x.x.x] TYROSINE-PROTEIN KINASE CSK
    3e-06  24%  2c3jA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  27%  3eb0C  [x.x.x] PUTATIVE UNCHARACTERIZED PROTEIN
    4e-06  24%  2cgwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-06  22%  3bceB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    5e-06  24%  2r4bB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    5e-06  31%  2ptoA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    5e-06  28%  2p3gX  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    5e-06  26%  2itxA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-06  24%  3e63A  [x.x.x] TYROSINE-PROTEIN KINASE JAK2
    5e-06  24%  3e62A  [x.x.x] TYROSINE-PROTEIN KINASE JAK2
    6e-06  29%  1zy4B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    6e-06  26%  1xkkA  [d.144.1] EPIDERMAL GROWTH FACTOR RECEPTOR
    6e-06  23%  2vwvA  [x.x.x] EPHRIN TYPE-B RECEPTOR 4
    6e-06  33%  2pkjA  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-06  29%  2ow3B  [x.x.x] GLYCOGEN SYNTHASE KINASE-3 BETA
    6e-06  24%  2gs6A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    6e-06  29%  1gngB  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    6e-06  29%  1gngA  [d.144.1] GLYCOGEN SYNTHASE KINASE-3 BETA
    6e-06  31%  2fsmX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    6e-06  30%  3enmB  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    8e-06  28%  1zy4A  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    8e-06  21%  1mqbA  [d.144.1] EPHRIN TYPE-A RECEPTOR 2
    8e-06  24%  1m17A  [d.144.1] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-06  24%  1m14A  [d.144.1] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-06  25%  1jpaA  [d.144.1] NEURAL KINASE, NUK=EPH/ELK/ECK FAMILY RECEPTOR-
    8e-06  24%  2j6mA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-06  24%  2itwA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-06  24%  2helA  [x.x.x] EPH RECEPTOR A4
    8e-06  24%  2gs2A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    8e-06  24%  3gniB  [x.x.x] STRAD ALPHA
    8e-06  29%  3enmD  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    8e-06  30%  3enmC  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    8e-06  29%  3enmA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    8e-06  22%  3bceA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    8e-06  26%  2b7aB  [x.x.x] TYROSINE-PROTEIN KINASE JAK2
    8e-06  26%  2b7aA  [x.x.x] TYROSINE-PROTEIN KINASE JAK2
    1e-05  23%  2vwwA  [x.x.x] EPHRIN TYPE-B RECEPTOR 4
    1e-05  23%  1rjbA  [d.144.1] FL CYTOKINE RECEPTOR
    1e-05  26%  2rgpA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    1e-05  28%  2qluA  [x.x.x] ACTIVIN RECEPTOR TYPE IIB
    1e-05  23%  2brhA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    1e-05  27%  2rf9B  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    1e-05  24%  2rf9A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    1e-05  24%  2j5fA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    1e-05  23%  2gs7A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    1e-05  24%  3el7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    1e-05  24%  3ekkA  [x.x.x] INSULIN RECEPTOR
    2e-05  29%  1zy5B  [x.x.x] SERINE/THREONINE-PROTEIN KINASE GCN2
    2e-05  25%  2zv7A  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    2e-05  27%  1z57A  [x.x.x] DUAL SPECIFICITY PROTEIN KINASE CLK1
    2e-05  25%  1yolB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-05  25%  1yolA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-05  26%  2qq7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-05  32%  1nxkB  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    2e-05  23%  1mqbB  [d.144.1] EPHRIN TYPE-A RECEPTOR 2
    2e-05  24%  2gs7B  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-05  24%  2rfeA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-05  25%  2qi8B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-05  23%  2jiuB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-05  23%  2jiuA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-05  23%  2jitB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-05  23%  2jitA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-05  24%  3gt8C  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-05  34%  2fstX  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    2e-05  25%  3belA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    3e-05  24%  2zvaA  [x.x.x] TYROSINE-PROTEIN KINASE LYN
    3e-05  24%  2qobA  [x.x.x] EPHRIN RECEPTOR
    3e-05  34%  2pv5A  [x.x.x] MITOGEN-ACTIVATED PROTEIN KINASE 14
    3e-05  21%  2ivtA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    3e-05  26%  3en7A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-05  22%  3bu5A  [x.x.x] INSULIN RECEPTOR SUBUNIT BETA
    3e-05  24%  3bceC  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    4e-05  20%  2wmvA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-05  20%  2qhnA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-05  30%  1oiqA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    4e-05  25%  2ityA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-05  24%  2itqA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    4e-05  24%  2itpA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR PRECURSOR
    4e-05  24%  2henA  [x.x.x] EPHRIN TYPE-B RECEPTOR 2
    4e-05  20%  3f9nA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    5e-05  27%  1ua2A  [d.144.1] CELL DIVISION PROTEIN KINASE 7
    5e-05  27%  1t4hA  [d.144.1] SERINE/THREONINE-PROTEIN KINASE WNK1
    5e-05  24%  2rfeD  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-05  25%  2rfeB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-05  24%  2rfdB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-05  24%  2rfdA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-05  25%  2qonA  [x.x.x] EPHRIN RECEPTOR
    5e-05  23%  2qo7A  [x.x.x] EPHRIN RECEPTOR
    5e-05  30%  1pyeA  [d.144.1] CELL DIVISION PROTEIN KINASE 2
    5e-05  34%  1nxkD  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    5e-05  32%  1nxkC  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    5e-05  28%  1kwpA  [d.144.1] MAP KINASE ACTIVATED PROTEIN KINASE 2
    5e-05  24%  2itvA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-05  24%  2ittA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-05  24%  3gt8D  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-05  24%  3gt8B  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-05  24%  3gt8A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    5e-05  24%  3fzoA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    5e-05  27%  3fpqB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE WNK1
    5e-05  27%  3fpqA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE WNK1
    5e-05  31%  1ckiB  [d.144.1] CASEIN KINASE I DELTA
    5e-05  31%  1ckiA  [d.144.1] CASEIN KINASE I DELTA
    7e-05  22%  1xbbA  [d.144.1] TYROSINE-PROTEIN KINASE SYK
    7e-05  20%  2r0uA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    7e-05  23%  1pkgB  [d.144.1] C-KIT PROTEIN
    7e-05  24%  2itoA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    7e-05  24%  2itnA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    7e-05  26%  3en7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-05  26%  2rfeC  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-05  27%  2qlqA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-05  34%  1nxkA  [d.144.1] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    9e-05  24%  2jivB  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-05  24%  2jivA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-05  24%  2hwpB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-05  24%  3en6A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-05  24%  3en5A  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    9e-05  25%  2eb2A  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    9e-05  32%  1ckjB  [d.144.1] RECOMBINANT CASEIN KINASE I DELTA
    9e-05  32%  1ckjA  [d.144.1] RECOMBINANT CASEIN KINASE I DELTA
    9e-05  25%  3bbtD  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    1e-04  40%  1zxeD  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    1e-04  23%  2wmrA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    2e-04  31%  1zxeC  [x.x.x] SERINE/THREONINE-PROTEIN KINASE
    2e-04  23%  2qoqA  [x.x.x] EPHRIN RECEPTOR
    2e-04  25%  2itzA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-04  25%  2ituA  [x.x.x] EPIDERMAL GROWTH FACTOR RECEPTOR
    2e-04  23%  3fqeA  [x.x.x] TYROSINE-PROTEIN KINASE SYK
    2e-04  26%  2qq7B  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-04  32%  3k2lA  [x.x.x] DUAL SPECIFICITY TYROSINE-PHOSPHORYLATION-
    2e-04  24%  2ivuA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    2e-04  26%  2hwoB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-04  24%  2hwoA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    2e-04  32%  3e3pB  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    2e-04  32%  3e3pA  [x.x.x] PROTEIN KINASE, PUTATIVE GLYCOGEN SYNTHASE
    2e-04  25%  3cc6A  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    2e-04  29%  2c47D  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    3e-04  25%  1yojB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-04  25%  1t53A  [x.x.x] ATRIAL NATRIURETIC PEPTIDE RECEPTOR A
    3e-04  30%  2jbpJ  [x.x.x] MAP KINASE-ACTIVATED PROTEIN KINASE 2
    3e-04  24%  2hwpA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    3e-04  37%  3fmeA  [x.x.x] DUAL SPECIFICITY MITOGEN-ACTIVATED PROTEIN
    3e-04  26%  3ewhA  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    3e-04  29%  2c47C  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    3e-04  23%  3bbwA  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    3e-04  23%  3bbwB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    3e-04  23%  3bbtB  [x.x.x] RECEPTOR TYROSINE-PROTEIN KINASE ERBB-4
    4e-04  20%  3jvrA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    4e-04  25%  3fzpA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    4e-04  25%  3et7A  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    6e-04  21%  2wmxA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    6e-04  21%  2wmwA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    6e-04  21%  2wmtA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    6e-04  25%  3fzsA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    6e-04  22%  3cokA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK4
    7e-04  24%  1yojA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE SRC
    7e-04  27%  2wmuA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    7e-04  27%  2wmsA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    7e-04  27%  2wmqA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    7e-04  27%  3jvsA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    7e-04  23%  2ivvA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    7e-04  23%  2ivsB  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    7e-04  21%  2ivsA  [x.x.x] PROTO-ONCOGENE TYROSINE-PROTEIN KINASE RECEPTOR
    7e-04  25%  3fztA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    7e-04  29%  2c47B  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    7e-04  29%  2c47A  [x.x.x] CASEIN KINASE 1 GAMMA 2 ISOFORM
    7e-04  27%  2brgA  [x.x.x] SERINE/THREONINE-PROTEIN KINASE CHK1
    0.001  23%  1xbcA  [d.144.1] TYROSINE-PROTEIN KINASE SYK
    0.001  24%  2oh4A  [x.x.x] VASCULAR ENDOTHELIAL GROWTH FACTOR RECEPTOR 2
    0.001  23%  2jedB  [x.x.x] PROTEIN KINASE C THETA
    0.001  23%  2jedA  [x.x.x] PROTEIN KINASE C THETA
    0.001  25%  3h3cA  [x.x.x] PROTEIN TYROSINE KINASE 2 BETA
    0.001  22%  3cokB  [x.x.x] SERINE/THREONINE-PROTEIN KINASE PLK4
:603

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAMAAGFPDGEELPEYIGPYKIRRRIGQGGMGVVYQAVDPQDRLVAVKVLRAEVAGDDIARARLAREVMT
3f69B           -------------------YELGEILGFGGMSEVHLARDLRDRDVAVKVLRADLARDPSFYLRFRREAQN
3f69A           -------------------YELGEILGFGGMSEVHLARDLRDRDVAVKVLRADLARDPSFYLRFRREAQN
2fumB           -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
2fumA           -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
1mruB           -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
1mruA           -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
2fumD           -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
1o6yA           -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
3f61A           -------------------YELGEILGFGGMSEVHLARDLRDRDVAVKVLRADLARDPSFYLRFRREAQN
1yhwA           ------------------------KIGQGASGTVYTAMDATGQEVAIRQMNLQ---QQPKKELIINEILV
2j4zB           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2j4zA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
1f3mC           ------------------------KIGQGASGTVYTAMDATGQEVAIRQMNLQ---QQPKKELIINEILV
1yhvA           ------------------------KIGQGASGTVYTAMDATGQEVAIRQMNLQ---QQPKKELIINEILV
3fxzA           ------------------------KIGQGASGTVYTAMDATGQEVAIRQMNLQ---QQPKKELIINEILV
1mq4A           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3e5aA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2q0nA           ------------------------KIGEGSTGIVCIAVRSSGKLVAVKKMDLR---KQQRRELLFNEVVI
2j0iA           ------------------------KIGEGSTGIVCIAVRSSGKLVAVKKMDLR---KQQRRELLFNEVVI
2fumC           -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
3h10B           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3h10A           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2cdzA           ------------------------KIGEGSTGIVCIAT-VRGKLVAVKKMDLR---KQQRRELLFNEVVI
1ol7A           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
1ol5A           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3ha6A           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2w1eA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
1f3mD           ------------------------KIGQGASGTVYTAMDATGQEVAIRQMNLQ---QQPKKELIINEILV
3ckxA           ------------------------KIGKGSFGEVFKGIDNRQKVVAIKXXXXXXXXXXXXXXXXT----V
2w1gA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2np8A           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
1muoA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2c6eA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2w1dA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3fdnA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2c30A           ------------------------KIGEGSTGIVCLAREKHSRQVAVKMMDLR---KQQRRELLFNEVVI
2w1fA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2c6dA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2bmcF           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2bmcC           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2bmcB           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2bmcA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2j50A           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3h10D           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2dwbA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3h0zA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3h0yA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3dj5A           -------------------FDIGRPLGKGKFGNVYLARERQSKFIALKVLQLEKAG---VEHQLRREVEI
3h4jB           ---------------HIGPYIIRETLGEGSFGKVKLATHYKQQKVALKFISRQLLKKSDMHMRVEREISY
2zmcA           -------------------YSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEA-DNQTLDSYRNEIAY
1u5qA           -------PDVAELFFKDDPEKLLREIGHGSFGAVYFARDVRNEVVAIKKMSYSGKQSNEKWQDIIKEVRF
3dj7A           -------------------FDIGRPLGKGKFGNVYLARERQSKFIALKVLQLEKAG---VEHQLRREVEI
3dbqA           -------------------YSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEA-DNQTLDSYRNEIAY
3d15A           -------------------FDIGRPLGKGKFGNVYLARERQSKFIALKVLQLEKAG---VEHQLRREVEI
3d14A           -------------------FDIGRPLGKGKFGNVYLARERQSKFIALKVLQLEKAG---VEHQLRREVEI
2vwiD           -------------------YELQEVIGSGATAVVQAAYAPKKEKVAIKRINLEKC--QTSMDELLKEIQA
3d2iA           -------------------FDIGRPLGKGKFGNVYLARERQSKFIALKVLQLEKAG---VEHQLRREVEI
2bvaB           -----------------------------GEGIVCIAVRSSGKLVAVKKM-------DLL---LFNEVVI
2c6eB           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3gfwA           -------------------YSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEA-DNQTLDSYRNEIAY
3dakD           -------------------YELQEVIGSGATAVVQAAYAPKKEKVAIKRINLEKC--QTSMDELLKEIQA
2bvaA           ---------------------------------------------------------------LFNEVVI
2jamB           ----------------------------------------------------------IKKSSLENEIAV
2jamA           ----------------------------------------------------------IKKSSLENEIAV
2vwiC           -------------------YELQEVIGSGATAVVQAAYAPKKEKVAIKRINLEKC--QTSMDELLKEIQA
3h4jA           ---------------HIGPYIIRETLGEGSFGKVKLATHYKQQKVALKFISRQLLKKSDMHMRVEREISY
2f57B           ------------------------KIGEGSTGIVCIATEKHTKQVAVKKMDLR---KQQRRELLFNEVVI
2f57A           ------------------------KIGEGSTGIVCIATEKHTKQVAVKKMDLR---KQQRRELLFNEVVI
2zmdA           -------------------YSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEA-DNQTLDSYRNEIAY
3h0zC           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3dakC           -------------------YELQEVIGSGATAVVQAAYAPKKEKVAIKRINLEKC--QTSMDELLKEIQA
3cohA           -------------------FEIGRPLGKGKFGNVYLAREKNSKFIALKVLQLEKAG---VEHQLRREVEI
2oibD           ------------------PISVGNKMGEGGFGVVYKGY-VNNTTVAVKKLTTEEL-----KQQFDQEIKV
3h9fA           -------------------YSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEA-DNQTLDSYRNEIAY
2qnjB           ---------GSDEQPHIGNYRLLKTIGKGNFAKVKLARHITGREVAIKIID-KTQLNPTSLQKLFREVRI
3ckwA           ----------------------------------------------------------------------
2v7oA           MATCTRFTDDYQLFEELGK----------GFSVVRRCVKPTQEYAAKIINTKKLSARD--HQKLEREARI
3cekA           -------------------YSILKQIGSGGSSKVFQVLNEKKQIYAIKYVNLEEA-DNQTLDSYRNEIAY
3ggfB           ------------------------RIGKGSFGEVFKGIDNRTQQV-VXXXXXXXXXXXXXXXXXXXXXTV
3ggfA           ------------------------RIGKGSFGEVFKGIDNRTQQV-VXXXXXXXXXXXXXXXXXXXXXTV
2bdwB           -------------------YDVKEELGKGAFSVVRRCVHKTTGLFAAKIINTKLSARDFQK--LEREARI
2bdwA           -------------------YDVKEELGKGAFSVVRRCVHKTTGLFAAKIINTKLSARDFQK--LEREARI
2vgpB           ----------------IDDFDIGRPLGKGKFGNVYLAREKQNKFIALKVLFKSQLEKEGVEHQLRREIEI
2vgoA           ----------------IDDFDIGRPLGKGKFGNVYLAREKQNKFIALKVLFKSQLEKEGVEHQLRREIEI
1ol6A           -------------------FEIGRPLGKK-FGNVYLAREKQSKFIALKVLKAQL---EKAEHQLRREVEI
2bfxA           ----------------IDDFDIGRPLGKGKFGNVYLAREKQNKFIALKVLFKSQLEKEGVEHQLRREIEI
2qnjA           ---------GSEQP-HIGNYRLLKTIGKGNFAKVKLARHITGREVAIKIID-KTQLNPTSLQKLFREVRI
2phkA           -------------------YEPKEILGRGVSSVVRRCIHPTCKEYAVKIIDVTGGGSFSAREATLKEVDI
1phkA           -------------------YEPKEILGRGVSSVVRRCIHPTCKEYAVKIIDVTGGGSFSAREATLKEVDI
2hakE           ---------------HIGNYRLQKTIGKGNFAKVKLARHVTGREVAVKIID-KTQLNPTSLQKLFREVRI
3dakA           -------------------YELQEVIGSGATAVVQAAYAPKKEKVAIKRINLEKC--QTSMDELLKEIQA
2bfyB           ----------------IDDFDIVRPLGKGKFGNVYLAREKQNKFIALKVLFKSQLEKEGVEHQLRREIEI
2bfyA           ----------------IDDFDIVRPLGKGKFGNVYLAREKQNKFIALKVLFKSQLEKEGVEHQLRREIEI
2wqeA           -------------------FEIGRPLGKGKFGNVYLAREKQRKFIALKVLQLEKAG---VEHQLRREVEI
3d2kA           -------------------FDIGRPLGKGKFGNVYLARERQSKFIALKVLQLEKAG---VEHQLRREVEI
2welA           -------------------YQLFEELGKGAFSVVRRCMKPTGQEYAAKIINTKLSARD--HQKLEREARI
2vn9A           -------------------YQLFEELGKGAFSVVRRCMKPTGQEYAAKIINTKLSARD--HQKLEREARI
1uwhA           --------DDWEIPD--GQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQA-FKNEVGV
1ql6A           -------------------YEPKEILGRGVSSVVRRCIHPTCKEYAVKIIDVTGGGSFSAREATLKEVDI
2nruB           ------------------------KMGEGGFGVVYKGY-VNNTTVAVKKLAAMV---DITTEELKQEIKV
2nruA           ------------------------KMGEGGFGVVYKGY-VNNTTVAVKKLAAMV---DITTEELKQEIKV
3efwB           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
3efwA           -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2clqA           -------------------------LGKGTYGIVYAGRDLSNQ---VRIAIKEIPERD--SQPLHEEIAL
2vz6B           -------------------YQLFEELGKGAFSVVRRCV----KVLAGQEYAAKIINTKKLSARLEREARI
3bhhD           --------------------------------------------------------------KLEREARI
3bhhC           --------------------------------------------------------------KLEREARI
3bhhB           --------------------------------------------------------------KLEREARI
3bhhA           --------------------------------------------------------------KLEREARI
3dajA           -------------------FDIGRPLGKGKFGNVYLARERQSKFIALKVLQLEKAG---VEHQLRREVEI
2nryA           ------------------------KMGEGGFGVVYKGY-VNNTTVAVKKLAAITTEE--LKQQFDQEIKV
3eqiA           -------------------------LGAGNGGVVFKVSHPSGLVMARKLIHLEIK--PAIRNQIIRELQV
3eqfA           -------------------------LGAGNGGVVFKVSHPSGLVMARKLIHLEIK--PAIRNQIIRELQV
3d4qA           --------DDWEIPD--GQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQA-FKNEVGV
2vgoB           ----------------IDDFDIGRPLGKGKFGNVYLAREKQNKFIALKVLFKSQL--EKVEHQLRREIEI
3f3zA           -------------------YTLENTIGRGSWGEVKIAVQKGTRIAAKKIPKYFVEDVD----RFKQEIEI
3hrfA           ----------------------------------------------------------------------
3fe3A           ---------------HIGNYRLLKTIGKGNFAKVKLARHITGREVAIKIID-KTQLNPTSLQKLFREVRI
2biyA           ----------------------------------------------------------------------
2vz6A           -----------QLFEELGKFSVVRRCVKVLAGQEYAA-----KIINTKKLSAR------DHQKLEREARI
2uztA           ----------------------------------------------------------------------
2oicD           ------------------------KMGEGGFGVVYKGY----------VNNTTVAVKKLLKQQFDQEIKV
2f7xE           ----------------------------------------------------------------------
1uwjA           --------DDWEIPD--GQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQA-FKNEVGV
2qg5D           -------------------YTLENTIGRGSWGEVKIAVQKGTRIAAKKIPKYFVEDVD----RFKQEIEI
2qg5B           -------------------YTLENTIGRGSWGEVKIAVQKGTRIAAKKIPKYFVEDVD----RFKQEIEI
2qg5A           -------------------YTLENTIGRGSWGEVKIAVQKGTRIAAKKIPKYFVEDVD----RFKQEIEI
2nryC           ------------------------KMGEGGFGVVYKGY----------VNNTTVAVKKLLKQQFDQEIKV
3e8nA           -------------------------LGAGNGGVVFKVSHPSGLVMARKLIHLEIK--PAIRNQIIRELQV
3dakB           -------------------YELQEVIGSGATAVVQAAYAPKKEKVAIKRINLEKC--QTSMDELLKEIQA
3h0zB           ---------------------------------VYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
2vgpA           ----------------IDDFDIGRPLGKGN---VYLAREKQNKFIALKVLFKSQLEKEGVEHQLRREIEI
2v5qA           -----------EIPEVLVDPRSRRRLGKGGFAKCFEISDADTKEVAGKIVPKSLLLKPHQREKMSMEISI
2oicA           ------------------------KMGEGGFGVVYKGY-VNNTTVAVKKLKQQ----------FDQEIKV
2nryD           ------------------------KMGEGGFGVVYKGY-VNNTTVAVKKLELKQQFD--------QEIKV
2evaA           --------------------EVEEVVGRGAFGVVCKA-KWRAKDVAIKQIESESE-----RKAFIVELRQ
2bfxB           ----------------IDDFDIGRPLGKGN---VYLAREKQNKFIALKVLFKSQLEKEGVEHQLRREIEI
1uwjB           --------DDWEIPD--GQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQA-FKNEVGV
1okyA           ----------------------------------------------------------------------
2oibC           ----------------------------GGFGVVYKGY-VNNTTVAVKKLAEEL------KQQFDQEIKV
2hakA           ---------------HIGNYRLQKTIGKGNFAKVKLARHVTGREVAVKIID-KTQLNPTSLQKLFREVRI
1a06A           -------------------YDFRDVLGTGAFSEVILAEDKRQKLVAIKCIAKE------------NEIAV
3hrcA           ----------------------------------------------------------------------
3c0iA           -------------------YELCEVIGKGPFSVVRRCINRETQQFAVKIVDVATSSPGLSTEDLKREASI
3c0hA           -------------------YELCEVIGKGPFSVVRRCINRETQQFAVKIVDVATSSPGLSTEDLKREASI
3c0gB           -------------------YELCEVIGKGPFSVVRRCINRETQQFAVKIVDVATSSPGLSTEDLKREASI
3c0gA           -------------------YELCEVIGKGPFSVVRRCINRETQQFAVKIVDVATSSPGLSTEDLKREASI
1uu7A           ----------------------------------------------------------------------
1h1wA           ----------------------------------------------------------------------
2clqB           -------------------------LGKGTYGIVYAGRDLSNQVIAIKEIPER-------SQPLHEEIAL
2rkuA           ----------KEIPEVLVDPRSRRRLGKGGFAKCFEISDADTKEVAGKIVPKSLLLKPHQREKMSMEISI
2ou7A           ----------KEIPEVLVDPRSRRRLGKGGFAKCFEISDADTKEVAGKIVPKSLLLKPHQREKMSMEISI
3fc2A           ----------KEIPEVLVDPRSRRRLGKGGFAKCFEISDADTKEVAGKIVPKSLLLKPHQREKMSMEISI
3eqcA           -------------------------LGAGNGGVVFKVSHPSGLVMARKLIHLEIK--PAIRNQIIRELQV
2vrxB           -------------------------IGRPLGGNVYLAREKQNKFIALKVLFKSQLEKEGVEHQLRREIEI
3i79A           -------------------YKGQRVLGKGSFGEVILCKDKTGQECAVKVISKRQVKQKTDKESLLREVQL
2w5bA           -------------------YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNL
2vwiB           -------------------YELQEVIGSAVVQAAYCA--PKKEKVAIKRINLEKC--QTSMDELLKEIQA
1zmwB           ---------------HIGNYRLLKTIGKGNFAKVKLARHITGKEVAVKIIDKTQLNSSSLQ-KLFREVRI
1zmwA           ---------------HIGNYRLLKTIGKGNFAKVKLARHITGKEVAVKIIDKTQLNSSSLQ-KLFREVRI
1s9jA           -------------------------LGAGNGGVVFKVSHPSGLVMARKLIHLEIK--PAIRNQIIRELQV
3daeB           ---------------HIGNYQIVKTLGEGSFGKVKLAYHTTTQKVALKIINKKV----LAQGRIEREISY
3daeA           ---------------HIGNYQIVKTLGEGSFGKVKLAYHTTTQKVALKIINKKV----LAQGRIEREISY
2yzaA           ----------------IGHYVLGDTLGVGTFGKVKIGEHQTGHKVAVKILRQKIRSLDVV-GKIKREIQN
1uu9A           ----------------------------------------------------------------------
1uu8A           ----------------------------------------------------------------------
1okzA           ----------------------------------------------------------------------
1j3hB           ----------------------------------------------------------------------
1j3hA           ----------------------------------------------------------------------
3h9oA           ----------------------------------------------------------------------
2hakD           ---------------HIGNYRLQKTIGKGNFAKVKLARHVTGREVAVKIID-KTQLNPTSLQKLFREVRI
2hakC           ---------------HIGNYRLQKTIGKGNFAKVKLARHVTGREVAVKIID-KTQLNPTSLQKLFREVRI
2fb8A           -----------EIPD--GQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQA-FKNEVGV
1zrzA           -------------------FDLLRVIGRGSYAVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHV
1z5mA           ----------------------------------------------------------------------
1xh8A           ----------------------------------------------------------------------
1xh6A           ----------------------------------------------------------------------
1uu3A           ----------------------------------------------------------------------
1stcE           ----------------------------------------------------------------------
2r7bA           ----------------------------------------------------------------------
1q8uA           ----------------------------------------------------------------------
1q8tA           ----------------------------------------------------------------------
2jfmA           -------------------WEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEEELEDYMV--EIDI
2gnlA           ----------------------------------------------------------------------
2gnjA           ----------------------------------------------------------------------
3e8eI           ----------------------------------------------------------------------
3e8cE           ----------------------------------------------------------------------
3e8cB           ----------------------------------------------------------------------
3dv3A           -------------------------LGAGNGGVVFKVSHPSGLVMARKLIHLEIK--PAIRNQIIRELQV
3dneA           ----------------------------------------------------------------------
3dndA           ----------------------------------------------------------------------
1ctpE           ----------------------------------------------------------------------
1cmkE           ----------------------------------------------------------------------
1cdkA           ----------------------------------------------------------------------
2c1aA           ----------------------------------------------------------------------
2oicC           ------------------------KMGEGGFGVVYKGY-VNNTTVAVKKLEE-------LKQQFDQEIKV
2fh9A           ---------------HIGNYQIVKTLGEGSFGKVKLAYHTTTQKVALKIINK--------KGRIEREISY
1xh7A           ----------------------------------------------------------------------
2weiA           -------------------YNIVCMLGKGSFGEVLKCKDRTQQEYAVKVIN-KASAKNKDTSTILREVEL
2r5tA           -------------------------IGKGSFGKVLLARHKAEEVFAVKVLQKKAI------------LVL
1q8wA           ----------------------------------------------------------------------
2oibB           -----------------------------GEGVVYKGY-VNNTTVAVKKLATEEL-----KQQFDQEIKV
1koaA           -------------------YDIHEELGTGAFGVVHRVTERANNFAAKFVMTPHESDKETVR----KEIQT
2j51A           -------------------WEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEEELEDYMV--EIDI
3hdnA           -------------------------IGKGSFGKVLLARHKAEEVFAVKVLQKKAI------------LVL
3hdmA           -------------------------IGKGSFGKVLLARHKAEEVFAVKVLQKKAI------------LVL
2gngA           ----------------------------------------------------------------------
2gnfA           ----------------------------------------------------------------------
3d5uA           -------PDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVAGKVVPKSMLLKPHQKEKMSTEIAI
3bwjA           ----------------------------------------------------------------------
1xh9A           ----------------------------------------------------------------------
1smhA           ----------------------------------------------------------------------
3hx4A           -------------------YKGQRVLGKGSFGEVILCKDKTGQECAVKVISKD-------KESLLREVQL
3comB           -------------------------------GSVYKAIHKETQIVAIKQVPVESDLQEIIK-----EISI
3comA           -------------------------------GSVYKAIHKETQIVAIKQVPVESDLQEIIK-----EISI
1s9iA           -------------------------LGAGNGGVVTKVQHPSGLIMARKLIHLEIK--PAIRNQIIRELQV
2oidD           ------------------------------------------------VYKGYVNNTTVAVKKLDQEIKV
3dy7A           -------------------------LGAGNGGVVFKVSHPSGLVMARKLIHLEIK--PAIRNQIIRELQV
2w5aA           -------------------YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNL
2vo0A           ----------------------------------------------------------------------
2uw4A           ----------------------------------------------------------------------
2uvxA           ----------------------------------------------------------------------
1q62A           ----------------------------------------------------------------------
1q61A           ----------------------------------------------------------------------
1q24A           ----------------------------------------------------------------------
2jdtA           ----------------------------------------------------------------------
2jc6C           -------------------FEFKETLGTGAFSEVVLAEEKATKLFAVKCIPK--------KASIENEIAV
3dlsC           --------------EYSQKYSTMSPLGSGAFGFVWTAVDXXXXXXXXXXXXXXXXXXDPKLGKVTLEIAI
3dlsB           --------------EYSQKYSTMSPLGSGAFGFVWTAXXXXXXXXXXXXXXXXXXXXDPKLGKVTLEIAI
1zwsA           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
2vo6A           ----------------------------------------------------------------------
2uvzA           ----------------------------------------------------------------------
2uvyA           ----------------------------------------------------------------------
1u7eA           ----------------------------------------------------------------------
1szmB           ----------------------------------------------------------------------
1szmA           ----------------------------------------------------------------------
1o6lA           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEVAKDEVAHT--VTESRV
1o6kA           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEVAKDEVAHT--VTESRV
2jdoA           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEVAKDEVAHT--VTESRV
2jc6A           -------------------FEFKETLGTGAFSEVVLAEEKATKLFAVKCIPKKASS-------IENEIAV
2iw9C           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3idpB           -----------EIPD--GQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQA-FKNEVGV
2h6dA           ----------------IGHYVLGDTLGVGTFGKVKIGEHQTGHKVAVKILRQKIRSLDVV-GKIKREIQN
3fhiA           ----------------------------------------------------------------------
3e8dB           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEVAKDEVAHT--VTESRV
3e8dA           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEVAKDEVAHT--VTESRV
3e88A           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEVAKDEVAHT--VTESRV
3e87A           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEVAKDEVAHT--VTESRV
3dogC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3db6A           -------PDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVAGKVVPKSMLLKPHQKEKMSTEIAI
3d0eA           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEVAKDEVAHT--VTESRV
2ckeB           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
2ckeA           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
3c4cB           --------DDWEIPD--GQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQA-FKNEVGV
2a2aB           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
2a2aA           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
1ydrE           ----------------------------------------------------------------------
1sykB           ----------------------------------------------------------------------
1sykA           ----------------------------------------------------------------------
1rejA           ----------------------------------------------------------------------
2qvsE           ----------------------------------------------------------------------
2qurA           ----------------------------------------------------------------------
1jbpE           ----------------------------------------------------------------------
2iw8C           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3idbA           ----------------------------------------------------------------------
3hyhA           -------------------YQIVKTLGEGKVKLAYHTTTGQK--VALKIINKKMQG------RIEREISY
2gu8A           ----------------------------------------------------------------------
1fmoE           ----------------------------------------------------------------------
3fjqE           ----------------------------------------------------------------------
3dlsA           --------------EYSQKYSTMSPLGSGAFGFVWTAVDXXXXXXXXXXXXXXXXXEDPKLGKVTLEIAI
1bkxA           ----------------------------------------------------------------------
1apmE           ----------------------------------------------------------------------
1v0bA           ------------------------KIGEGTYGVVYKAQNNYGETFALKKIRLEKEDEGIPSTTI-REISI
1oiuC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2jflA           -------------------WEIIGELGDGAFGKVYKAQNKETSVLAAAKVIDTKSEEELEDYMV--EIDI
3e92A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
3ddqC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3d83A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1wmkH           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
1wmkB           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
1wmkE           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
1wmkA           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
1tkiA           -------------------YMIAEDLGRGEFGIVHRCVETSSKKTYMAKF-VKVKGTD--QVLVKKEISI
2qr8A           --------------QFTDGYEVKEDIGVGSYSVCKRCIHKATNMFAVKII------DKSKRDPTEEIEIL
2qcsA           ----------------------------------------------------------------------
2pziA           -----------------GQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDXXXXXXFLAEVVH
1oguC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
1l3rE           ----------------------------------------------------------------------
2j90A           ---------GEELGS--GQFAIVRKCRQKGTGKEYAAKFIKKRRLSSR--------RGVSREEIEREVNI
2cpkE           ----------------------------------------------------------------------
3bhuC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3bhtC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2a27A           ---------GEELGS--GQFAIVKKCREKSTGLEYAA-----KFIKKRQSRASRRG--VSREEIEREVSI
1vzoA           -------------------FELLKVLGTGAYGKVFRKISGHDKLYAMKVLKKATI---VQKAKTTEHTRT
2uv2A           ----------EHVTRDLNPEDFWEIIGEGDFGKVYKAQNKETSVLAAAKVIDTKSEEELEDYMV--EIDI
2g9xC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3d5wA           ----------------------------------------------------------------------
2w5hA           -------------------YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNL
2r0iA           ---------------HIGNYRLLKTIGKGNFAKVKLARHITGKEVAVKIIDKTQLNSSSLQ-KLFREVRI
1h26C           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3c4cA           --------DDWEIPD--GQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQA-FKNEVGV
2v55C           -------------------YEVVKVIGRGAFGEVQLVRHKSTRKVAMKLLSKMIKRSDSAFFWEERDIMA
2v55A           -------------------YEVVKVIGRGAFGEVQLVRHKSTRKVAMKLLSKMIKRSDSAFFWEERDIMA
2oicB           ------------------------KMGEGG--VVYKGY----------VNNTTVAVKKLLKQQFDQEIKV
1ob3A           ------------------------KIGEGTYGVVYKAQNNYGETFALKKIRLEKEDEGIPSTTI-REISI
3idpA           -----------EIPD--GQITVGQRIGSGSFGTVYKGKWHGD--VAVKMLNVTAPTPQQLQA-FKNEVGV
2etkB           -------------------YEVVKVIGRGAFGEVQLVRHKSTRKVAMKLLSKMIKRSDSAFFWEERDIMA
2etkA           -------------------YEVVKVIGRGAFGEVQLVRHKSTRKVAMKLLSKMIKRSDSAFFWEERDIMA
2vd5B           ----------------------------------------------------------------------
1unlA           -------------------YEKLEKIGEGTYGTVFKAKNRETHIVALKRVRLDDDDEGVPSSAL-REICL
2i6lB           -----------------------------GNGLVFSAVDNDDKRVAIKKI---VLTDPQSVKHALREIKI
1fotA           -------------------FQILRTLGTGSFGRVHLIRSRHNRYYAMKVLKKEIVVRLKQVEHTNDERLM
2vwiA           ----------------------------------------------------EVIGTAVVQAAYCEKVAA
2j0lA           --------------------ELGRCIGEGQFGDVHQGISPENPAMAVAIKTCKNCTSDSVREKFLQEALT
1h25C           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
1zmuB           ---------------HIGNYRLLKTIGKGAKVKLARHI-LTGKEVAVKIIDKTQLNSSSLQ-KLFREVRI
1s9iB           -------------------------LGAGNGGVVTKVQHPSGLIMARKLIHLEIK--PAIRNQIIRELQV
2oibA           -----------------------------------------------------------------QEIKV
3igoA           -------------------YNIVCMLGKGSFGEVLKCKDRTQQEYAVKVINKASAKNKTST--ILREVEL
2hakG           ---------------HIGNYRLQKTIGKGNFAKVKLARHVTGREVAVKIID-KTQLNPTSLQKLFREVRI
2h9vA           -------------------YDVVKVIGRGAFGEV-QLVKASQKVYAMKLLSKMIKRSDSAFFWEERDIMA
2f2uB           -------------------YDVVKVIGRGAFGEV-QLVKASQKVYAMKLLSKMIKRSDSAFFWEERDIMA
2f2uA           -------------------YDVVKVIGRGAFGEV-QLVKASQKVYAMKLLSKMIKRSDSAFFWEERDIMA
3dlsF           --------------EYSQKYSTMSPLGSGAFGFVWTAXXXXXXXXXXXXXXXXXXXEDPKLGKVTLEIAI
3dlsE           --------------EYSQKYSTMSPLGSGAFGFVWTAXXXXXXXXXXXXXXXXXXXEDPKLGKVTLEIAI
1rdqE           ----------------------------------------------------------------------
2pziB           -----------------GQYEVKGCIAHGGLGWIYLALDRNVNGRPVVLKGLVHSGDXXXXXXFLAEVVH
2oidC           -----------------------------------------------------------------KEIKV
2j90B           -------------------YEMGEELGSGQFAIVRKCRQKEYAAKFIKKRRLS-SRRGVSREEIEREVNI
3coiA           -----------ELPKYVSP----THVGSGAYGSVCSAIDKRSEKVAIKKLSRPFQSEIFAK-RAYRELLL
2i6lA           ------------------------------LGLVFSAVDNDDKRVAIKKI---VLTDPQSVKHALREIKI
2cn5A           -------------------YIMSKTLGSGACGEVKLAFERKTKKVAIKI---------ISKRNVETEIEI
3c51B           ----------------------------------------------------------------------
1zmvB           ---------------HIGNYRLLKTIGKGAKVKLARHI-LTGKEVAVRIIDKTQLNSSSLQ-KLFREVRI
2j7tA           ----------------------------------------------------------------------
3dlsD           --------------EYSQKYSTMSPLGSGAFGFVWTAXXXXXXXXXXXXXXXXXXXEDPKLGKVTLEIAI
2w4oA           -------------------FEVESELGRGATSIVYRCKQKTQKPYALKVLK---------------KIGV
1v0oB           ------------------------KIGEGTYGVVYKAQNNYGETFALKKIRLTI-----------REISI
2jbpC           ----------------------------------------------------------------------
2fysA           ----------------VGPYTNLSYIGEGAYGMVCSAYDNLNK-VRVAIKKISPFEHQTYCQRTLREIKI
1ykrA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
1vywC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
1vywA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
1v0oA           ------------------------KIGEGTYGVVYKAQNNYGETFALKKIRLSTT---------IREISI
2r3qA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVALKKITREISL
2r3iA           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
1pmqA           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
1okvC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
1okvA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2oidB           -----------------------------------------------------------------QEIKV
2hw6B           -------------------------LGEGAYAKVQGAVSLQNKEYAVKIIEKQAGH---SRSRVFREVET
1gz8A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
3gc8B           -----------------------RPVGSGAYGSVCSAYDARLRQVAVKKLSRPFQSLIHAR-RTYRELRL
3gc8A           -----------------------RPVGSGAYGSVCSAYDARLRQVAVKKLSRPFQSLIHAR-RTYRELRL
3gc7A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
2g2iA           -----------------------------GGGEVYEGVWKKYSLVAVKTLKE----DTMEVEEFLKEAAV
3f5xA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3dfaA           -------------------YNIVCMLGKGSFGEVLKCKDRTQQEYAVKVIN-KASAKNKDTSTILREVEL
3dbeA           -------PDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVAGKVVPKSMLLKPHQKEKMSTEIAI
3d7zA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
3c4yA           ----------------------------------------------------------------------
2c4gC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2c4gA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2bkzC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2baqA           -----------EVPER---YQNLSPIGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
2bajA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
3b2wA           --------------------KLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDLAEANLMKQLQH
1zmuA           -----------------GNYRLLKTIGKGAKVKLARHI-LTGKEVAVKIIDKTQLNSSSLQ-KLFREVRI
1pmuA           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
1oz1A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
2o0uA           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
2gtmA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTHRVAVKKLSRPFQSIIHAK-RTYRELRL
2g2fB           ------------------------------LGEVYEGVWKKYSLVAVKTLKE----DTMEVEEFLKEAAV
3e7oA           -------------------YQQLKPIGSGAQGIVCAAFDTVLGIVAVKKLSRPFQNQTHAK-RAYRELVL
3dqxA           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
1bi8A           -------------------YECVAEIGEGAYGKVFKARDLKNRFVALKRVRVQEHPNVV---RLF-DVCT
2zdtA           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
2zb0A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1yqjA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1wbsA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1pmvA           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
1pmnA           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
2pl0A           --------------------KLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDLAEANLMKQLQH
2p33A           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
1ouyA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
2oidA           -----------------------------------------------------------------KEIKV
2of2A           --------------------KLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDLAEANLMKQLQH
1jnkA           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
2hz4B           ------------------------------LGEVYEGVWKKYSLVAVKTLKE----DTMEVEEFLKEAAV
2hz4A           ------------------------------LGEVYEGVWKKYSLVAVKTLKE----DTMEVEEFLKEAAV
3gfeA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
3famA           ---------------HIGNYQIVKKVK-----LAYHTTTGQK--VALKIINKKVM-----QGRIEREISY
1di9A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
2cl1A           ---------------------------------------------------------------LVSEVNL
3c51A           ----------------------------------------------------------------------
3c50B           ----------------------------------------------------------------------
3c50A           ----------------------------------------------------------------------
3c4zA           ----------------------------------------------------------------------
3c4yB           ----------------------------------------------------------------------
3c4xB           ----------------------------------------------------------------------
3c4xA           ----------------------------------------------------------------------
3c4wB           ----------------------------------------------------------------------
3c4wA           ----------------------------------------------------------------------
1bi7A           -------------------YECVAEIGEGAYGKVFKARDLKNRFVALKRVRVQEHPNVVRLFDVCTVSRT
1qpjA           --------------------KLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDLAEANLMKQLQH
1qpcA           --------------------KLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDLAEANLMKQLQH
2ofuA           --------------------KLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDLAEANLMKQLQH
2jbpD           ----------------------------------------------------------------------
2iw6C           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2h96A           -------------------YQNLKPIGSGAQGIVCAAYDALERNVAIKKLSRPFQNQTHAK-RAYRELVL
2gmxB           -------------------YQNLKPIGSGAQGIVCAAYDALERNVAIKKLSRPFQNQTHAK-RAYRELVL
2gmxA           -------------------YQNLKPIGSGAQGIVCAAYDALERNVAIKKLSRPFQNQTHAK-RAYRELVL
2g2iB           -------------------------------GEVYEGVWKKYSLVAVKTLKE----DTMEVEEFLKEAAV
2g01B           -------------------YQNLKPIGSGAQGIVCAAYDALERNVAIKKLSRPFQNQTHAK-RAYRELVL
2g01A           -------------------YQNLKPIGSGAQGIVCAAYDALERNVAIKKLSRPFQNQTHAK-RAYRELVL
3famB           ---------------HIGNYQI-----VGKVKLAYHTTTGQK--VALKIINKKMQG------RIEREISY
3e93A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
2c3iB           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDWGEGTRVPMEVVL
3bymA           --------------------KLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDLAEANLMKQLQH
1zmvA           -----------------GNYRLLKTIGKGAKVKLARHI-LTGKEVAVRIIDKTQLNSSSLQ-KLFREVRI
1qpdA           --------------------KLVERLGAGQAGEVWMGYYNGHTKVAVKSLKQGSMSPDLAEANLMKQLQH
2o8yB           --------------------------GEGGFGVVYKGY-VNNTTVAVKKLKQQFDQE-----------IK
2j0jA           --------------------ELGRCIGEGQFGDVHQGISPENPAMAVAIKTCKNCTSDSVREKFLQEALT
3eljA           -------------------YQNLKPIGSGAQGIVCAAYDALERNVAIKKLSRPFQNQTHAK-RAYRELVL
3dk6A           ---------------------MKHKLGQ--FGEVYEGVWKKYSLVAVKTLEVE---------EFLKEAAV
3cqwA           -------------------FEYLKLLGKGTFGVILVKEKATGRYYAMKILKKEVAKDEVAHTLTENRVL-
3cquA           -------------------FEYLKLLGKGTFGVILVKEKATGRYYAMKILKKEVAKDEVAHTLTENRVL-
2b9iA           -------------------FQLKSLLGEGAYGVVCSATHPTGEIVAIK--KIEPFDKPLFALRTLREIKI
2onlD           ----------------------------------------------------------------------
2onlC           ----------------------------------------------------------------------
2jkqA           --------------------ELGRCIGEGQFGDVHQGISPENPALAVAIKTCKNCTSDSVREKFLQEALT
2jbpE           ----------------------------------------------------------------------
2ijmB           --------------------ELGRCIGEGQFGDVHQGISPENPALAVAIKTCKNCTSDSVREKFLQEALT
2ijmA           --------------------ELGRCIGEGQFGDVHQGISPENPALAVAIKTCKNCTSDSVREKFLQEALT
2hznA           -----------------------------GGGEVYEGVWKKYSLVAVKTL------DTMEVEEFLKEAAV
2hz4C           ------------------------------LGEVYEGVWKK-YTVAVKTLK-----DTMEVEEFLKEAAV
3hyhB           -------------------YQIVKTLGEK-VKLAYHTTTGQK--VALKIINKKVM-----QGRIEREISY
3hkoA           ---------GGSLLELQKKYHLKGAIGQGSYGVVRVAIENQTRAIAIKIMKNKIRQKDVERIKT--EVRL
1fgiA           -------------------------LGEGAFGVLAEAIGLPNRVVAVKMLKSDATEKDLSDLISEMEMMK
2fa2B           -------------------FQLKSLLGEGAYGVVCSATHPTGEIVAIK--KIEPFDKPLFALRTLREIKI
2fa2A           -------------------FQLKSLLGEGAYGVVCSATHPTGEIVAIK--KIEPFDKPLFALRTLREIKI
2f49A           -------------------FQLKSLLGEGAYGVVCSATHPTGEIVAIK--KIEPFDKPLFALRTLREIKI
2eueB           ---------------HIGNYQIVAKVK-----LAYHTTTGQK--VALKIINKKMQG------RIEREISY
2etmA           --------------------ELGRCIGEGQFGDVHQGISPENPALAVAIKTCKNCTSDSVREKFLQEALT
2clxA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLGVPSTAI------REISL
2b9hA           -------------------FQLKSLLGEGAYGVVCSATHPTGEIVAIK--KIEPFDKPLFALRTLREIKI
3b2tA           -------------------------LGEGCFGQVVMAIDPKEAVVAVKMLKDDATEKDLSDLVSEMEMMK
2w9zB           -------------------YEPVAEIGVGAYGTVYKARDPHSHFVALKSVRVP-NGEEGLPISTVREVAL
2w99B           -------------------YEPVAEIGVGAYGTVYKARDPHSHFVALKSVRVP-NGEEGLPISTVREVAL
2w7xA           ----------------------------------------------------------------------
2vd5A           ----------------------------------------------------------------------
1ukhA           -------------------YQNLKPIGSGAQGIVCAAYDALERNVAIKKLSRPFQNQTHAK-RAYRELVL
2qohB           --------------------------------------------VAVKTLKMEVE-------EFLKEAAV
2qohA           --------------------------------------------VAVKTLKEEVE-------EFLKEAAV
2qkrA           -----------------------------GEGVVYKAKDSQ-RIVALKRISTAI-----------REISL
1p4fA           ------YDTGEELGS--GQFAVVKKCREKSTGLQYAAK-------FIKKRRTKSSRRGVSREDIEREVSI
2ozaA           ----------------------------------------------------------------------
2iw8A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3eqrB           --------------------RLLEKLGDGSFGVVWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNA
3ehaA           ------YDTGEELGS--GQFAVVKKCREKSTGLQYAAK-------FIKKRRTKSSRRGVSREDIEREVSI
1bmkA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTHRVAVKKLSRPFQSIIHAK-RTYRELRL
2a4lA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVALKKIAREISL
1y57A           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
2w96B           -------------------YEPVAEIGVGAYGTVYKARDPHSHFVALKSVRVP-NGEEGLPISTVREVAL
1w98A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2vtrA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRPSTA---------IREISL
2srcA           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
1jstA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2jgzA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2hw6A           -------------------------LGEGAYAKVQGAVSLQNKEYAVKIIEKQAGH---SRSRVFREVET
1hckA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRTEGVP-----STAIREISL
2h8hA           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
1h27C           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
1h24A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2g9xA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3fpmA           ----------------------------------------------------------------------
1e9hA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2ds1A           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
2cchA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2b9fA           -------------------FQLKSLLGEGAYGVVCSATHPTGEIVAIK--KIEPFDKPLFALRTLREIKI
2zm3B           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
2zduA           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
2psqB           -------------------------LGEGCFGQVVMAIDPKEAVVAVKMLKDDATEKDLSDLVSEMEMMK
2jbpB           ----------------------------------------------------------------------
2i40A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLTEGVPSTA----IREISL
3hztA           -------------------YQRVKKLGSGAYGEVLLC---KDKLTAIKIIKKSSVTTTSNSGALLDEVAV
2g2hA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2g2fA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2f4jA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
3dgkA           ------YDTGEELGS--GKFAVVKKCREKSTGLQYAAK-------FIKKRRTKSSRRGVSREDIEREVSI
3ddqA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTEG---VPSTAIREISL
1buhA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTTA--------IREISL
3bhtA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLDTEG---VPSTAIREISL
2zoqA           -------------PFDVGPYTQLQYIGEGAYGMVSSAYD-HVRKTRVAIKKISPFEHQTYCQRTLREIQI
2hziA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2hz0A           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2hyyA           --------------------------------------------VAVKTLK-----DTMEVEEFLKEAAV
2hiwA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
1g3nA           -------------------YECVAEIGEGAYGKVFKARDLKNRFVALKRVRVQTGEEGMPLSTI-REVAV
2g1tD           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2g1tC           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2g1tB           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2g1tA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2fysB           ----------------VGPYTNLSYIGEGAYGMVCSAYDNLNK-VRVAIKKISPFEHQTYCQRTLREIKI
2fvdA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVALKKIRREISL
3cy3A           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDGELPTRVPMEVVL
3cs9D           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2c6iA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIR-------LVPSTAIREISL
2c68A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIR-------LVPSTAIREISL
1blxA           -------------------YECVAEIGEGAYGKVFKARDLKNRFVALKRVRVQTGEEGMPLSTI-REVAV
3bgzA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISD--WGERVPMEVVL
2balA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1agwB           -------------------------LGEGAFGVLAEAIGLPNRVVAVKMLKSDATEKDLSDLISEMEMMK
1y8gB           ---------------HIGNYRLLKTIGKGNFAKVKLARHITGKEVAVKIIKTQLNSSSLQKLFREVRIKV
1y8gA           ---------------HIGNYRLLKTIGKGNFAKVKLARHITGKEVAVKIIKTQLNSSSLQKLFREVRIKV
1xo2B           -------------------YECVAEIGEGAYGKVFKARDLKNRFVALKRVRVQTGEEGMPLSTI-REVAV
2w9fB           -------------------YEPVAEIGVGAYGTVYKARDPHSHFVALKSVRVP-NGEEGLPISTVREVAL
2pzyB           ----------------------------------------------------------------------
1opjB           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
1opjA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
1m52B           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
1m52A           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
1iepA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
1h01A           ------------------------KIGEGTYGVVYKARNKTGEVVALKI-----------RSTAIREISL
3fv8A           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
1fpuA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
1f5qC           ---------------------------EGTYGVVYKARNGE--VVALKKIRLDTETEGVPSTAI-REISL
3eocC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLTEGVPSTA----IREISL
3ej1C           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLTEGVPSTA----IREISL
3ej1A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLTEGVPSTA----IREISL
3ds6A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
3dqwD           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
3dqwC           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
3dqwA           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
1yrpA           ---------GEELGS--GQFAIVRKCRQKGTGKEYAAK-------FIKKXXXXXXXXXXXXXXXXXXVNI
1yi6A           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
1v0bB           ------------------------KIGEGTYGVVYKAQNNY--------------GETFALKKIIREISI
1tvoA           ----------------VGPYTNLSYIGEGAYGMVCSAYDNVNK-VRVAIKKISPFEHQTYCQRTLREIKI
2r3kA           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
1qcfA           --------------------KLEKKLGAGQFGEVWMATYNKHTKVAVKTMK---PGSMSVEAFLA-EANV
2ojiA           ----------------VGPYTNLSYIGEGAYGMVCSAYDNVNK-VRVAIKKISPFEHQTYCQRTLREIKI
2ojgA           ----------------VGPYTNLSYIGEGAYGMVCSAYDNVNK-VRVAIKKISPFEHQTYCQRTLREIKI
1jsvA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVALKKITREISL
1jqhB           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
1jqhA           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
2jkmA           --------------------ELGRCIGEGQFGDVHQGISPENPAMAVAIKTCKNCTSDSVREKFLQEALT
2iw9A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLEGVP-----STAIREISL
2hyyB           --------------------------------------------VAVKTLKETMEVEEFLK-----EAAV
2hk5A           --------------------KLEKKLGAGQFGEVWMATYNKHTKVAVKTMK---PGSMSVEAFLA-EANV
1h0uA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
2gqgB           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2gqgA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
1golA           ----------------VGPYTNLSYIGEGAYGMVCSAYDNLNK-VRVAIRKISPFEHQTYCQRTLREIKI
2eufB           -------------------YECVAEIGEGAYGKVFKARDLKNRFVALKRVRVQTGEEGMPLSTI-REVAV
2etmB           --------------------ELGRCIGEGQFGDVHQGISPENPALAVAIKTCKNCTSDSVREKFLQEALT
3erkA           ----------------VGPYTNLSYIGEGAYGMVCSAYDNLNK-VRVAIKKISPFEHQTYCQRTLREIKI
1erkA           ----------------VGPYTNLSYIGEGAYGMVCSAYDNLNK-VRVAIKKISPFEHQTYCQRTLREIKI
3eidA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLTEGVPSTA----IREISL
1e1vA           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
3cy2A           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDGELPTRVPMEVVL
3cxwA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDGELPTRVPMEVVL
3c4fA           -------------------------LGEGAFGQVVLAEDKPNRVVAVKMLKSDATEKDLSDLISEMEMMK
1agwA           -----------------------------GQVVLAEAIGLPNRVVAVKMLKSDATEKDLSDLISEMEMMK
2z60A           --------------------------------------------VAVKTLKEEVE-------EFLKEAAV
1wvyA           ------YDTGEELGS--GQFAVVKKCREKSTGLQYAAK-------FIKKRRTKSSRRGVSREDIEREVSI
1wvwA           ------YDTGEELGS--GQFAVVKKCREKSTGLQYAAK-------FIKKRRTKSSRRGVSREDIEREVSI
1oirA           ------------------------KIGEGTYGVVYKARNKTGEVVALKI-----------RLTAIREISL
2objA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
1jktA           ------YDTGEELGS--GQFAVVKKCREKSTGLQYAAK-------FIKKRRTKSSRRGVSREDIEREVSI
1jkkA           ------YDTGEELGS--GQFAVVKKCREKSTGLQYAAK-------FIKKRRTKSSRRGVSREDIEREVSI
2jbpF           ----------------------------------------------------------------------
2j0kA           --------------------ELGRCIGEGQFGDVHQGISPENPAMAVAIKTCKNCTSDSVREKFLQEALT
1ig1A           ------YDTGEELGS--GQFAVVKKCREKSTGLQYAAK-------FIKKRRTKSSRRGVSREDIEREVSI
3hmiA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
3gc9B           -----------------------RPVGSGAYGSVCSAYDARLRQVAVKKLSRPFQSLIHAR-RTYRELRL
3gc9A           -----------------------RPVGSGAYGSVCSAYDARLRQVAVKKLSRPFQSLIHAR-RTYRELRL
1f5qA           ---------------------------EGTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3f2aA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
3eidC           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLEGVP-----STAIREISL
3eh9A           -------------------YDTGEELGSGQFAVVKKCREKSTGLYAAKFIRRTKSSRGVSREDIEREVSI
3dxnA           ----------------------------GSYGEVLLCKDKTGAERAIKIIKKSSVTTTSNSGALLDEVAV
3dfcB           ------YDTGEELGS--GKFAVVKKCREKSTGLQYAAK-------FIKKRRTKSSRRGVSREDIEREVSI
3dcvA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
1cm8A           --------------------------------------------VAIKKLYRPFQSELFAK-RAYRELRL
2bikB           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
2vtiA           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
1ungA           -------------------------------GTVFKAKNRETHIVALKRVRLDDDDEGVPSSAL-REICL
1ukiA           -------------------YQNLKPIGSGAQGIVCAAYDALERNVAIKKLSRPFQNQTHAK-RAYRELVL
1pmeA           -----------------------------GYGMVCSAYDNVNK-VRVAIKKISPFEHQTYCQRTLREIKI
1oitA           ------------------------KIGEGTYGVVYKARNKLGEVVALKKITA------------IREISL
1kobA           -------------------YDILEELGSGAFGVVHRCVEKATRVFVAKFINTPYPLD---KYTVKNEISI
1jvpP           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
2jkkA           --------------------ELGRCIGEGQFGDVHQGISPENPAMAVAIKTCKNCTSDSVREKFLQEALT
2j0mB           --------------------ELGRCIGEGQFGDVHQGISPENPALAVAIKTCKNCTSDSVREKFLQEALT
2j0kB           --------------------ELGRCIGEGQFGDVHQGISPENPAMAVAIKTCKNCTSDSVREKFLQEALT
2iw6A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLTEGVPSTA----IREISL
2hyyD           --------------------------------------------VAVKTLK------EMEVEEFLKEAAV
3f5pB           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
2erkA           ----------------VGPYTNLSYIGEGAYGMVCSAYDNLNK-VRVAIKKISPFEHQTYCQRTLREIKI
3eqrA           --------------------RLLEKLGDGSFGVVWDAPSGKTVSVAVKCLKPEAMDDFI------REVNA
3dqxB           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
3dk6B           ---------------------------------VYEGVWKKYSLVAVKTLEVE---------EFLKEAAV
2bakA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1ywvA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
1xwsA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
1xqzA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
2wajA           -------------------YQNLKPIGSGGIVAAYDAV--LDRNVAIKKLSRPFQNQTHAK-RAYRELVL
2r3jA           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
2r3hA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVALKKIPREISL
1kswA           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
2jbpH           ----------------------------------------------------------------------
2jboA           ----------------------------------------------------------------------
2javA           -------------------YEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNL
2j2iB           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
3g9nA           --------------------------GQGIVCAAYDAV--LDRNVAIKKLSRPFQNQTHAK-RAYRELVL
3g33A           -------------------YEPVAEIGVGAYGTVYKARDPHSHFVALKSVRVPNXXXXXXXLPISREVAL
3f6xD           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
3f6xC           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPPEA--------FLQEAQV
3f6xA           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLSPEA---------FLQEAQV
3f5pS           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
3f5pI           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
3f5pA           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
3eqpA           --------------------RLLEKLGDGSFGVVWDAPSGKTVSVAVKCLQPEAMDDFI------REVNA
3eqpB           --------------------RLLEKLGDGSFGVVWDAPSGKTVSVAVKCLQPEAMDDFI------REVNA
2dq7X           -----------------------KRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPE----SFLEEAQI
3d94A           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
3c4eC           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
2bzhB           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
2bilB           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
1yhsA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRI-SDWGETRVPMEVVL
2w0jA           ----------------------------------------------------------------------
2r9sA           -------------------YQNLKPIGSGAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
1r39A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1mryA           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEVI------------IRV
1iasB           ---------------------LQESIGKGRFGEVWRGKWRGEE-VAVKIFSSREERSWFREAEIYQTVM-
2hakH           ---------------HIGNYRLQKTIGKGNFAKVKLARHVTGREVAVKIID-KTQLNPTSLQKLFREVRI
2hakB           ---------------HIGNYRLQKTIGKGNFAKVKLARHVTGREVAVKIID-KTQLNPTSLQKLFREVRI
1h4lA           -------------------------------GTVFKAKNRETHIVALKRVRL----DGVPSSAL-REICL
1h0vA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
3g90X           ----------------------------GSQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
2fgiA           -----------------------------GQVVLAEAIGLPNRVVAVKMLKSDATEKDLSDLISEMEMMK
3f5pE           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
2e14A           ----------------VGPYTNLSYIGEGAYGMVCSAYDNVNK-VRVAIKKISPFEHQTYCQRTLREIKI
2duvA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVALKKIIREISL
2c5yA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVALKKIGREISL
2zm3A           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
1yxsA           -------------------YQVGPLLGSGGFGSVYSGIRVSDNLVAIKHVEKDRISDELPNGRVPMEVVL
2wntB           -------------------YVVKETIGVGSYSECKRCVHKATNMYAVKVI-------DKSKRDPSEEIIL
2wipC           ------------------------------IGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2wipA           ------------------------------IGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2uznA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVALKKIPREISL
2r3lA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
2pzyC           ----------------------------------------------------------------------
2pwlA           -------------------------LGEGAFGQVVMAIDPKEAVVAVKMLKDDATEKDLSDLVSEMEMMK
1oi9A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRTETEG---VPSTAIREISL
1k3aA           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
2jbpI           ----------------------------------------------------------------------
2i0eB           -------------------------LGKGSFGVMLSERKGTDELYAVKILKKDVVDDDVECTMVEKRVLA
2i0eA           -------------------------LGKGSFGVMLSERKGTDELYAVKILKKDVVDDDVECTMVEKRVLA
2hziB           -----------------------------------------------------------------KEAAV
3hngA           --------------------KLGKSLGRGAFGKVVQASSPTCRTVAVKMLKEGATASEYKALMTELKILT
1h08A           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
1gjoA           -------------------------LGEGCFGQVVMAIKPKEAVVAVKMLKDDATEKDLSDLVSEMEMMK
3gcuA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
3fz1A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
3f5pM           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
3f5pC           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
3dtcA           -------------------------IGIGGFGKVYRAFWIGDE-VAVKAATIENVRQEAKLFAMLKHIIA
3dogA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRTETEG---VPSTAIREISL
3dk3B           -----------------------------------------------------------------KEAAV
3dk3A           -----------------------------------------------------------------KEAAV
3cs9A           -----------------------------------------------------------------KEAAV
3bqrA           ---------GEELGS--GQFAIVRKCRQKGTGKEYAAK-------FIKKXXXXXXXXXXXXXXXXXXVNI
2w06A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
2vtsA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRPSTA---------IREISL
2vtpA           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
2v7aB           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
2v7aA           --------------------------------------------VAVKTLKE----DTMEVEEFLKEAAV
1u4dA           --------------------RLLEKLGDGSFGVVRRGEAPSGKTVSVAVKCPEAMDDFI------REVNA
2pmiC           -----------------------------------------------------------------REISL
2pmiA           -----------------------------------------------------------------REISL
2ozaB           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTHRVAVKKLSRPFQSIIHAK-RTYRELRL
1oiyA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLTEGVPSTA----IREISL
1oguA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRLTEGVPSTA----IREISL
1m7nA           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
2jkoA           --------------------ELGRCIGEGQFGDVHQGISPENPAMAVAIKTCKNCTSDSVREKFLQEALT
3hrbA           ------------------------------VGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
2gphA           ----------------VGPYTNLSYIGEGAYGMVCSAYDNLNK-VRVAIKKISPFEHQTYCQRTLREIKI
2f9gA           -------------------FQLKSLLGEGAYGVVCSATHPTGEIVAIK--KIEPFDKPLFALRTLREIKI
2dylA           ----------------------------------------------------------------------
1di8A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRG-------VPSTAIREISL
3da6A           -------------------YQNLKPIGSGGIVAAYDAV--LDRNVAIKKLSRPFQNQTHAK-RAYRELVL
2cjmC           ------------------------KIGEG-TGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
3bv3A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
2b52A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRTEGVP-----STAIREISL
2zazA           -------------------------------GSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1wccA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRTEGVP-----STAIREISL
2r3nA           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
2pwlB           -------------------------LGEGAFGQVVMAIDPKEAVVAVKMLKDDATEKDLSDLVSEMEMMK
2okrA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1lezA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTHRVAVKKLSRPFQSIIHAK-RTYRELRL
1giiA           ------------------------KIGEGTYGVVYKARN--------KLTGEVVALKKIVPSTAIREISL
2excX           -------------------YQNLKPIGSGIVCAAYDAV--LDRNVAIKKLSRPFQNQTHAK-RAYRELVL
2ewaA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
3d5xA           -------PDVLVDPRTMKRYMRGRFLGKGGFAKCYEITDMDTKEVAGKVVPKSMLLKPHQKEKMSTEIAI
3bz3A           --------------------ELGRCIGEGQFGDVHQGIYMSPLAVAIKTCKN--CTSDSVREKFLQEALT
3byuA           --------------------KLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDLAEANLMKQLQH
3bv2A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
2zm3D           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
1unhA           -------------------------------GTVFKAKNRHE-IVALKRVRL----DGVPSSAL-REICL
2pzyD           ----------------------------------------------------------------------
2pzpA           --------------------------------------------VAVKMLKDDATEEDLSDLVSEMEMMK
2pvfA           -------------------------LGEGAFGQVVMAIDKDKPVVAVKMLKDDATEKDLSDLVSEMEMMK
1h07A           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
1gzkA           -------------------------LGKGTFGVILVREKATGRYYAMKILRKEV---------IVTESRV
2vthA           ------------------------KIGEGTYGVVYKARNK---------LTGEVVALKKIRSTAIREISL
2pzyA           ----------------------------------------------------------------------
1p4oB           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
1p4oA           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
2oj9A           -----------------------RELGQGSFGMVYEGVDEPETRVAIKTVNE--AASMRERIEFLNEASV
2oiqB           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
2ofvB           --------------------KLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQ---GAFLAEANLMKQLQH
2o2uA           -------------------YQNLKPIGSGGIVAAYDAV--LDRNVAIKKLSRPFQNQTHAK-RAYRELVL
1gijA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVAKIRAIREISL
3gcpA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
3gc0A           ----------------IDRYRRITKLGEGTYGEVYKAIDTTNETVAIKRIRLEHTA--------IREVSL
3g6hA           --------------------RLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEA----FLQEAQV
3fy2A           ---------------------------------------PSKKEISVAIKTLKVGYTEKQRRDFLGEASI
1fvtA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
1zz2A           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTGLVAVKKLSRPFQSIIHAK-RTYRELRL
1vyzA           ------------------------KIGEGTYGVVYKA-------------RNKLTGEVVALKKITREISL
2vtoA           ------------------------KIGEGTYGVVYKARNKTGEVVALKKIRVP--------STAIREISL
2pzpB           --------------------------------------------VAVKMLKDDATEEDLSDLVSEMEMMK
2ok1A           ----------------------------GAQGIVCAAYDAVDRNVAIKKLSRPFQNQTHAK-RAYRELVL
1lewA           -----------EVPER---YQNLSPVGSGAYGSVCAAFDTKTHRVAVKKLSRPFQSIIHAK-RTYRELRL
1jsuA           ----------------------------GTYGVVYKARNKTGEVVALKKIRLDTETEGVPSTAI-REISL
2i0yA           -----------------------KTLGAGAFGKVVEALGKEDAVVAVKMLKSTAHADE--KEALMSELKI
2i0vA           -----------------------KTLGAGAFGKVVEALGKEDAVVAVKMLKSTAHADE--KEALMSELKI
3hp2A           -----------EVPER---YQNLSP