[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ54978.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3d36B.bssp"
#ERROR : Can't open dsspfile "3d36A.bssp"
#ERROR : Can't open dsspfile "3cntB.bssp"
#ERROR : Can't open dsspfile "3bi4B.bssp"
#ERROR : Can't open dsspfile "3bi4A.bssp"
#ERROR : Can't open dsspfile "3bi2B.bssp"
#ERROR : Can't open dsspfile "3bi2A.bssp"

## Summary of PDB Search
:1077
    3e-06  34%  3d36B  [x.x.x] SPORULATION KINASE B
    3e-06  34%  3d36A  [x.x.x] SPORULATION KINASE B
    8e-04  28%  3cntB  [x.x.x] FMS1
    8e-04  28%  3bi4B  [x.x.x] POLYAMINE OXIDASE FMS1
    8e-04  28%  3bi4A  [x.x.x] POLYAMINE OXIDASE FMS1
    8e-04  28%  3bi2B  [x.x.x] POLYAMINE OXIDASE FMS1
    8e-04  28%  3bi2A  [x.x.x] POLYAMINE OXIDASE FMS1
:1077

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPLRVLRDGAMRIAAKDLPEAIVRMRETNVRPEEVKITP
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           --------------------------------PLKVIQDAFDKIHFGALGKVIFEFEECCWSNESSKIVT
3bi4B           --------------------------------PLKVIQDAFDKIHFGALGKVIFEFEECCWSNESSKIVT
3bi4A           --------------------------------PLKVIQDAFDKIHFGALGKVIFEFEECCWSNESSKIVT
3bi2B           --------------------------------PLKVIQDAFDKIHFGALGKVIFEFEECCWSNESSKIVT
3bi2A           --------------------------------PLKVIQDAFDKIHFGALGKVIFEFEECCWSNESSKIVT


                         .         .         +         .         .         .         .:490
query           LEVDSSDEFGEVARSFDEVHXXXXXXXXXXXXXXXNVNAMFVNLSRRSQSLVERQLRLIEHLEQSEQDEE
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           L-ANSTNEFVEIVRNAENLDELDSMLERETSVTCWSQPLFFVNLSKSTSFMMLMQAPLTNHIESIREDKE
3bi4B           L-ANSTNEFVEIVRNAENLDELDSMLERETSVTCWSQPLFFVNLSKSTSFMMLMQAPLTNHIESIREDKE
3bi4A           L-ANSTNEFVEIVRNAENLDELDSMLERETSVTCWSQPLFFVNLSKSTSFMMLMQAPLTNHIESIREDKE
3bi2B           L-ANSTNEFVEIVRNAENLDELDSMLERETSVTCWSQPLFFVNLSKSTSFMMLMQAPLTNHIESIREDKE
3bi2A           L-ANSTNEFVEIVRNAENLDELDSMLERETSVTCWSQPLFFVNLSKSTSFMMLMQAPLTNHIESIREDKE


                         *         .         .         .         .         +         .:560
query           RLAELFQxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           RLFSFFQ---------------------------------------------------------------
3bi4B           RLFSFFQ---------------------------------------------------------------
3bi4A           RLFSFFQ---------------------------------------------------------------
3bi2B           RLFSFFQ---------------------------------------------------------------
3bi2A           RLFSFFQ---------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVDNGDIIIEITDSGIGMSAEELESANQKLAEPPVIDVA
3d36B           -------------------------------SIDNGRVLIRIADTGVGMTKEQLE----RLGEPYFTTKG
3d36A           -------------------------------SIDNGRVLIRIADTGVGMTKEQLE----RLGEPYFTTKG
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           VSRRMGLFVVSRLANRHGIEVRLRPAHNGGITAAVRLPxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           VGTGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLP--------------------------------
3d36A           VGTGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLP--------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ----------------------------------------------------------------------
3d36A           ----------------------------------------------------------------------
3cntB           ----------------------------------------------------------------------
3bi4B           ----------------------------------------------------------------------
3bi4A           ----------------------------------------------------------------------
3bi2B           ----------------------------------------------------------------------
3bi2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
3d36B           ---------------------------
3d36A           ---------------------------
3cntB           ---------------------------
3bi4B           ---------------------------
3bi4A           ---------------------------
3bi2B           ---------------------------
3bi2A           ---------------------------