[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55004.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3cbgA.bssp"
#ERROR : Can't open dsspfile "2hnkC.bssp"
#ERROR : Can't open dsspfile "2hnkB.bssp"
#ERROR : Can't open dsspfile "2hnkA.bssp"
#ERROR : Can't open dsspfile "2avdA.bssp"
#ERROR : Can't open dsspfile "3duwA.bssp"
#ERROR : Can't open dsspfile "1suiA.bssp"
#ERROR : Can't open dsspfile "3dulA.bssp"
#ERROR : Can't open dsspfile "3dulB.bssp"
#ERROR : Can't open dsspfile "3c3yA.bssp"
#ERROR : Can't open dsspfile "2gpyB.bssp"
#ERROR : Can't open dsspfile "2gpyA.bssp"
#ERROR : Can't open dsspfile "3bwmA.bssp"
#ERROR : Can't open dsspfile "3bwyA.bssp"
#ERROR : Can't open dsspfile "2zthA.bssp"
#ERROR : Can't open dsspfile "1vidA.bssp"
#ERROR : Can't open dsspfile "1jr4A.bssp"
#ERROR : Can't open dsspfile "3hvhA.bssp"
#ERROR : Can't open dsspfile "2cl5B.bssp"
#ERROR : Can't open dsspfile "2cl5A.bssp"
#ERROR : Can't open dsspfile "1o54A.bssp"
#ERROR : Can't open dsspfile "1vq1B.bssp"
#ERROR : Can't open dsspfile "1vq1A.bssp"
#ERROR : Can't open dsspfile "1sg9A.bssp"
#ERROR : Can't open dsspfile "1nv9A.bssp"
#ERROR : Can't open dsspfile "1nv8B.bssp"
#ERROR : Can't open dsspfile "1nv8A.bssp"
#ERROR : Can't open dsspfile "1dl5B.bssp"
#ERROR : Can't open dsspfile "1dl5A.bssp"

## Summary of PDB Search
:219
    1e-45  44%  3cbgA  [x.x.x] O-METHYLTRANSFERASE
    2e-40  41%  2hnkC  [x.x.x] SAM-DEPENDENT O-METHYLTRANSFERASE
    2e-40  41%  2hnkB  [x.x.x] SAM-DEPENDENT O-METHYLTRANSFERASE
    2e-40  42%  2hnkA  [x.x.x] SAM-DEPENDENT O-METHYLTRANSFERASE
    2e-31  40%  2avdA  [x.x.x] CATECHOL-O-METHYLTRANSFERASE
    3e-31  41%  3duwA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    8e-30  38%  1suiA  [x.x.x] CAFFEOYL-COA O-METHYLTRANSFERASE
    5e-28  42%  3dulA  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    6e-28  43%  3dulB  [x.x.x] O-METHYLTRANSFERASE, PUTATIVE
    4e-25  32%  3c3yA  [x.x.x] O-METHYLTRANSFERASE
    3e-14  38%  2gpyB  [x.x.x] O-METHYLTRANSFERASE
    7e-13  38%  2gpyA  [x.x.x] O-METHYLTRANSFERASE
    6e-10  28%  3bwmA  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    1e-09  28%  3bwyA  [x.x.x] COMT PROTEIN
    3e-09  26%  2zthA  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    3e-09  26%  1vidA  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    3e-09  26%  1jr4A  [c.66.1] CATECHOL O-METHYLTRANSFERASE, SOLUBLE FORM
    3e-09  26%  3hvhA  [c.66.1 (1h1dA)] CATECHOL O-METHYLTRANSFERASE
    3e-09  26%  2cl5B  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    3e-09  26%  2cl5A  [x.x.x] CATECHOL O-METHYLTRANSFERASE
    9e-05  24%  1o54A  [c.66.1] SAM-DEPENDENT O-METHYLTRANSFERASE
    1e-04  29%  1vq1B  [x.x.x] N5-GLUTAMINE METHYLTRANSFERASE, HEMK
    1e-04  29%  1vq1A  [x.x.x] N5-GLUTAMINE METHYLTRANSFERASE, HEMK
    1e-04  29%  1sg9A  [c.66.1] HEMK PROTEIN
    1e-04  29%  1nv9A  [c.66.1] HEMK PROTEIN
    1e-04  29%  1nv8B  [c.66.1] HEMK PROTEIN
    1e-04  29%  1nv8A  [c.66.1] HEMK PROTEIN
    6e-04  23%  1dl5B  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
    6e-04  23%  1dl5A  [c.66.1 - d.197.1] PROTEIN-L-ISOASPARTATE O-METHYLTRANSFERASE
:219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xTRTSENLSPELHAYLVAHSTPVDEVLTDLAAETERLFPDHVGMQIAPEQGLFLTLLTQLIGARNIVEVG
3cbgA           ---------PSLYSYLQSISADDSFYLAQLRRETAHL--PGAPMQISPEQAQFLGLLISLTGAKQVLEIG
2hnkC           --RKNISLTESLEEYIFRNSVREPDSFLKLRKETGTLA--QANMQISPEEGQFLNILTKISGAKRIIEIG
2hnkB           -SRKNISLTESLEEYIFRNSVREPDSFLKLRKETGTLAQN---MQISPEEGQFLNILTKISGAKRIIEIG
2hnkA           --RKNISLTESLEEYIFRNSVREPDSFLKLRKETGTL-----NMQISPEEGQFLNILTKISGAKRIIEIG
2avdA           ------------------------------------------------EQAQLLANLARLIQAKKALDLG
3duwA           ---------------LIPKDSTLEEVLQVNAAAN---LPAH---DVSPTQGKFLQLLVQIQGARNILEIG
1suiA           -------------------------------------------MTTSADEGQFLSMLLKLINAKNTMEIG
3dulA           ---------------LIPKDSTLEEVLQVNAAAN---LPAH---DVSPTQGKFLQLLVQIQGARNILEIG
3dulB           ---------------LIPKDSTLEEVLQVNAAAN---LPAH---DVSPTQGKFLQLLVQIQGARNILEIG
3c3yA           --------SEELCQYILRTSVPREAGFLKELREANESHPDSY-MSTSPLAGQLMSFVLKLVNAKKTIEVG
2gpyB           -----------------------------------------------------------------ILEIG
2gpyA           -----------------------------------------------------------------ILEIG
3bwmA           -------------------------------------------MNVGDKKGKIVDAVIQEHQPSVLLELG
3bwyA           -------------------------------------------MNVGDKKGKIVDAVIQEHQPSVLLELG
2zthA           --------------------------------------------QVGDAKGQIMDAVIREYSPSLVLELG
1vidA           -------------------------------------------MNVGDAKGQIMDAVIREYSPSLVLELG
1jr4A           -------------------------------------------MNVGDAKGQIMDAVIREYSPSLVLELG
3hvhA           -------------------------------------------MNVGDAKGQIMDAVIREYSPSLVLELG
2cl5B           -------------------------------------------MNVGDAKGQIMDAVIREYSPSLVLELG
2cl5A           -------------------------------------------MNVGDAKGQIMDAVIREYSPSLVLELG
1o54A           ---------------------------------------------VYPKDSSFIAMMLDVKEGDRIIDTG
1vq1B           -------------------------------------------------------------GIKTVADIG
1vq1A           -------------------------------------------------------------GIKTVADIG
1sg9A           -------------------------------------------------------------GIKTVADIG
1nv9A           -------------------------------------------------------------GIKTVADIG
1nv8B           -------------------------------------------------------------GIKTVADIG
1nv8A           -------------------------------------------------------------GIKTVADIG
1dl5B           -----------------------------------------------------------------VLEIG
1dl5A           -----------------------------------------------------------------VLEIG


                         .         .         *         .         .         .         .:140
query           TFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRLAPALDTLRALPEEPQFDLAF
3cbgA           VFRGYSALAMALQLPPDGQIIACDQDPNATAIAKKYWQKAGVAEKISLRLGPALATLEQLTQGPEFDLIF
2hnkC           TFTGYSSLCFASALPEDGKILCCDVSEEWTNVARKYWKENGLENKIFLKLGSALETLQVLIDSSSIDLFF
2hnkB           TFTGYSSLCFASALPEDGKILCCDVSEEWTNVARKYWKENGLENKIFLKLGSALETLQVLIDSSSIDLFF
2hnkA           TFTGYSSLCFASALPEDGKILCCDVSEEWTNVARKYWKENGLENKIFLKLGSALETLQVLIDSSSIDLFF
2avdA           TFTGYSXXXXXXXXPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELGEAGTFDVAV
3duwA           TLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEEPFDFIF
1suiA           VYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVDHKIDFREGPALPVLDEMIKDEKYDFIF
3dulA           TLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEEPFDFIF
3dulB           TLGGYSTIWLARGLSSGGRVVTLEASEKHADIARSNIERANLNDRVEVRTGLALDSLQQIENEEPFDFIF
3c3yA           VFTGYSLLLTALSIPDDGKITAIDFDREAYEIGLPFIRKAGVEHKINFIESDAMNLLQGQESEGSYDFGF
2gpyB           TAIGYSAI-RAQALP-EATIVSIERDERRYEEAHKHVKALGLESRIELLFGDALQLGEKLELYPLFDVLF
2gpyA           TAIGYSAI-RAQALP-EATIVSIERDERRYEEAHKHVKALGLESRIELLFGDALQLGEKLELYPLFDVLF
3bwmA           AYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKDTLDMVF
3bwyA           AYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGMKDKVTLVVGASQDIIPQLKKKDTLDMVF
2zthA           AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKDTLDMVF
1vidA           AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKDTLDMVF
1jr4A           AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKDTLDMVF
3hvhA           AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKDTLDMVF
2cl5B           AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKDTLDMVF
2cl5A           AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKDTLDMVF
1o54A           VGSGAMCAVLARAVGSSGKVFAYEKREEFAKLAESNLTKWGLIERVTIKVRDISEGF----DEKDVDALF
1vq1B           TGSGAIGVSVAKF--SDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFK------------
1vq1A           TGSGAIGVSVAKF--SDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFK------------
1sg9A           TGSGAIGVSVAKF--SDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFK------------
1nv9A           TGSGAIGVSVAKF--SDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFK------------
1nv8B           TGSGAIGVSVAKF--SDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFK------------
1nv8A           TGSGAIGVSVAKF--SDAIVFATDVSSKAVEIARKNAERHGVSDRFFVRKGEFLEPFK------------
1dl5B           GGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFV----CGDGYYGVPEFSPYDVIF
1dl5A           GGTGYNAAVMSRVVGEKGLVVSVEYSRKICEIAKRNVERLGIENVIFV----CGDGYYGVPEFSPYDVIF


                         +         .         .         .         .         *         .:210
query           IDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPAQTAARVQAIRDFNVHARDDTRVDLVILPIG
3cbgA           IDADKRNYPRYYEIGLNLLRRGGLMVIDNVLWHGKVTEVDPQEAQTQVLQQFNRDLAQDERVRISVIPLG
2hnkC           LDADKENYPNXXXXXXXXXXXXXXXXADNVLWDGSVADLSHQEPSTVGIRKFNELVYNDSLVDVSLVPIA
2hnkB           LDADKENYPNXXXXXXXXXXXXXXXXADNVLWDGSVADLSHQEPSTVGIRKFNELVYNDSLVDVSLVPIA
2hnkA           LDADKENYPNXXXXXXXXXXXXXXXXADNVLWDGSVADLSHQEPSTVGIRKFNELVYNDSLVDVSLVPIA
2avdA           VDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLG
3duwA           IDADKQNNPAYFEWALKLSRPGTVIIGDNVVREGEVIDNTSNDPRVQGIRRFYELIAAEPRVSATAL---
1suiA           VDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAVDPRIEICMLPVG
3dulA           IDADKQNNPAYFEWALKLSRPGTVIIGDNVVRIRRFYELIAAEPRVSA----------------------
3dulB           IDADKQNNPAYFEWALKLSRPGTVIIGDNVVREGEVI---------------------------------
3c3yA           VDADKPNYIKYHERLMKLVKVGGIVAYDNTLWGGTVAQPESEVENREAVIELNKLLAADPRIEIVHLPLG
2gpyB           IDAAKGQYRRFFD--YSPVRPGGLILSDNVLFNQWLLE----------------HPQYDTR----IFPVG
2gpyA           IDAAKGQYRRFFD--YSPVRPGGLILSDNVL-----------------FQWLLEHPQYDTR----IFPVG
3bwmA           LDHWKDRYLTLLLEECGLLRKGTVLLADNV----------------------------------------
3bwyA           LDHWKDRYLTLLLEECGLLRKGTVLLADNV----------------------------------------
2zthA           LDHWKDRYLTLLLEKCGLLRKGTVLLADNV----------------------------------------
1vidA           LDHWKDRYLTLLLEKCGLLRKGTVLLADNV----------------------------------------
1jr4A           LDHWKDRYLTLLLEKCGLLRKGTVLLADNV----------------------------------------
3hvhA           LDHWKDRYLTLLLEKCGLLRKGTVLLADNV----------------------------------------
2cl5B           LDHWKDRYLTLLLEKCGLLRKGTVLLADNV----------------------------------------
2cl5A           LDHWKDRYLTLLLEKCGLLRKGTVLLADNV----------------------------------------
1o54A           LDVDPWNYIKCWEAL-------------------------------------------------------
1vq1B           ----------------------------------------------------------------------
1vq1A           ----------------------------------------------------------------------
1sg9A           ----------------------------------------------------------------------
1nv9A           ----------------------------------------------------------------------
1nv8B           ----------------------------------------------------------------------
1nv8A           ----------------------------------------------------------------------
1dl5B           VTVGVDEVPETW----------------------------------------------------------
1dl5A           VTVGVDEVPETW----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           DGFTLARRR
3cbgA           DGMTLALKK
2hnkC           DGVSLVRKR
2hnkB           DGVSLVRKR
2hnkA           DGVSLVRKR
2avdA           DGLTLA---
3duwA           ---------
1suiA           DGITICRR-
3dulA           ---------
3dulB           ---------
3c3yA           DGITFCRR-
2gpyB           DGIAISIKR
2gpyA           DGIAISIKR
3bwmA           ---------
3bwyA           ---------
2zthA           ---------
1vidA           ---------
1jr4A           ---------
3hvhA           ---------
2cl5B           ---------
2cl5A           ---------
1o54A           ---------
1vq1B           ---------
1vq1A           ---------
1sg9A           ---------
1nv9A           ---------
1nv8B           ---------
1nv8A           ---------
1dl5B           ---------
1dl5A           ---------