[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55025.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1s7bB.bssp"
#ERROR : Can't open dsspfile "2f2mA.bssp"
#ERROR : Can't open dsspfile "2i68A.bssp"

## Summary of PDB Search
:107
    3e-14  44%  1s7bB  [f.39.1] EMRE PROTEIN
    5e-14  44%  2f2mA  [f.39.1 (1s7bA)] PROTEIN EMRE
    3e-06  47%  2i68A  [x.x.x] PROTEIN EMRE
:107

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxWLLLIGAILTEVTGTISLRLSDGFTRLVPSLIALTSYGIAFTLLAQVLKLGMGVGVAYGIWSALGVTL
1s7bB           --YIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAY-IPTGIAYAIWSGVGIVL
2f2mA           ---IYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAY-IPTGIAYAIWSGVGIVL
2i68A           --YIYLGGAILAEVIGT---------TLMVGTIIC---YCASFWLLAQTL------AIAYAIWSGVGIVL


                         .         .         *         .         .         .         .:140
query           VAVIGAVFLGDTLxxxxxxxxxxxxxxxxxxxxxxxx
1s7bB           ISLLSWGFFGQRL------------------------
2f2mA           ISLLSWGFFGQRL------------------------
2i68A           ISLLSWGFFG---------------------------