[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55194.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ka9F.bssp"
#ERROR : Can't open dsspfile "1h5yB.bssp"
#ERROR : Can't open dsspfile "1h5yA.bssp"
#ERROR : Can't open dsspfile "1vh7A.bssp"
#ERROR : Can't open dsspfile "2a0nA.bssp"
#ERROR : Can't open dsspfile "1thfD.bssp"
#ERROR : Can't open dsspfile "1gpwA.bssp"
#ERROR : Can't open dsspfile "1gpwE.bssp"
#ERROR : Can't open dsspfile "2rkxA.bssp"
#ERROR : Can't open dsspfile "1jvnA.bssp"
#ERROR : Can't open dsspfile "1ox4A.bssp"
#ERROR : Can't open dsspfile "1ox6A.bssp"
#ERROR : Can't open dsspfile "1ox4B.bssp"
#ERROR : Can't open dsspfile "1ox5B.bssp"
#ERROR : Can't open dsspfile "1ox5A.bssp"
#ERROR : Can't open dsspfile "3cwoX.bssp"
#ERROR : Can't open dsspfile "2w6rA.bssp"
#ERROR : Can't open dsspfile "2vepA.bssp"
#ERROR : Can't open dsspfile "1qo2A.bssp"
#ERROR : Can't open dsspfile "2cffA.bssp"
#ERROR : Can't open dsspfile "2w79B.bssp"
#ERROR : Can't open dsspfile "2w79A.bssp"
#ERROR : Can't open dsspfile "1vzwA.bssp"
#ERROR : Can't open dsspfile "1ep3A.bssp"
#ERROR : Can't open dsspfile "1ep2A.bssp"
#ERROR : Can't open dsspfile "1ep1A.bssp"
#ERROR : Can't open dsspfile "3hojA.bssp"
#ERROR : Can't open dsspfile "1nfbA.bssp"
#ERROR : Can't open dsspfile "1nf7A.bssp"
#ERROR : Can't open dsspfile "3b5vA.bssp"
#ERROR : Can't open dsspfile "1b3oB.bssp"

## Summary of PDB Search
:256
    3e-76  65%  1ka9F  [c.1.2] IMIDAZOLE GLYCEROL PHOSPHTATE SYNTHASE
    2e-72  60%  1h5yB  [c.1.2] HISF
    2e-72  60%  1h5yA  [c.1.2] HISF
    3e-67  58%  1vh7A  [c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    3e-67  58%  2a0nA  [x.x.x] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    6e-67  58%  1thfD  [c.1.2] HISF PROTEIN
    1e-66  58%  1gpwA  [c.1.2] HISF PROTEIN
    2e-64  58%  1gpwE  [c.1.2] HISF PROTEIN
    2e-60  49%  2rkxA  [x.x.x] CYCLASE SUBUNIT OF
    4e-38  45%  1jvnA  [c.23.16 - c.1.2] BIFUNCTIONAL HISTIDINE BIOSYNTHESIS PROTEIN
    2e-37  45%  1ox4A  [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF
    4e-37  44%  1ox6A  [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF
    6e-37  45%  1ox4B  [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF
    8e-37  43%  1ox5B  [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF
    8e-37  43%  1ox5A  [c.23.16 - c.1.2] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE HISHF
    2e-34  56%  3cwoX  [x.x.x] BETA/ALPHA-BARREL PROTEIN BASED ON 1THF AND 1TMY
    4e-22  38%  2w6rA  [x.x.x] IMIDAZOLE GLYCEROL PHOSPHATE SYNTHASE SUBUNIT
    2e-13  24%  2vepA  [x.x.x] PHOSPHORIBOSYL ISOMERASE A
    4e-12  26%  1qo2A  [c.1.2]
    7e-12  27%  2cffA  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    5e-11  26%  2w79B  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    1e-10  26%  2w79A  [x.x.x] 1-(5-PHOSPHORIBOSYL)-5-[(5-PHOSPHORIBOSYLAMINO)
    5e-10  24%  1vzwA  [x.x.x] PHOSPHORIBOSYL ISOMERASE A
    1e-04  34%  1ep3A  [c.1.4] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    1e-04  34%  1ep2A  [c.1.4] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    1e-04  34%  1ep1A  [c.1.4] DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)
    2e-04  24%  3hojA  [x.x.x] RETROALDOLASE-22
    4e-04  30%  1nfbA  [c.1.5 - d.37.1 - d.37.1] INOSINE-5'-MONOPHOSPHATE
    4e-04  30%  1nf7A  [c.1.5 - d.37.1 - d.37.1] INOSINE-5'-MONOPHOSPHATE
    4e-04  24%  3b5vA  [x.x.x] RETROALDOLASE-22
    4e-04  30%  1b3oB  [c.1.5 - d.37.1 - d.37.1] PROTEIN (INOSINE MONOPHOSPHATE
:256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSLAVRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNRETTYDVVRRT
1ka9F           -SLAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAILLDVVARV
1h5yB           --MALRIIPCLDIDGGAVVKGVNFQGIREVGDPVEMAVRYEEEGADEIAILDITAAPEGRATFIDSVKRV
1h5yA           --MALRIIPCLDIDGGAVVKGVNFQGIREVGDPVEMAVRYEEEGADEIAILDITAAPEGRATFIDSVKRV
1vh7A           --LAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
2a0nA           --LAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
1thfD           --LAKRIIACLDVKDGRVVKGSNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
1gpwA           --LAKRIIACLNVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
1gpwE           --LAKRIIACLNVKDGRVVK--NFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
2rkxA           --LAKRIIAALIVKDGRVVKGSNFENLRDSGDPVELGKFYSEIGIDELSFWDITASVEKRKTMLELVEKV
1jvnA           --LTRRIIACLDVDQGDLVKG-------DLGKPVQLAQKYYQQGADEVTFLNITDCPLKDTPMLEVLKQA
1ox4A           --LTRRIIACLDVDQGDLVKG-------DLGKPVQLAQKYYQQGADEVTFLNITCPLKDTPML-EVLKQA
1ox6A           --LTRRIIACLDVDQGDLVV---------LGKPVQLAQKYYQQGADEVTFLNITDCPLKDTPMLEVLKQA
1ox4B           --LTRRIIACLDVDQGDLVKG-------DLGKPVQLAQKYYQQGADEVTFLNITSFRDKDTPMLEVLKQA
1ox5B           --LTRRIIACLDVDQGDLV-------VTKLGKPVQLAQKYYQQGADEVTFLNITCPLKDTPML-EVLKQA
1ox5A           --LTRRIIACLDVDQGDLV-------VTKLGKPVQLAQKYYQQGADEVTFLNITCPLKDTPML-EVLKQA
3cwoX           ----------------------------------------------------------------------
2w6rA           ----------------------------------------EKRGAGELTSIDRDGTKSGYDT--EMIRFV
2vepA           ----LELLPAVDVRDGQAVRLVHGESGTETGSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRA-LIAEV
1qo2A           ------VVPAIDLFRGKVIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKL
2cffA           ------VVPAIDLFRGKVIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKL
2w79B           ------VVPAIDLFRGKVIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKL
2w79A           ------VVPAIDLFRGKVIKGRKENTIFYEKDPVELVEKLIEEGFTLIHVVDLSNAIENSGENLPVLEKL
1vzwA           ----LELLPAVDVRDGQAVRETSY------GSPLEAALAWQRSGAEWLHLVDLDAAFGTGDNRA-LIAEV
1ep3A           -------------------------------DIVPIAKAVEAAGADGLTMINITGGLSGKPVALKLIHQV
1ep2A           -------------------------------DIVPIAKAVEAAGADGLTMINITGGLSGKPVALKLIHQV
1ep1A           -------------------------------DIVPIAKAVEAAGADGLTMINITGGLSGKPVALKLIHQV
3hojA           -------------------------------DPIEYSKFMERYAVG----LSITTEEKYFNGSYETLRKI
1nfbA           --------PNLQVIGGNVVTAAQAKNLIDAG--VDALRVGMGSGSICIT-QEVLACGRPQATAVYKVSEY
1nf7A           --------PNLQVIGGNVVTAAQAKNLIDAG--VDALRVGMGSGSICIT-QEVLACGRPQATAVYKVSEY
3b5vA           -------------------------------DPIEYSKFMERYAVG----LSITTEAKYFNGSYETLRAI
1b3oB           --------PNLQVIGGNVVTAAQAKNLIDAG--VDALRVGMGSGSICIT-QEVLACGRPQATAVYKVSEY


                         .         .         *         .         .         .         .:140
query           AEQVFIPLTVGGGVRSTEDVDRLLRAGADKVSINTAAVRRPELIREIAQEFGSQVLVLSADVRRTVNGTA
1ka9F           AERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHFGAQAVVLAIDARWRGDFP-
1h5yB           AEAVSIPVLVGGGVRSLEDATTLFRAGADKVSVNTAAVRNPQLVALLAREFGSQSTVVAIDAK--WNG--
1h5yA           AEAVSIPVLVGGGVRSLEDATTLFRAGADKVSVNTAAVRNPQLVALLAREFGSQSTVVAIDAK--WNG--
1vh7A           AEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKR-VDGE-
2a0nA           AEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKR-VDGE-
1thfD           AEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKR-VDGE-
1gpwA           AEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKR-VDGE-
1gpwE           AEQIDIPFTVGGGIHDFETASELILRGADKVSINTAAVENPSLITQIAQTFGSQAVVVAIDAKR-VDGE-
2rkxA           AEQIDIPFTVGGGIHDFETASELILRGADKVEINTAAVENPSLITQIAQTFGSQAVVVYIAAKR-VDGE-
1jvnA           AKTVFVPLTXXXXIPALEVASLYFRSGADKVSIGTDAVYAAEKIETISKAYGAQAVVISVDPKRVVNSQA
1ox4A           AKTVFVPLTXXXXIPALEVASLYFRSGADKVSIGTDAVYAAEKIETISKAYGAQAVVISVDPKRVVNSQA
1ox6A           AKTVFVPLTXXXXIPALEVASLYFRSGADKVSIGTDAVYAAEKIETISKAYGAQAVVISVDPKRVVNSQA
1ox4B           AKTVFVPLTXXXXIPALEVASLYFRSGADKVSIGTDAVYAAEKIETISKAYGAQAVVISVDPKRVVNSQA
1ox5B           AKTVFVPLTXXXXIPALEVASLYFRSGADKVSIGTDAVYAAEKIETISKAYGAQAVVISVDPKRVVNSQA
1ox5A           AKTVFVPLTXXXXIPALEVASLYFRSGADKVSIGTDAVYAAEKIETISKAYGAQAVVISVDPKRVVNSQA
3cwoX           -----------------------IKAGAKDFIVNTAAVENPSLITQIAQTFGSQAVVVAIDAKR-VDGE-
2w6rA           RPLTTLPIIASGGAGKMEHFLEXXXXXXXXXXXXSVFMRE---LKEYLKS--GQAVVVAIDAKR-VDGE-
2vepA           AQAMDIKVELSGGIRXXXXXXXXXXXGCTRVNLGTAALETPEWVAKVIAEHGDKIAV-GLDVXXXXXXXX
1qo2A           SEFAE-HIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSL-REIDVEP-VFSLDTR-------
2cffA           SEFAE-HIQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSFLKSLRE----------IDVEPV-----
2w79B           SEFAEY-IQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSSLKSLRE----------IDVEPV-----
2w79A           SEFAEY-IQIGGGIRSLDYAEKLRKLGYRRQIVSSKVLEDPSSLKSLRE----------IDVEPV-----
1vzwA           AQAMDIKVELSGGIRXXXXXXXXXXXGCTRVNLGTAALETPEWVAKVIAEHGDKIAV-GLDVXXXXXXXX
1ep3A           AQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADP-----------------------------
1ep2A           AQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADP-----------------------------
1ep1A           AQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADP-----------------------------
3hojA           ASSVSIPILMADFIVKESQIDDAYNLGADTVAVKILTERELESLLEYARSYGMEPLIKIND---------
1nfbA           ARRFGVPVIADGGIQNVGHIAKALALGASTVMMGS-----------------------------------
1nf7A           ARRFGVPVIADGGIQNVGHIAKALALGASTVMMGS-----------------------------------
3b5vA           ASSVSIPILMADFIVKESQIDDAYNLGADTVALIVAILTEAELLLAYARSYGMEPLIKIND---------
1b3oB           ARRFGVPVIADGGIQNVGHIAKALALGASTVMMGS-----------------------------------


                         +         .         .         .         .         *         .:210
query           TPSGFEITTHGGRQGTGIDAVEWVQQAEELGAGEILLNSMDADGTKSGFDLELIRAVRKAVNVPLIASGG
1ka9F           -----EVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGTKEGYDLRLTRMVAEAVGVPVIASGG
1h5yB           --EYYEVYVKGGREATGLDAVKWAKEVEELGAGEILLTSIDRDGTGLGYDVELIRRVADSVRIPVIASGG
1h5yA           --EYYEVYVKGGREATGLDAVKWAKEVEELGAGEILLTSIDRDGTGLGYDVELIRRVADSVRIPVIASGG
1vh7A           ----FMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
2a0nA           ----FMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
1thfD           ----FMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
1gpwA           ----FMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
1gpwE           ----FMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
2rkxA           ----FMVFTYSGKKNTGILLRDWVVEVEKRGAGEIVLGSIDRLGTKSGYDTEMIRFVRPLTTLPIIAHGG
1jvnA           DPNGYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSNSGYDLELIEHVKDAVKIPVIASSG
1ox4A           DPNGYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSNSGYDLELIEHVKDAVKIPVIASSG
1ox6A           DPNGYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSNSGYDLELIEHVKDAVKIPVIASSG
1ox4B           DPNGYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSNSGYDLELIEHVKDAVKIPVIASSG
1ox5B           DPNGYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSNSGYDLELIEHVKDAVKIPVIASSG
1ox5A           DPNGYQCTIKGGRESRDLGVWELTRACEALGAGEILLNCIDKDGSNSGYDLELIEHVKDAVKIPVIASSG
3cwoX           ----FMVFTYSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
2w6rA           ----FMVFTHSGKKNTGILLRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFVRPLTTLPIIASGG
2vepA           XXXXXXXXXY-----------ETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVCAATDRPVVASGG
1qo2A           ---GGRVAFKGWLAEEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGG
2cffA           ----FSLVTRGGRVAEEIDPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAIEAEVKVLAAGG
2w79B           ----FSLVTRGGRVAAEIDPVSLLKRLKEYGLEEIVHTEIEKVGTLQEHDFSLTKKIAIEAEVKVLAAGG
2w79A           ----FSLVTRGGRVAEEIDPVSLLKRLKEYGLEEIVHTEIEKVGTLQEHDFSLTKKIAIEAEVKVLAAGG
1vzwA           XXXXXXXXXY-----------ETLDRLNKEGCARYVV-------TDIGPNLELLKNVCAATDRPVVASGG
1ep3A           ----------------------------------------------------------------------
1ep2A           ----------------------------------------------------------------------
1ep1A           ----------------------------------------------------------------------
3hojA           -ENDLDIALRIGARFIGIVSADW-----------------------------------------------
1nfbA           ----------------------------------------------------------------------
1nf7A           ----------------------------------------------------------------------
3b5vA           -ENDLDIALRIGARFIGIVSADW-----------------------------------------------
1b3oB           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AGAVEHFXXXXXXXXXXXXXXXXFHFGEITISDVKAELRAKGYPVR
1ka9F           AGRMEHXXXXXXXXXXXXXXXSVFHFGEIPIPKLKRYLAEKGVHVR
1h5yB           AGRVEHFYEXXXXXXXXXXXXSLFHFRVLSIAQVKRYLKERGVEVR
1h5yA           AGRVEHFYEXXXXXXXXXXXXSLFHFRVLSIAQVKRYLKERGVEVR
1vh7A           AGKMEHFXXXXXXXXXXXXXXSVFHFREIDVRELKEYLKKHGVNVR
2a0nA           AGKMEHFXXXXXXXXXXXXXXSVFHFREIDVRELKEYLKKHGVNVR
1thfD           AGKMEHFXXXXXXXXXXXXXXSVFHFREIDVRELKEYLKKHGVNVR
1gpwA           AGKMEHFXXXXXXXXXXXXXXSVFHFREIDVRELKEYLKKHGVNVR
1gpwE           AGKMEHFXXXXXXXXXXXXXXSVFHFREIDVRELKEYLKKHGVNVR
2rkxA           AGKMEHFLEAFLAGADAAKANSVFHFREIDVRELKEYLKKHGVNVR
1jvnA           AGVPEHFEAFLKTRADACLGAGMFHRGEFTVNDVKEYLLEHGLKVR
1ox4A           AGVPEHFEAFLKTRADACLGAGMFHRGEFTVNDVKEYLLEHGLKVR
1ox6A           AGVPEHFEAFLKTRADACLGAGMFHRGEFTVNDVKEYLLEHGLKVR
1ox4B           AGVPEHFEAFLKTRADACLGAGMFHRGEFTVNDVKEYLLEHGLKVR
1ox5B           AGVPEHFEAFLKTRADACLGAGMFHRGEFTVNDVKEYLLEHGLKVR
1ox5A           AGVPEHFEAFLKTRADACLGAGMFHRGEFTVNDVKEYLLEHGLKVR
3cwoX           AGKMEHFXXXXXXXXXXXXXXSVFHFREIDVRELKEYLKKHGVNVR
2w6rA           AGKMEHF---------------------------------------
2vepA           VSSLD-----------------------------------------
1qo2A           ----------------------------------------------
2cffA           ----------------------------------------------
2w79B           ----------------------------------------------
2w79A           ----------------------------------------------
1vzwA           VSSLD-----------------------------------------
1ep3A           ----------------------------------------------
1ep2A           ----------------------------------------------
1ep1A           ----------------------------------------------
3hojA           ----------------------------------------------
1nfbA           ----------------------------------------------
1nf7A           ----------------------------------------------
3b5vA           ----------------------------------------------
1b3oB           ----------------------------------------------