[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55274.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1rttA.bssp"
#ERROR : Can't open dsspfile "1t0iB.bssp"
#ERROR : Can't open dsspfile "1t0iA.bssp"

## Summary of PDB Search
:227
    4e-09  36%  1rttA  [c.23.5] CONSERVED HYPOTHETICAL PROTEIN
    6e-09  46%  1t0iB  [c.23.5] YLR011WP
    6e-09  46%  1t0iA  [c.23.5] YLR011WP
:227

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1rttA           ----------------------------------------------------------------------
1t0iB           ----------------------------------------------------------------------
1t0iA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxLSRLTPRLRRADMFVFVVPEYNRSFPASVKSLIDWHTAEWEAKPVGFVSYGGRSGGLRA
1rttA           -----------VERFREQIRAADALLFATPEYNYSMAGVLKNAIDWASQPFSGKPAAILASAGRFGTARA
1t0iB           ----------------------DIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGH-GGSKC
1t0iA           ----------------------DIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGH-GGSKC


                         +         .         .         .         .         *         .:210
query           VEHLGQVFTELHAVTVRNTVSFHSVEEQFDSEGRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1rttA           QYHLRQVFLDVHPLN-KPEVMISSAQNAFDAQGR------------------------------------
1t0iB           NDQLQEV---------------------------------------------------------------
1t0iA           NDQLQEV---------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxx
1rttA           -----------------
1t0iB           -----------------
1t0iA           -----------------