[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55328.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3hutA.bssp"
#ERROR : Can't open dsspfile "1usgA.bssp"
#ERROR : Can't open dsspfile "2lbpA.bssp"
#ERROR : Can't open dsspfile "1z15A.bssp"
#ERROR : Can't open dsspfile "2livA.bssp"
#ERROR : Can't open dsspfile "1qo0B.bssp"
#ERROR : Can't open dsspfile "1qo0A.bssp"
#ERROR : Can't open dsspfile "1qnlA.bssp"
#ERROR : Can't open dsspfile "1peaA.bssp"
#ERROR : Can't open dsspfile "3i45A.bssp"

## Summary of PDB Search
:392
    6e-15  26%  3hutA  [x.x.x] PUTATIVE BRANCHED-CHAIN AMINO ACID ABC
    2e-12  23%  1usgA  [c.93.1] LEUCINE-SPECIFIC BINDING PROTEIN
    2e-12  23%  2lbpA  [x.x.x] LEUCINE-BINDING PROTEIN
    3e-12  24%  1z15A  [x.x.x] LEU/ILE/VAL-BINDING PROTEIN
    3e-12  24%  2livA  [x.x.x] LEUCINE
    5e-10  25%  1qo0B  [c.93.1] AMIC
    5e-10  25%  1qo0A  [c.93.1] AMIC
    5e-10  25%  1qnlA  [c.93.1] ALIPHATIC AMIDASE EXPRESSION-REGULATING PROTEIN
    5e-10  25%  1peaA  [x.x.x] AMIDASE OPERON
    8e-10  25%  3i45A  [x.x.x] TWIN-ARGININE TRANSLOCATION PATHWAY SIGNAL
:392

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDTIKIMSIKEMTGPVSFAGENSTKGIDL
3hutA           ----------------------------------------------------LTGANAAYGRVFQEAARL
1usgA           ------------------------------------------DDIKVAVVGAMSGPIAQWGDMEFNGARQ
2lbpA           ------------------------------------------DDIKVAVVGAMSGPIAQWGIMEFNGAEQ
1z15A           ------------------------------------------EDIKVAVVGAMSGPVAQYGDQEFTGAEQ
2livA           ------------------------------------------EDIKVAVVGAMSGPVAQYGDQEFTGAEQ
1qo0B           -----------------------------------------------------TGVTADIERSQRYGALL
1qo0A           -----------------------------------------------------TGVTADIERSQRYGALL
1qnlA           -----------------------------------------------------TGVTADIERSQRYGALL
1peaA           -----------------------------------------------------TGVTADIERSQRYGALL
3i45A           ------------------------------------------------------------------GWQL


                         .         .         *         .         .         .         .:140
query           AVEQINEQGFLGDTKLEIDLKDASDSTQEAASLATQAVSDKSYSAILGPGLSSQASAISPIAEKGEIPVI
3hutA           QLDRFNAAGGVGGRPVDILYADSRDDADQARTIARAFVDDPRVVGVLGD-FSSTVSAAGSIYGKEGPQLS
1usgA           AIKDINAKGGIGDKLVGVEYDDACDPKQ-AVAVANKIVND-GIKYVIGHLCSSSTQPASDIYEDEGILMI
2lbpA           AIKDINAKGGIGDKLVGVEYDDACDPKQ-AVAVANKIVND-GIKYVIGHLCSSSTQPASDIYEDEGILMI
1z15A           AVADINAKGGIKGNKLQIKYDDACDPKQXXXXXXXXXXDGIKY--VIGHLCSSSTQPASDIYEDEGILMI
2livA           AVADINAKGGIKGNKLQIKYDDACDPKQXXXXXXXXXXDGIKY--VIGHLCSSSTQPASDIYEDEGILMI
1qo0B           AVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLC
1qo0A           AVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLC
1qnlA           AVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLC
1peaA           AVEQLNREGGVGGRPIETLSQDPGGDPDRYRLCAEDFIRNRGVRFLVGCYMSHTRKAVMPVVERADALLC
3i45A           AVEQINAAGLLGGRPLEVISRDDGGDPGKAVTAAQELLTRHGVHALAGTFLSHVGLAVSDFARQRKVLFM


                         +         .         .         .         .         *         .:210
query           YYQAGSDGVLVGDYTYRVTAPAASYYHIIGDYLAEKKVKTAAVLYTSGNPTLTELGEKAVPGVIEENGVT
3hutA           PTAAHPDYIKISPWQFRITTPAPNNAAWIGDGFT-----SVAVIGVTTDWGLSSA--QAFRKAFELRGGA
1usgA           SPGATNPELTQRGYQHRTAGLDSSQGPTAAKYILE-TVKPQRIAIIHDKQQYGEGLARSVQDGLKAANAN
2lbpA           SPGATAPELTQRGYQHRTAGLDSSQGPTAAKYILE-TVKPQRIAIIHDKQQYGEGLARSVQDGLKAANAN
1z15A           TPAATAPELTARGYILRTTGLDSDQGPTAAKYILE-KVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNAN
2livA           TPAATAPELTARGYILRTTGLDSDQGPTAAKYILE-KVKPQRIAIVHDKQQYGEGLARAVQDGLKKGNAN
1qo0B           YFEYSPNIVYGGPAPNQNSAPLAAY--LIRHY-GERVVFIGSIYPRESNHVMRHLYRQHGGTVLEEIYIP
1qo0A           YFEYSPNIVYGGPAPNQNSAPLAAY--LIRHY-GERVVFIGSIYPRESNHVMRHLYRQHGGTVLEEIYIP
1qnlA           YFEYSPNIVYGGPAPNQNSAPLAAY--LIRHY-GERVVFIGSIYPRESNHVMRHLYRQHGGTVLEEIYIP
1peaA           YFEYSPNIVYGGPAPNQNSAPLAAY--LIRHY-GERVVFIGSIYPRESNHVMRHLYRQHGGTVLEEIYIP
3i45A           ASEPLTDALTWNRYTYRLRP--STYMQXXXXXXXXXKLPTIAPNYEYGQSAVARFKELLLAARPE---VT


                         .         .         .         +         .         .         .:280
query           IKRSDTVSNDTQDFTAVTSEIIKADPDAVFLLLLGPQNPRAVSQLKQKGYDGEIIGMTTMGAGNLETAGE
3hutA           VVVNEEVPPGNRRFDDVIDEIEDEAPQAIYLAAYEDAAP-FLRALRARGSALPVYGSSALYSPKIDLGGP
1usgA           VVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAG
2lbpA           VVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVGLKTQFMGPEGVGNASLSNIAG
1z15A           VVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNAGE
2livA           VVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAGLKTQFMGPEGVANVSLSNAGE
1qo0B           LYPSD------DDLQRAVERIYQARADVVFSTVVGTGTARAIARRYGDGRRPPIASLTTSEAEVAKMESD
1qo0A           LYPSD------DDLQRAVERIYQARADVVFSTVVGTGTARAIARRYGDGRRPPIASLTTSEAEVAKMESD
1qnlA           LYPSD------DDLQRAVERIYQARADVVFSTVVGTGTARAIARRYGDGRRPPIASLTTSEAEVAKMESD
1peaA           LYPSD------DDLQRAVERIYQARADVVFSTVVGTGTARAIARRYGDGRRPPIASLTTSEAEVAKMESD
3i45A           FVAEQWPALYKLDAGPTVQALQQAEPEGLFNVLFGADLPKFVREGRVRGLFAQVVSMLTGEPEYLNPLKD


                         .         *         .         .         .         .         +:350
query           DAAGVVWPSNFSARSEVPSTQEFVKAYEEKYGELPNNYAAEGYDAVWLLARGIKEANSADRVAIREGIAK
3hutA           AVEGVRLATAFVLGASDPVVVEFVSAYETLYGAIPTLFAAHGYDAVGILAAVGRAGPEVTRESLRDALA-
1usgA           DAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLAL---VKD
2lbpA           DAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYVWITYAAVQSLATALERTGSDEPLAL---VKD
1z15A           SAEGVTKPKNY---DQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIA-----KY
2livA           SAEGVTKPKNY---DQVPANKPIVDAIKAKKQDPSGAFVWTTYAALQSLQAGLNQSDDPAEIA-----KY
1qo0B           VAEGQVVVAPYFSSIDTPASRAFVQAC---HGFFPENWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYD
1qo0A           VAEGQVVVAPYFSSIDTPASRAFVQAC---HGFFPENWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYD
1qnlA           VAEGQVVVAPYFSSIDTPASRAFVQAC---HGFFPENWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYD
1peaA           VAEGQVVVAPYFSSIDTPASRAFVQAC---HGFFPENWAEAAYWQTLLLGRAAQAAGNWRVEDVQRHLYD
3i45A           EATGYPWYDIDTAPHRA-----FVEAYRARWKEDPFVGSLVGYNTLTAMAVAFEKAGGTESETLVETLKD


                         .         .         .         .         *         .         .:420
query           VAAEGFDGAQGPLSFENNDVRVEGVIASWNGxxxxxxxxxxx
3hutA           -ATDRYAGVTGITRFD--------------------------
1usgA           LKANGANTVIGPLNWD--------------------------
2lbpA           LKANGANTVIGPLNWD--------------------------
1z15A           LKANSVDTVMGPLTWD--------------------------
2livA           LKANSVDTVMGPLTWD--------------------------
1qo0B           I---DIDAPQGPVRVENNHSRLSSRIA---------------
1qo0A           I---DIDAPQGPVRVENNHSRLSSRIA---------------
1qnlA           I---DIDAPQGPVRVENNHSRLSSRIA---------------
1peaA           I---DIDAPQGPVRVENNHSRLSSRIA---------------
3i45A           MA---FSTPMGPLSFRASD--HQSTMGAWVG-----------