[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55524.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1djqA.bssp"
#ERROR : Can't open dsspfile "1djnA.bssp"
#ERROR : Can't open dsspfile "1ps9A.bssp"
#ERROR : Can't open dsspfile "1z41A.bssp"
#ERROR : Can't open dsspfile "1vypX.bssp"
#ERROR : Can't open dsspfile "1vysX.bssp"
#ERROR : Can't open dsspfile "2gq9A.bssp"
#ERROR : Can't open dsspfile "1vyrA.bssp"
#ERROR : Can't open dsspfile "1gvrA.bssp"
#ERROR : Can't open dsspfile "1gvoA.bssp"
#ERROR : Can't open dsspfile "2abbA.bssp"
#ERROR : Can't open dsspfile "2gqaA.bssp"
#ERROR : Can't open dsspfile "2gouA.bssp"
#ERROR : Can't open dsspfile "2g5wB.bssp"
#ERROR : Can't open dsspfile "3hgsA.bssp"
#ERROR : Can't open dsspfile "2hs8B.bssp"
#ERROR : Can't open dsspfile "2hs8A.bssp"
#ERROR : Can't open dsspfile "1oyaA.bssp"
#ERROR : Can't open dsspfile "1k02A.bssp"
#ERROR : Can't open dsspfile "3hgoB.bssp"
#ERROR : Can't open dsspfile "3hgoA.bssp"
#ERROR : Can't open dsspfile "1bwlA.bssp"
#ERROR : Can't open dsspfile "1q45B.bssp"
#ERROR : Can't open dsspfile "2hs6A.bssp"
#ERROR : Can't open dsspfile "3hgsB.bssp"
#ERROR : Can't open dsspfile "1bwkA.bssp"
#ERROR : Can't open dsspfile "2hsaA.bssp"
#ERROR : Can't open dsspfile "2hsaB.bssp"
#ERROR : Can't open dsspfile "2g5wA.bssp"
#ERROR : Can't open dsspfile "2r14A.bssp"
#ERROR : Can't open dsspfile "1q45A.bssp"
#ERROR : Can't open dsspfile "3gx9A.bssp"
#ERROR : Can't open dsspfile "1gwjA.bssp"
#ERROR : Can't open dsspfile "3gkaB.bssp"
#ERROR : Can't open dsspfile "3gkaA.bssp"
#ERROR : Can't open dsspfile "1vjiA.bssp"
#ERROR : Can't open dsspfile "1icsA.bssp"
#ERROR : Can't open dsspfile "1icqA.bssp"
#ERROR : Can't open dsspfile "1icpB.bssp"
#ERROR : Can't open dsspfile "3hgrB.bssp"
#ERROR : Can't open dsspfile "1icqB.bssp"
#ERROR : Can't open dsspfile "1icpA.bssp"
#ERROR : Can't open dsspfile "2h8zA.bssp"
#ERROR : Can't open dsspfile "2h8xA.bssp"
#ERROR : Can't open dsspfile "2iidA.bssp"
#ERROR : Can't open dsspfile "1f8sA.bssp"
#ERROR : Can't open dsspfile "1reoA.bssp"
#ERROR : Can't open dsspfile "2rabB.bssp"
#ERROR : Can't open dsspfile "2rabA.bssp"
#ERROR : Can't open dsspfile "2r9zB.bssp"
#ERROR : Can't open dsspfile "2r9zA.bssp"
#ERROR : Can't open dsspfile "3e1tA.bssp"
#ERROR : Can't open dsspfile "1wamA.bssp"
#ERROR : Can't open dsspfile "1usjA.bssp"
#ERROR : Can't open dsspfile "3intB.bssp"
#ERROR : Can't open dsspfile "3inrB.bssp"
#ERROR : Can't open dsspfile "3gf4A.bssp"
#ERROR : Can't open dsspfile "2eq6A.bssp"
#ERROR : Can't open dsspfile "2bi7A.bssp"

## Summary of PDB Search
:656
    2e-53  31%  1djqA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    7e-53  31%  1djnA  [c.1.4 - c.4.1 - c.3.1] TRIMETHYLAMINE DEHYDROGENASE
    1e-50  28%  1ps9A  [c.1.4 - c.4.1 - c.3.1] 2,4-DIENOYL-COA REDUCTASE
    2e-22  34%  1z41A  [x.x.x] PROBABLE NADH-DEPENDENT FLAVIN OXIDOREDUCTASE
    2e-22  33%  1vypX  [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    2e-22  33%  1vysX  [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    2e-22  34%  2gq9A  [x.x.x] OXIDOREDUCTASE, FMN-BINDING
    4e-22  33%  1vyrA  [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    4e-22  33%  1gvrA  [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    4e-22  33%  1gvoA  [c.1.4] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    4e-22  33%  2abbA  [x.x.x] PENTAERYTHRITOL TETRANITRATE REDUCTASE
    1e-21  34%  2gqaA  [x.x.x] OXIDOREDUCTASE, FMN-BINDING
    1e-21  34%  2gouA  [x.x.x] OXIDOREDUCTASE, FMN-BINDING
    3e-21  29%  2g5wB  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    6e-21  28%  3hgsA  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    7e-21  28%  2hs8B  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    7e-21  28%  2hs8A  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    1e-20  29%  1oyaA  [x.x.x] OLD YELLOW ENZYME
    1e-20  29%  1k02A  [c.1.4] NADPH DEHYDROGENASE 1
    1e-20  28%  3hgoB  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    1e-20  28%  3hgoA  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    1e-20  29%  1bwlA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    5e-20  29%  1q45B  [c.1.4] 12-OXOPHYTODIENOATE-10,11-REDUCTASE
    5e-20  28%  2hs6A  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    6e-20  28%  3hgsB  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    6e-20  29%  1bwkA  [c.1.4] PROTEIN (NADPH DEHYDROGENASE 1)
    8e-20  28%  2hsaA  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    8e-20  28%  2hsaB  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    3e-19  29%  2g5wA  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 3
    4e-19  30%  2r14A  [x.x.x] MORPHINONE REDUCTASE
    5e-19  30%  1q45A  [c.1.4] 12-OXOPHYTODIENOATE-10,11-REDUCTASE
    3e-18  29%  3gx9A  [x.x.x] MORPHINONE REDUCTASE
    3e-18  29%  1gwjA  [c.1.4] MORPHINONE REDUCTASE
    4e-18  35%  3gkaB  [x.x.x] N-ETHYLMALEIMIDE REDUCTASE
    4e-18  35%  3gkaA  [x.x.x] N-ETHYLMALEIMIDE REDUCTASE
    1e-17  31%  1vjiA  [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE (OPR1)
    8e-17  31%  1icsA  [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
    8e-17  31%  1icqA  [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
    8e-17  30%  1icpB  [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
    8e-17  31%  3hgrB  [x.x.x] 12-OXOPHYTODIENOATE REDUCTASE 1
    1e-16  31%  1icqB  [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
    1e-16  31%  1icpA  [c.1.4] 12-OXOPHYTODIENOATE REDUCTASE 1
    1e-13  31%  2h8zA  [x.x.x] XENOBIOTIC REDUCTASE A
    1e-13  31%  2h8xA  [x.x.x] XENOBIOTIC REDUCTASE A
    2e-06  43%  2iidA  [c.3.1 - d.16.1 (1f8rA)] L-AMINO-ACID OXIDASE
    2e-06  43%  1f8sA  [c.3.1 - d.16.1] L-AMINO ACID OXIDASE
    5e-06  40%  1reoA  [c.3.1 - d.16.1] AHPLAAO
    3e-05  44%  2rabB  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    3e-05  44%  2rabA  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    3e-05  44%  2r9zB  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    3e-05  44%  2r9zA  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    4e-05  57%  3e1tA  [x.x.x] HALOGENASE
    6e-04  35%  1wamA  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    6e-04  35%  1usjA  [c.4.1 - d.16.1] UDP-GALACTOPYRANOSE MUTASE
    6e-04  35%  3intB  [x.x.x] PROBABLE UDP-GALACTOPYRANOSE MUTASE
    6e-04  35%  3inrB  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    6e-04  35%  3gf4A  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
    6e-04  52%  2eq6A  [x.x.x] PYRUVATE DEHYDROGENASE COMPLEX, DIHYDROLIPOAMIDE
    6e-04  35%  2bi7A  [x.x.x] UDP-GALACTOPYRANOSE MUTASE
:656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxFTHLFTPIRVGRMDLPNRIMATPHATPIGNLWSPDEAEADRNIXXXXXXXXXXXXXXXXISA
1djqA           -----------LFEPIQIGPKTLRNRFYQVPHAIGAGSD-KPGFQSAHRSVKAEGGWAALNTEYCSINPE
1djnA           -----------LFEPIQIGPKTLRNRFYQVPHCIGAGSD-KPGFQSAHRSVKAEGGWAALNTEYCSINPE
1ps9A           --------YPSLFAPLDLGFTTLKNRVLMGSMHTGLEEY--PDGAER--------LAAFYAERARHGVAL
1z41A           ----------------------------------------------------------------------
1vypX           -----------LFTPLKVGAVTAPNRVFMAPRSIEPGDIPTPLMGEYYRQ----------------RASA
1vysX           -----------LFTPLKVGAVTAPNRVFMAPRSIEPGDIPTPLMGEYYRQ----------------RASA
2gq9A           ----------------------------------------------------------------------
1vyrA           -----------LFTPLKVGAVTAPNRVFMAPRSIEPGDIPTPLMGEYYRQ----------------RASA
1gvrA           -----------LFTPLKVGAVTAPNRVFMAPRSIEPGDIPTPLMGEYYRQ----------------RASA
1gvoA           -----------LFTPLKVGAVTAPNRVFMAPRSIEPGDIPTPLMGEYYRQ----------------RASA
2abbA           -----------LFTPLKVGAVTAPNRVFMAPRSIEPGDIPTPLMGEYYRQ----------------RASA
2gqaA           ----------------------------------------------------------------------
2gouA           ----------------------------------------------------------------------
2g5wB           -----------LFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEY---------------------
3hgsA           -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
2hs8B           -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
2hs8A           -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
1oyaA           ----------------------------------------------------------------------
1k02A           ----------------------------------------------------------------------
3hgoB           -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
3hgoA           -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
1bwlA           ----------------------------------------------------------------------
1q45B           -----------LFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEY---------------------
2hs6A           -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
3hgsB           -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
1bwkA           ----------------------------------------------------------------------
2hsaA           -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
2hsaB           -----------LFSPYKMGKFNLSHRVVLAPMT----------RCRALNNIPQAALGEYYEQRATAGGFL
2g5wA           -----------LFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEY---------------------
2r14A           -----------LFTPLQLGSLSLPNRVIMAP----LTRSRTPDSVPG----------RLQQIYYGQRASA
1q45A           -----------LFSSYKMGRFDLSHRVVLAPMTRCRALNGVPNAALAEY---------------------
3gx9A           -----------LFTPLQLGSLSLPNRVIMAP----LTRSRTPDSVPG----------RLQQIYYGQRASA
1gwjA           -----------LFTPLQLGSLSLPNRVIMAP----LTRSRTPDSVPG----------RLQQIYYGQRASA
3gkaB           -----------LFDPLTIGDLTLANRIIMAPLTRAAGDTRTPNALMA--------------RYYAERASA
3gkaA           -----------LFDPLTIGDLTLANRIIMAPLTRAAGDTRTPNALMA--------------RYYAERASA
1vjiA           -----------LLTPYKMGRFNLSHRVVLAPRQRSYGNVPQPHAA------------------------I
1icsA           ----------------------------------------------------------------------
1icqA           ----------------------------------------------------------------------
1icpB           ----------------------------------------------------------------------
3hgrB           ----------------------------------------------------------------------
1icqB           ----------------------------------------------------------------------
1icpA           ----------------------------------------------------------------------
2h8zA           ----------------------------------------------------------------------
2h8xA           ----------------------------------------------------------------------
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
2rabB           ----------------------------------------------------------------------
2rabA           ----------------------------------------------------------------------
2r9zB           ----------------------------------------------------------------------
2r9zA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2eq6A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           ALENHLVPGFEPTGVGAAARGVFRLPYFHDRIRKLTDTLHEAGAYVTAQLIMQGGMPHGPSPTVTAYVAN
1djqA           SDDTHRL------SARIWDEGDVR------NLKAMTDEVHKYGALAGVELWYGGATPRGPSQYASEFETL
1djnA           SDDTHRL------SARIWDEGDVR------NLKAMTDEVHKYGALAGVELWYGGATPRGPSQYASEFETL
1ps9A           IVSGGIAPDLTGVGMGAMLNDASQIPHH----RTITEAVHQEGGKIALQILHTGRQPHLVAPSALQAPIN
1z41A           ---------------------------------KLTEQVKEQGSKIGIQLAHAGRKAELEAPSAIAFDEQ
1vypX           GLIIS-----EATQISAQAKGYAGAPGLHSAWKKITAGVHAEDGRIAVQLFHTGRISHGQAPSASALNAN
1vysX           GLIIS-----EATQISAQAKGYAGAPGLHSAWKKITAGVHAEDGRIAVQLYHTGRISHGQAPSASALNAN
2gq9A           ----------EGTQISPTAKGYAWTPYTPEQIRIVTEAVHAKGCAIFAQLWHVGRVTHGQQPNVKVFVDN
1vyrA           GLIIS-----EATQISAQAKGYAGAPGLHSAWKKITAGVHAEDGRIAVQLWHTGRISHGQAPSASALNAN
1gvrA           GLIIS-----EATQISAQAKGYAGAPGLHSAWKKITAGVHAEDGRIAVQLWHTGRISHGQAPSASALNAN
1gvoA           GLIIS-----EATQISAQAKGYAGAPGLHSAWKKITAGVHAEDGRIAVQLWHTGRISHGQAPSASALNAN
2abbA           GLIIS-----EATQISAQAKGYAGAPGLHSAWKKITAGVHAEDGRIAVQLWHTGRISHGQAPSASALNAN
2gqaA           ----------EGTQISPTAKGYAWTPYTPEQIRIVTEAVHAKGCAIFAQLWHVGRVTHGQQPNVKVFVDN
2gouA           ----------EGTQISPTAKGYAWTPYTPEQIRIVTEAVHAKGCAIFAQLWHVGRVTHGQQPNVKVFVDN
2g5wB           -YAQRTTPGSEGTMVSPGSAGFPHVPYSDEQVKQVVEAVHAKGGFIFCQLWHVGRQPNGGSPISSSHVKY
3hgsA           ITEGTMI---SPTSAGFPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
2hs8B           ITEGTMI---SPTSAGFPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
2hs8A           ITEGTMI---SPTSAGFPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
1oyaA           ---------------------------------------------------------------------N
1k02A           ---------------------------------------------------------------------N
3hgoB           ITEGTMI---SPTSAGYPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
3hgoA           ITEGTMI---SPTSAGYPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
1bwlA           ---------------------------------------------------------------------N
1q45B           -YAQRTTPGSEGTMVSPGSAGFPHVPYSDEQVKQVVEAVHAKGGFIFCQLWHVGRQPNGGSPISSSHVKY
2hs6A           ITEGTMI---SPTSAGFPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
3hgsB           ITEGTMI---SPTSAGFPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
1bwkA           ---------------------------------------------------------------------N
2hsaA           ITEGTMI---SPTSAGFPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
2hsaB           ITEGTMI---SPTSAGFPVPGIFTKEQVREW-KKIVDVVHAKGAVIFCQLWHVGRASHAPISSTEKPISN
2g5wA           -YAQRTTPGSEGTMVSPGSAGFPHVPYSDEQVKQVVEAVHAKGGFIFCQLWHVGRQPNGGSPISSSHVKY
2r14A           GLIIS-----EATNISPTARGYVYTPGIWTDAQEVVEAVHAKGGRIALQLWHVGRVSHGQQPVAPSALKA
1q45A           -YAQRTTPGSEGTMVSPGSAGFPHVPYSDEQVKQVVEAVHAKGGFIFCQLWHVGRQPNGGSPISSSHVKY
3gx9A           GLIIS-----EATNISPTARGYVYTPGIWTDAQEVVEAVHAKGGRIALQLWHVGRVSHGQQPVAPSALKA
1gwjA           GLIIS-----EATNISPTARGYVYTPGIWTDAQEVVEAVHAKGGRIALQLWHVGRVSHGQQPVAPSALKA
3gkaB           GLIISEATSVTPQGVGYASTPGIWSPEQVDGWRLVTDAVHAAGGRIFLQLFLDGALPVAPSAIAPGGHVS
3gkaA           GLIISEATSVTPQGVGYASTPGIWSPEQVDGWRLVTDAVHAAGGRIFLQLFLDGALPVAPSAIAPGGHVS
1vjiA           YYSQRTTPGTEATGVSDTAQGYQDTPGIWTKEKPIVDAVHAKGGIFFCQISNSGFQPNGKAPIMPQIRSN
1icsA           ----------------------------------------------------------------------
1icqA           ----------------------------------------------------------------------
1icpB           ----------------------------------------------------------------------
3hgrB           ----------------------------------------------------------------------
1icqB           ----------------------------------------------------------------------
1icpA           ----------------------------------------------------------------------
2h8zA           ------------------------------------------------------------APSAIAFGAH
2h8xA           ------------------------------------------------------------APSAIAFGAH
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
2rabB           ----------------------------------------------------------------------
2rabA           ----------------------------------------------------------------------
2r9zB           ----------------------------------------------------------------------
2r9zA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2eq6A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           QVSHALDRDEIAWFINEYAESARRGKAAGLDGVELHANHDDLLEWFLSPASNHRDDEYGGDLAGRMRFLL
1djqA           SYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWL
1djnA           SYCKEMDLSDIAQVQQFYVDAAKRSRDAGFDIVYVYGAHSYLPLQFLNPYYNKRTDKYGGSLENRARFWL
1ps9A           RVPHELSHEEILQLIDNFARCAQLAREAGYDGVEVMGSEGYLINEFLTLRTNQRSDQWGGDYRNXXXXXX
1z41A           SATPVESAEKVKETVQEFKQAAARAKEAGFDVIEIHAAHGYLIHEFLSPLSNHRTDEYGGSPENRYRFLR
1vypX           TTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVL
1vysX           TTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVL
2gq9A           EVPRAMTKADIAQVIADYRQAALNAMEAGFDGIELHAANGYLINQFIDSEANNRSDEYGGSLENRLRFLD
1vyrA           TTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVL
1gvrA           TTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVL
1gvoA           TTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHGYLLHQFLSPSSNQRTDQYGGSVENRARLVL
2abbA           TTPRALELDEIPGIVNDFRQAVANAREAGFDLVELHSAHGFLLHQFLSPSSNQRTDQYGGSVENRARLVL
2gqaA           AVPRAMTKADIAQVIADYRQAALNAMEAGFDGIELHAANGYLINQFIDSEANNRSDEYGGSLENRLRFLD
2gouA           AVPRAMTKADIAQVIADYRQAALNAMEAGFDGIELHAANGYLINQFIDSEANNRSDEYGGSLENRLRFLD
2g5wB           PKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLK
3hgsA           RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
2hs8B           RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
2hs8A           RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
1oyaA           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTL
1k02A           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEIHSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTL
3hgoB           RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
3hgoA           RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
1bwlA           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEINSAHGYLLNQFLDPHSNTRTDEYGGSIENRARFTL
1q45B           PKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLK
2hs6A           RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
3hgsB           RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
1bwkA           NPQHSLTKDEIKQYIKEYVQAAKNSIAAGADGVEINSANGYLLNQFLDPHSNTRTDEYGGSIENRARFTL
2hsaA           RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
2hsaB           RKPRAIGTYEISQVVEDYRRSALNAIEAGFDGIEIHGAHGYLIDQFLKDGINDRTDEYGGSLANRCKFIT
2g5wA           PKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLK
2r14A           ETPRALETDEIPGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPL
1q45A           PKPRALEASEIPRVVEDYCLSALNAIRAGFDGIEIHGAHGYLIDQFLKDGINDRTDQYGGSIANRCRFLK
3gx9A           ETPRALETDEIPGIVEDYRQAAQRAKRAGFDMVEVHAAAACLPNQFLATGTNRRTDQYGGSIENRARFPL
1gwjA           ETPRALETDGIPGIVEDYRQAAQRAKRAGFDMVEVHAANACLPNQFLATGTNRRTDQYGGSIENRARFPL
3gkaB           LVRRALELDEIPGVVAAFRRGAENARAAGFDGVEVHGANGYLLDQFLQDSANRRTDAYGGSIENRARLLL
3gkaA           LVRRALELDEIPGVVAAFRRGAENARAAGFDGVEVHGANGYLLDQFLQDSANRRTDAYGGSIENRARLLL
1vjiA           GIDEALFTEEIPGIVNDFRLAARNAMEAGFDGVEIHGANGYLIDQFMKDTVNDRTDEYGGSLQNRCKFPL
1icsA           -----LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFAL
1icqA           -----LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFAL
1icpB           -----LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFAL
3hgrB           -----LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFAL
1icqB           -----LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFAL
1icpA           -----LTTDEIPQIVNEFRVAARNAIEAGFDGVEIHGAHGYLIDQFMKDQVNDRSDKYGGSLENRCRFAL
2h8zA           KVPREMTLDDIARVKQDFVXXXXXXXXXGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLL
2h8xA           KVPREMTLDDIARVKQDFVXXXXXXXXXGFEWIELHFAHGYLGQSFFSEHSNKRTDAYGGSFDNRSRFLL
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
2rabB           ----------------------------------------------------------------------
2rabA           ----------------------------------------------------------------------
2r9zB           ----------------------------------------------------------------------
2r9zA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2eq6A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           EIIDAIRAEVGPDFTLGVRMNLYEALDGGYDAAEGVDIAKALEATGKIDYLSVVVGDNWGAPSYIQPHYY
1djqA           ETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEAE-VDGQKFVEADSLVDMWDITIGDEWGEDAGPSRFYQ
1djnA           ETLEKVKHAVGSDCAIATRFGVDTVYGPGQIEAE-VDGQKFVEADSLVDMWDITIGDEWGEDAGPSRFYQ
1ps9A           XXXXXXXXXXGNDFIIIYRLSMLDLVEDGGTFAETVELAQAIEAAGATIINTGIGWHEARIPTIATPVPR
1z41A           EIIDEVKQVW--DGPLFVRVSASDYTDKGLDIADHIGFAKWKEQ--GVDLIDCSSGALVHADINVFPGYQ
1vypX           EVVDAVCNEWSAD-RIGIRVSTFQNVDNGNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY------
1vysX           EVVDAVCNEWSAD-RIGIRVSTFQNVDNGNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY------
2gq9A           EVVAALVDAIGAE-RVGVRLAPLTTLNGTVDADPTYTAAAALLNKHRIVYLHIAEVDWDDAPD-------
1vyrA           EVVDAVCNEWSAD-RIGIRVSTFQNVDNGNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY------
1gvrA           EVVDAVCNEWSAD-RIGIRVSTFQNVDNGNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY------
1gvoA           EVVDAVCNEWSAD-RIGIRVSTFQNVDNGNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY------
2abbA           EVVDAVCNEWSAD-RIGIRVSTFQNVDNGNEEADALYLIEELAKRG-IAYLHMSETDLAGGKPY------
2gqaA           EVVAALVDAIGAE-RVGVRLAPLTTLNGTVDADPTYTAAAALLNKHRIVYLHIAEVDWDDAPD-------
2gouA           EVVAALVDAIGAE-RVGVRLAPLTTLNGTVDADPTYTAAAALLNKHRIVYLHIAEVDWDDAPD-------
2g5wB           QVVEGVVSAIGAS-KVGVRVS--PAID-HLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYH
3hgsA           QVVQAVVSAIGAD-RVGVRVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYV
2hs8B           QVVQAVVSAIGAD-RVGVRVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRLG
2hs8A           QVVQAVVSAIGAD-RVGVRVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRLG
1oyaA           EVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELE-KRAKAGKRLAFVHLVEPRVT
1k02A           EVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELE-KRAKAGKRLAFVHLVEPRVT
3hgoB           QVVQAVVSAIGAD-RVGVRVS--PAID-YLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRLG
3hgoA           QVVQAVVSAIGAD-RVGVRVS--PAID-YLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRLG
1bwlA           EVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELE-KRAKAGKRLAFVHLVEPRVT
1q45B           QVVEGVVSAIGAS-KVGVRVS--PAID-HLDATDSDPLSLGLAVVGMLNKLQGVNGSKLAYLHVTQPRYH
2hs6A           QVVQAVVSAIGAD-RVGVRVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPREE
3hgsB           QVVQAVVSAIGAD-RVGVRVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPSEE
1bwkA           EVVDALVEAIGHE-KVGLRLSPYGVFNSMSGGAETGIVAQYAYVAGELE-KRAKAGKRLAFVHLVEPRVT
2hsaA           QVVQAVVSAIGAD-RVGVRVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYY
2hsaB           QVVQAVVSAIGAD-RVGVRVS--PAID-HLDAMDSNPLSLGLAVVERLNKIQLHSGSKLAYLHVTQPRYY
2g5wA           QVVEGVVSAIGAS-KVGVRVS--PAID-HLDATDSDPLSLGLAVVGMLNKLQ---GVNGSKLAYL--HVT
2r14A           EVVDAVAEVFGPE-RVGIRLTPFLELFG---LTDDEPEAMAFYLAGELDRRGL---------AYL--HFN
1q45A           QVVEGVVSAIGAS-KVGVRVS--PAID-HLDATDSDPLSLGLAVVGMLNKLQ---GVNGSKLAYL--HVT
3gx9A           EVVDAVAEVFGPE-RVGIRLTPFLELFG---LTDDEPEAMAFYLAGELDRRGLAY-LHFNEPDITYPEGF
1gwjA           EVVDAVAEVFGPE-RVGIRLTPFLELFG---LTDDEPEAMAFYLAGELDRRGLAY-LHFNEPDWIGGDIT
3gkaB           EVVDA-----------------------------------------------------------------
3gkaA           EVVDA-----------------------------------------------------------------
1vjiA           EIVDAVAKEIGPD-RVGIRLSPFDYMESGNPGALGLYMAESLNKYG-ILYCHVIEA---------RMHTL
1icsA           EIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYC--------------HVV
1icqA           EIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYC--------------HVV
1icpB           EIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYC--------------HVV
3hgrB           EIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYC--------------HVV
1icqB           EIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLA-----------------YC
1icpA           EIVEAVANEIGSD-RVGIRISPFAHYNEAGDTNPTALGLYMVESLNKYDLAYCHV---------VEP---
2h8zA           ETLAAVREVWPENLPLTARFGVLE-YDGRDEQTESIELARRFKA-GGLDLLSVSVG--FTIPDTNIP--W
2h8xA           ETLAAVREVWPENLPLTARFGVLE-YDGRDEQTESIELARRFKA-GGLDLLSVSVG--FTIPDTNIP--W
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
2rabB           ----------------------------------------------------------------------
2rabA           ----------------------------------------------------------------------
2r9zB           ----------------------------------------------------------------------
2r9zA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2eq6A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           QPAQWADLAAQVTRAVSLPVIYTGRVTDPHTAEKVIAQGQADLVGMARAIITDPEIITKTAQGRVHEIRP
1djqA           QTIPWVKLVKQVSKK---PVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRV
1djnA           QTIPWVKLVKQVSKK---PVLGVGRYTDPEKMIEIVTKGYADIIGCARPSIADPFLPQKVEQGRYDDIRV
1ps9A           GAFSW--VTRKLKGHVSLPLVTTNRINDPQVADDILSRGDADMVSMARPFLADAELLSKAQSGRADEINT
1z41A           VSAEKIREQADATGAVG--------ITD-GSAEEILQNGRADLIFIGRELLRDP----------------
1vypX           -----SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANPDLVAR-----------
1vysX           -----SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANPDLVAR-----------
2gq9A           TPVSFKRALREAYQGV---LIYAGRY-NAEKAEQAINDGLADMIGFGRPFIANPDLPERLRHG-------
1vyrA           -----SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANPDLVAR-----------
1gvrA           -----SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANPDLVAR-----------
1gvoA           -----SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANPDLVAR-----------
2abbA           -----SEAFRQKVRERFHGVIIGAGAYTAEKAEDLIGKGLIDAVAFGRDYIANPDLVAR-----------
2gqaA           TPVSFKRALREAYQGV---LIYAGRY-NAEKAEQAINDGLADMIGFGRPFIANPDLPERLRHG-------
2gouA           TPVSFKRALREAYQGV---LIYAGRY-NAEKAEQAINDGLADMIGFGRPFIANPDLPERLRHG-------
2g5wB           AYEEEAKLMKSLRMAYNGTFMSSGGF-NKELGMQAVQQGDADLVSYGRLFIANPDLVSR-----------
3hgsA           QEEEEARLMRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR-----------
2hs8B           SEEEEARLMRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR-----------
2hs8A           SEEEEARLMRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR-----------
1oyaA           NPGEYEGGSNDFVYSIKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKG-------
1k02A           NPGEYEGGSNDFVYSIKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKG-------
3hgoB           SEEEEARLMRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR-----------
3hgoA           SEEEEARLMRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR-----------
1bwlA           NPGEYEGGSNDFVYSIKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKG-------
1q45B           YDEEEAKLMKSLRMAYNGTFMSSGGF-NKELGMQAVQQGDADLVSYGRLFIANPDLVSR-----------
2hs6A           EEAR---LMRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR-----------
3hgsB           EEAR---LMRTLRNAYQGTFICSGGYTRELGIE-AVAQGDADLVSYGRLFISNPDLVMR-----------
1bwkA           NPGEYEGGSNDFVYSIKGPVIRAGNFALHPEVVREEVKDKRTLIGYGRFFISNPDLVDRLEKG-------
2hsaA           GQTEAGRLGSEEEEARLMRTLYQGTCSGGYTREEAVAQGDADLVSYGRLFISNPDLVMR-----------
2hsaB           GQTEAGRLGSEEEEARLMRTLYQGTCSGGYTREEAVAQGDADLVSYGRLFISNPDLVMR-----------
2g5wA           QPRE-AKLMKSLRMAYNGTFMSSGGF-NKELGMQAVQQGDADLVSYGRLFIANPDLVSR-----------
2r14A           EPDTYPEFREQMRQRFKGGLIYCGNY-DAGRAQARLDDNTADAVAFGRPFIANPDL--------------
1q45A           QPRE-----EEAKLMKSLRMAYNGTFMNKELGMQAVQQGDADLVSYGRLFIANPDLVSR-----------
3gx9A           R--------EQMRQRFKGGLIYCGNY-DAGRAQARLDDNTADAVAFGRPFIANPDL--------------
1gwjA           YPEGFRE---QMRQRFKGGLIYCGNY-DAGRAQARLDDNTADAVAFGRPFIANPDL--------------
3gkaB           ----------------------------------------------------------------------
3gkaA           ----------------------------------------------------------------------
1vjiA           MP---------MRKAFKGTFISAGGFT-REDGNEAVSKGRTDLVAYGRWFLANPDL--------------
1icsA           EPR--TESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVAYGRLFISNPDL--------------
1icqA           EPR--TESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVAYGRLFISNPDL--------------
1icpB           EPRMKTTESLVPMRKAYKGTFIVAGGYDREDGNRALIEDRADLVAYGRLFISNPDL--------------
3hgrB           EPR--TESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVAYGRLFISNPDL--------------
1icqB           HVVEPRESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVAYGRLFISNPDL--------------
1icpA           RMKTCTESLVPMRKAYKGTFIVAGGY-DREDGNRALIEDRADLVAYGRLFISNPDL--------------
2h8zA           GPAFMGPIAERVRREAKLPVTSAWGFGTPXXXXXXXXXXXXXXVSVGRAHLADP----------------
2h8xA           GPAFMGPIAERVRREAKLPVTSAWGFGTPXXXXXXXXXXXXXXVSVGRAHLADP----------------
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
2rabB           ----------------------------------------------------------------------
2rabA           ----------------------------------------------------------------------
2r9zB           ----------------------------------------------------------------------
2r9zA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2eq6A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           CIGCNECIHRRLVDKLPFACAINPYASRELDGPLPPARTPRRVLVVGGGPAGMELAGLLAERGHEVTLWE
1djqA           CIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTD
1djnA           CIGCNVCISRWEIGGPPMICTQNATAGEEYRRGWHPTKNKDSVLIVGAGPSGSEAARVLMESGYTVHLTD
1ps9A           CIGCNQCLDQIFVGKVT-SCLVNPRACHETKMPILPAVQKKNXXXXXXXXXXXXXXINAAARGHQVTLFD
1z41A           ----------------------------------------------------------------------
1vypX           ----------------------------------------------------------------------
1vysX           ----------------------------------------------------------------------
2gq9A           ----------------------------------------------------------------------
1vyrA           ----------------------------------------------------------------------
1gvrA           ----------------------------------------------------------------------
1gvoA           ----------------------------------------------------------------------
2abbA           ----------------------------------------------------------------------
2gqaA           ----------------------------------------------------------------------
2gouA           ----------------------------------------------------------------------
2g5wB           ----------------------------------------------------------------------
3hgsA           ----------------------------------------------------------------------
2hs8B           ----------------------------------------------------------------------
2hs8A           ----------------------------------------------------------------------
1oyaA           ----------------------------------------------------------------------
1k02A           ----------------------------------------------------------------------
3hgoB           ----------------------------------------------------------------------
3hgoA           ----------------------------------------------------------------------
1bwlA           ----------------------------------------------------------------------
1q45B           ----------------------------------------------------------------------
2hs6A           ----------------------------------------------------------------------
3hgsB           ----------------------------------------------------------------------
1bwkA           ----------------------------------------------------------------------
2hsaA           ----------------------------------------------------------------------
2hsaB           ----------------------------------------------------------------------
2g5wA           ----------------------------------------------------------------------
2r14A           ----------------------------------------------------------------------
1q45A           ----------------------------------------------------------------------
3gx9A           ----------------------------------------------------------------------
1gwjA           ----------------------------------------------------------------------
3gkaB           ----------------------------------------------------------------------
3gkaA           ----------------------------------------------------------------------
1vjiA           ----------------------------------------------------------------------
1icsA           ----------------------------------------------------------------------
1icqA           ----------------------------------------------------------------------
1icpB           ----------------------------------------------------------------------
3hgrB           ----------------------------------------------------------------------
1icqB           ----------------------------------------------------------------------
1icpA           ----------------------------------------------------------------------
2h8zA           ----------------------------------------------------------------------
2h8xA           ----------------------------------------------------------------------
2iidA           ---------------------------------LKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLE
1f8sA           ---------------------------------LKATSNPKHVVIVGAGMAGLSAAYVLAGAGHQVTVLE
1reoA           ---------------------------------LKATSNPKHVVVVGAGMSGLSAAYVLSGAGHQVTVLE
2rabB           ------------------------------DGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVA
2rabA           ------------------------------DGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVA
2r9zB           ------------------------------DGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVA
2r9zA           ------------------------------DGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVA
3e1tA           ------------------------------------------LIVIGGGPGGSTLASFVAMRGHRVLLLE
1wamA           ----------------------------------------KKILIVGAGFSGAVIGRQLAEKGHQVHIID
1usjA           ----------------------------------------KKILIVGAGFSGAVIGRQLAEKGHQVHIID
3intB           ----------------------------------------KKILIVGAGFSGAVIGRQLAEKGHQVHIID
3inrB           ----------------------------------------KKILIVGAGFSGAVIGRQLAEKGHQVHIID
3gf4A           ----------------------------------------KKILIVGAGFSGAVIGRQLAEKGHQVHIID
2eq6A           ---------------------------------------PKRLLVIGGGAVGLELGQVYRRLGAEVTLIE
2bi7A           ----------------------------------------KKILIVGAGFSGAVIGRQLAEKGHQVHIID


                         .         .         +         .         .         .         .:490
query           REEQLGGQMRIXXXXXXXXXYHDFVTWQEGRLRRAGVTVELGRTATVDNVLSFXXXXXXXXXXXXPRRLP
1djqA           TAEKIGGQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLAKPMTADDVLQYTGARWNTDGTNCLTHDP
1djnA           TAEKIGGQVAALPGLGEWSYHRDYRETQITKLLKKNKESQLAKPMTADDVLQYTGARWNTDGTNCLTHDP
1ps9A           AHSEIGGQFNIAKQIPGKEEFYETLRYYRRMIEVTGVTLKLNHTVTADQLQAF--DETILASGIVPRTPP
1z41A           ----------------------------------------------------------------------
1vypX           ----------------------------------------------------------------------
1vysX           ----------------------------------------------------------------------
2gq9A           ----------------------------------------------------------------------
1vyrA           ----------------------------------------------------------------------
1gvrA           ----------------------------------------------------------------------
1gvoA           ----------------------------------------------------------------------
2abbA           ----------------------------------------------------------------------
2gqaA           ----------------------------------------------------------------------
2gouA           ----------------------------------------------------------------------
2g5wB           ----------------------------------------------------------------------
3hgsA           ----------------------------------------------------------------------
2hs8B           ----------------------------------------------------------------------
2hs8A           ----------------------------------------------------------------------
1oyaA           ----------------------------------------------------------------------
1k02A           ----------------------------------------------------------------------
3hgoB           ----------------------------------------------------------------------
3hgoA           ----------------------------------------------------------------------
1bwlA           ----------------------------------------------------------------------
1q45B           ----------------------------------------------------------------------
2hs6A           ----------------------------------------------------------------------
3hgsB           ----------------------------------------------------------------------
1bwkA           ----------------------------------------------------------------------
2hsaA           ----------------------------------------------------------------------
2hsaB           ----------------------------------------------------------------------
2g5wA           ----------------------------------------------------------------------
2r14A           ----------------------------------------------------------------------
1q45A           ----------------------------------------------------------------------
3gx9A           ----------------------------------------------------------------------
1gwjA           ----------------------------------------------------------------------
3gkaB           ----------------------------------------------------------------------
3gkaA           ----------------------------------------------------------------------
1vjiA           ----------------------------------------------------------------------
1icsA           ----------------------------------------------------------------------
1icqA           ----------------------------------------------------------------------
1icpB           ----------------------------------------------------------------------
3hgrB           ----------------------------------------------------------------------
1icqB           ----------------------------------------------------------------------
1icpA           ----------------------------------------------------------------------
2h8zA           ----------------------------------------------------------------------
2h8xA           ----------------------------------------------------------------------
2iidA           ASERPGGRVR------------------------------------------------------------
1f8sA           ASERPGGRVR------------------------------------------------------------
1reoA           ASERAGGRVR------------------------------------------------------------
2rabB           LEDRL-----------------------------------------------------------------
2rabA           LEDRL-----------------------------------------------------------------
2r9zB           LEDRL-----------------------------------------------------------------
2r9zA           LEDRL-----------------------------------------------------------------
3e1tA           RE--------------------------------------------------------------------
1wamA           QRDHIGG---------------------------------------------------------------
1usjA           QRDHIGG---------------------------------------------------------------
3intB           QRDHIGG---------------------------------------------------------------
3inrB           QRDHIGG---------------------------------------------------------------
3gf4A           QRDHIGG---------------------------------------------------------------
2eq6A           ----------------------------------------------------------------------
2bi7A           QRDHIGG---------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           IPGADAPFVVDGHAVLAGTAQIGERVLLTAAEDHMQPLTIAGYLADHGHHVHLVYQTPGPAPLVGKYTIX
1djqA           IPGADAPDQLTPEQVMDGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIV-----SGVHLANYMHF
1djnA           IPGADAPDQLTPEQVMDGKKKIGKRVVILNADTYFMAPSLAEKLATAGHEVTIV-----SGVHLANYMHF
1ps9A           IDGIDHPKVLSYLDVLRDKAPVGNKVAI------------------------------------------
1z41A           ----------------------------------------------------------------------
1vypX           ----------------------------------------------------------------------
1vysX           ----------------------------------------------------------------------
2gq9A           ----------------------------------------------------------------------
1vyrA           ----------------------------------------------------------------------
1gvrA           ----------------------------------------------------------------------
1gvoA           ----------------------------------------------------------------------
2abbA           ----------------------------------------------------------------------
2gqaA           ----------------------------------------------------------------------
2gouA           ----------------------------------------------------------------------
2g5wB           ----------------------------------------------------------------------
3hgsA           ----------------------------------------------------------------------
2hs8B           ----------------------------------------------------------------------
2hs8A           ----------------------------------------------------------------------
1oyaA           ----------------------------------------------------------------------
1k02A           ----------------------------------------------------------------------
3hgoB           ----------------------------------------------------------------------
3hgoA           ----------------------------------------------------------------------
1bwlA           ----------------------------------------------------------------------
1q45B           ----------------------------------------------------------------------
2hs6A           ----------------------------------------------------------------------
3hgsB           ----------------------------------------------------------------------
1bwkA           ----------------------------------------------------------------------
2hsaA           ----------------------------------------------------------------------
2hsaB           ----------------------------------------------------------------------
2g5wA           ----------------------------------------------------------------------
2r14A           ----------------------------------------------------------------------
1q45A           ----------------------------------------------------------------------
3gx9A           ----------------------------------------------------------------------
1gwjA           ----------------------------------------------------------------------
3gkaB           ----------------------------------------------------------------------
3gkaA           ----------------------------------------------------------------------
1vjiA           ----------------------------------------------------------------------
1icsA           ----------------------------------------------------------------------
1icqA           ----------------------------------------------------------------------
1icpB           ----------------------------------------------------------------------
3hgrB           ----------------------------------------------------------------------
1icqB           ----------------------------------------------------------------------
1icpA           ----------------------------------------------------------------------
2h8zA           ----------------------------------------------------------------------
2h8xA           ----------------------------------------------------------------------
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
2rabB           ----------------------------------------------------------------------
2rabA           ----------------------------------------------------------------------
2r9zB           ----------------------------------------------------------------------
2r9zA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2eq6A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           XXXXXXXXXXXXXXXMQRVVQIEEGRVATRNIYSDIPGEITGFDSVVVAAGGVPDDSLYHELKRHGKANV
1djqA           TLEYPNMMRRLHELHVEELSRIEPGRMEIYNIWGDGPGRWIEFDSLVLVTGRHSECTLWNELKENDIKGI
1djnA           TLEYPNMMRRLHELHVEELSRIEPGRMEIYNIWGDGPGRWIEFDSLVLVTGRHSECTLWNELKENDIKGI
1ps9A           ----------------------------------------------------------------------
1z41A           ----------------------------------------------------------------------
1vypX           ----------------------------------------------------------------------
1vysX           ----------------------------------------------------------------------
2gq9A           ----------------------------------------------------------------------
1vyrA           ----------------------------------------------------------------------
1gvrA           ----------------------------------------------------------------------
1gvoA           ----------------------------------------------------------------------
2abbA           ----------------------------------------------------------------------
2gqaA           ----------------------------------------------------------------------
2gouA           ----------------------------------------------------------------------
2g5wB           ----------------------------------------------------------------------
3hgsA           ----------------------------------------------------------------------
2hs8B           ----------------------------------------------------------------------
2hs8A           ----------------------------------------------------------------------
1oyaA           ----------------------------------------------------------------------
1k02A           ----------------------------------------------------------------------
3hgoB           ----------------------------------------------------------------------
3hgoA           ----------------------------------------------------------------------
1bwlA           ----------------------------------------------------------------------
1q45B           ----------------------------------------------------------------------
2hs6A           ----------------------------------------------------------------------
3hgsB           ----------------------------------------------------------------------
1bwkA           ----------------------------------------------------------------------
2hsaA           ----------------------------------------------------------------------
2hsaB           ----------------------------------------------------------------------
2g5wA           ----------------------------------------------------------------------
2r14A           ----------------------------------------------------------------------
1q45A           ----------------------------------------------------------------------
3gx9A           ----------------------------------------------------------------------
1gwjA           ----------------------------------------------------------------------
3gkaB           ----------------------------------------------------------------------
3gkaA           ----------------------------------------------------------------------
1vjiA           ----------------------------------------------------------------------
1icsA           ----------------------------------------------------------------------
1icqA           ----------------------------------------------------------------------
1icpB           ----------------------------------------------------------------------
3hgrB           ----------------------------------------------------------------------
1icqB           ----------------------------------------------------------------------
1icpA           ----------------------------------------------------------------------
2h8zA           ----------------------------------------------------------------------
2h8xA           ----------------------------------------------------------------------
2iidA           ----------------------------------------------------------------------
1f8sA           ----------------------------------------------------------------------
1reoA           ----------------------------------------------------------------------
2rabB           ----------------------------------------------------------------------
2rabA           ----------------------------------------------------------------------
2r9zB           ----------------------------------------------------------------------
2r9zA           ----------------------------------------------------------------------
3e1tA           ----------------------------------------------------------------------
1wamA           ----------------------------------------------------------------------
1usjA           ----------------------------------------------------------------------
3intB           ----------------------------------------------------------------------
3inrB           ----------------------------------------------------------------------
3gf4A           ----------------------------------------------------------------------
2eq6A           ----------------------------------------------------------------------
2bi7A           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           HLLGDAYAPRRITFATQQAYALAxxx
1djqA           YLIGDAEAPRLIADATFTGHRVA---
1djnA           YLIGDAEAPRLIADATFTGHRVA---
1ps9A           --------------------------
1z41A           --------------------------
1vypX           --------------------------
1vysX           --------------------------
2gq9A           --------------------------
1vyrA           --------------------------
1gvrA           --------------------------
1gvoA           --------------------------
2abbA           --------------------------
2gqaA           --------------------------
2gouA           --------------------------
2g5wB           --------------------------
3hgsA           --------------------------
2hs8B           --------------------------
2hs8A           --------------------------
1oyaA           --------------------------
1k02A           --------------------------
3hgoB           --------------------------
3hgoA           --------------------------
1bwlA           --------------------------
1q45B           --------------------------
2hs6A           --------------------------
3hgsB           --------------------------
1bwkA           --------------------------
2hsaA           --------------------------
2hsaB           --------------------------
2g5wA           --------------------------
2r14A           --------------------------
1q45A           --------------------------
3gx9A           --------------------------
1gwjA           --------------------------
3gkaB           --------------------------
3gkaA           --------------------------
1vjiA           --------------------------
1icsA           --------------------------
1icqA           --------------------------
1icpB           --------------------------
3hgrB           --------------------------
1icqB           --------------------------
1icpA           --------------------------
2h8zA           --------------------------
2h8xA           --------------------------
2iidA           --------------------------
1f8sA           --------------------------
1reoA           --------------------------
2rabB           --------------------------
2rabA           --------------------------
2r9zB           --------------------------
2r9zA           --------------------------
3e1tA           --------------------------
1wamA           --------------------------
1usjA           --------------------------
3intB           --------------------------
3inrB           --------------------------
3gf4A           --------------------------
2eq6A           --------------------------
2bi7A           --------------------------