[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55595.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1ii8B.bssp"
#ERROR : Can't open dsspfile "1f2uD.bssp"
#ERROR : Can't open dsspfile "1f2uB.bssp"
#ERROR : Can't open dsspfile "1f2tB.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1us8B.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"

## Summary of PDB Search
:253
    8e-51  44%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    8e-51  44%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    8e-51  44%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    5e-49  45%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-49  45%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    5e-47  45%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-47  45%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    8e-08  34%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-08  34%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-07  30%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    3e-07  26%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    9e-07  33%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-06  31%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    2e-06  30%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    2e-06  32%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-06  32%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-06  30%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-06  30%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-06  34%  1yqtA  [x.x.x] RNASE L INHIBITOR
    3e-06  30%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-06  30%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-05  30%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-05  30%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-05  33%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    5e-05  25%  2oukB  [x.x.x] PROTEIN ARTP
    5e-05  25%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    5e-05  33%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-05  33%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-05  33%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-05  33%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-05  33%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-05  31%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    6e-05  31%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    1e-04  31%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-04  31%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-04  29%  1ii8B  [c.37.1] RAD50 ABC-ATPASE
    1e-04  29%  1f2uD  [c.37.1] RAD50 ABC-ATPASE
    1e-04  29%  1f2uB  [c.37.1] RAD50 ABC-ATPASE
    1e-04  29%  1f2tB  [c.37.1] RAD50 ABC-ATPASE
    1e-04  31%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    2e-04  28%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    2e-04  29%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-04  28%  1us8B  [c.37.1] DNA DOUBLE-STRAND BREAK REPAIR RAD50 ATPASE
    4e-04  32%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    7e-04  29%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    7e-04  26%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    0.001  36%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    0.001  36%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
:253

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MVSIDQSAIRGSRRSNPATYTGLLDPIRKAFAKANGVKPSLFSANSEGACPACNGAGVIYTDLAMMAGVA
2vf8B           LVRVDQKPIGRTPRSNMATYTGLFDQVRKLFAKKRGYNAGRFSFNVKGGCEHCQGEGWVMVELLFLPSVY
2vf7C           LVRVDQKPIGRTPRSNMATYTGLFDQVRKLFAKKRGYNAGRFSFNVKGGCEHCQGEGWVMVELLFLPSVY
2vf7A           LVRVDQKPIGRTPRSNMATYTGLFDQVRKLFAKKRGYNAGRFSFNVKGGCEHCQGEGWVMVELLFLPSVY
2vf8A           LVRVDQKPIGRTPRSNMATYTGLFDQVRKLFAKKRGYNAGRFSFNVKGGCEHCQGEGWV-----MVPSVY
2vf7B           LVRVDQKPIGRTPRSNMATYTGLFDQVRKLFAKKRGYNAGRFSFNVKGGCEHCQGEGWV-----MVPSVY
2r6fB           VIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTNGYKKGRFSFNVKGGCEACHGDGIIKIE-HFLPDVY
2r6fA           VIDIDQSPIGRTPRSNPATYTGVFDDIRDVFASTNGYKKGRFSFNVKGGCEACHGDGIIKIE-HFLPDVY
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
1b0uA           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
3g60A           ----------------------------------------------------------------------
3g5uA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
1xefA           ----------------------------------------------------------------------
2ffaA           ----------------------------------------------------------------------
1q12A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1ii8B           ----------------------------------------------------------------------
1f2uD           ----------------------------------------------------------------------
1f2uB           ----------------------------------------------------------------------
1f2tB           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
1f3oA           ----------------------------------------------------------------------
1us8B           ----------------------------------------------------------------------
2ghiD           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           TVCETCEGKRFQASVLKYTLGGRTISDVLEMSVXXXXXXXXXXXXXLPAAHAILTRLADVGLGYLSLGQP
2vf8B           APCPVCHGTRYNAETLEVEYRGKNIADVLALTVDEAHDFFADESAIFRA----LDTLREVGLGYLRLGQP
2vf7C           APCPVCHGTRYNAETLEVEYRGKNIADVLALTVDEAHDFFADESAIFRA----LDTLREVGLGYLRLGQP
2vf7A           APCPVCHGTRYNAETLEVEYRGKNIADVLALTVDEAHDFFADESAIFRA----LDTLREVGLGYLRLGQP
2vf8A           APCPVCHGTRYNAETLEVEYRGKNIADVLALTVDEAHDFFADESAIFRA----LDTLREVGLGYLRLGQP
2vf7B           APCPVCHGTRYNAETLEVEYRGKNIADVLALTVDEAHDFFADESAIFRA----LDTLREVGLGYLRLGQP
2r6fB           VPCEVCHGKRYNRETLEVTYKGKNIAEVLDT-----VEDALDFFASIPKIKRKLETLYDVGLGY-KLGQP
2r6fA           VPCEVCHGKRYNRETLEVTYKGKNIAEVLDT-----VEDALDFFASIPKIKRKLETLYDVGLGY-KLGQP
2yz2B           ----------------------------------------------------------------------
2yz2A           ----------------------------------------------------------------------
2hydA           ------------------------------------------------------------------VGER
1b0uA           ------------------------------------------------ARERALKYLAKVGIDERAQGKY
3bk7A           ----------------------------------------------------------------------
1pf4A           ------------------------------------------------------------------IGEN
1mt0A           ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
3g60A           ------------------------------------------------------------------VGER
3g5uA           ------------------------------------------------------------------VGER
2ff7A           ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
3b5jA           ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
1yqtA           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
2ffbA           ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
1xefA           ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
2ffaA           ----------------------------------------------LAGAHDFISELRE---GYNTIGEQ
1q12A           ----------------------------------------------------------------------
2oukB           ----------------------------------------------------------------------
2oljA           ----------------------------------------------------------------------
3fh6A           ----------------------------------------------------------------------
2awoC           ----------------------------------------------------------------------
2awoA           ----------------------------------------------------------------------
2awnC           ----------------------------------------------------------------------
2awnB           ----------------------------------------------------------------------
1mv5D           ------------------------------------------------------------------VGER
1mv5A           ------------------------------------------------------------------VGER
2r6gB           ----------------------------------------------------------------------
2r6gA           ----------------------------------------------------------------------
1ii8B           --------------------------------------------------------------------RP
1f2uD           --------------------------------------------------------------------RP
1f2uB           --------------------------------------------------------------------RP
1f2tB           --------------------------------------------------------------------RP
1jj7A           ----------------------------------------------------------------------
2pcjA           --------------------------------------------------------LSELGLGDKLSRKP
1f3oA           ----------------------------------------------------------------------
1us8B           --------------------------------------------------------------------RP
2ghiD           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
2cbzA           ------------------------------------------------------------------IGEK
2ix3A           ---------------------------------------------------AIKDKLIEFGFTDEMIAMP
2iwhB           ---------------------------------------------------AIKDKLIEFGFTDEMIAMP


                         +         .         .         .         .         *         .:210
query           LTTLSGGERQRLKLATHMGDKGGIYVLDEPTTGXXXXXXXXXXXXXDRIVDSGKSVIVIEHHQAVMAHAD
2vf8B           ATELSGGEAQRIKLATELGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASD
2vf7C           ATELSGGEAQRIKLATELGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASD
2vf7A           ATELSGGEAQRIKLATELGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASD
2vf8A           ATELSGGEAQRIKLATELGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASD
2vf7B           ATELSGGEAQRIKLATELGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKMQVVAASD
2r6fB           ATTLSGGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTAD
2r6fA           ATTLSGGEAQRVKLAAELHRRSNLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNLDVIKTAD
2yz2B           ---LSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDETVINHVD
2yz2A           ---LSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDETVINHVD
2hydA           GVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALD-VLSKDRTTLIVAHRLSTITHAD
1b0uA           PVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHSS
3bk7A           LHQLSGGELQRVAIAAALLRKAHFYFFDEPSSYLDIRQRLKVARVIRRLANEGKAVLVVEHDLAVLDYLS
1pf4A           GTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDEL-QKNKTVLVIAHRLSTIEQAD
1mt0A           GAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAHRLSTVKNAD
3g60A           GAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDK-AREGRTTIVIAHRLSTVRNAD
3g5uA           GAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDK-AREGRTTIVIAHRLSTVRNAD
2ff7A           GAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAHRLSTVKNAD
3b5jA           GAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAHRLSTVKNAD
1yqtA           ---LSGGELQRVAIAAALLRNATFYFFDEPSSYLDIRQRLNAARAIRRLSEEGKSVLVVEHDLAVLDYLS
2fgkA           GAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKIC-KGRTVIIIAHRLSTVKNAD
2ffbA           GAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKIC-KGRTVIIIAHRLSTVKNAD
1xefA           GAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAARLSTVKNAD
2ffaA           GAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKIC-KGRTVIIIAARLSTVKNAD
1q12A           ---LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVAMTLAD
2oukB           --SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREGD
2oljA           --SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREGD
3fh6A           ---LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVAMTLAD
2awoC           ---LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVAMTLAD
2awoA           ---LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVAMTLAD
2awnC           ---LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVAMTLAD
2awnB           ---LSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVAMTLAD
1mv5D           GVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLM-KGRTTLVIAHRLSTIVDAD
1mv5A           GVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLM-KGRTTLVIAHRLSTIVDAD
2r6gB           ---LSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVAMTLAD
2r6gA           ---LSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRGRTMIYVTHDQVAMTLAD
1ii8B           LTFLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAAD
1f2uD           LTFLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAAD
1f2uB           LTFLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAAD
1f2tB           LTFLSGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAAD
1jj7A           ---LSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERSRSVLLITQHLSLVEQAD
2pcjA           YE-LSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHER-------
1f3oA           ---LSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDGKTVVVVTHDINVARFGE
1us8B           LTFLRGGERFRLAMSLYLAGEISLLILDEPTPYLDEERRRKLITIMERYLKKIPQVILVSHDEELKDAAD
2ghiD           ---LSGGERQRIAIARCLLKDPKIVIFDDSKT----------EYLFQKAVEDNRTLIIIAHRLSTISSAE
2ghiA           ---LSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDL-RKNRTLIIIAHRLSTISSAE
2cbzA           GVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAAHVGKHIFENVIGPKGMLKNKTRILVTHSMSYLPQVD
2ix3A           ISALSGGWKMKLALARAVLRNADILLLDEPT---------------------------------------
2iwhB           ISALSGGWKMKLALARAVLRNADILLLDEPT---------------------------------------


                         .         .         .         +         .         .         .:280
query           WIIDLGPGAGHEGGRVVFEGTPAELVAARSTLTGQHLxxxxxx
2vf8B           WVLDIGPGAGEDGGRLVAQGTPAEVAQAAGSVTAPYL------
2vf7C           WVLDIGPGAGEDGGRLVAQGTPAEVAQAAGSVTAPYL------
2vf7A           WVLDIGPGAGEDGGRLVAQGTPAEVAQAAGSVTAPYL------
2vf8A           WVLDIGPGAGEDGGRLVAQGTPAEVAQAAGSVTAPYL------
2vf7B           WVLDIGPGAGEDGGRLVAQGTPAEVAQAAGSVTAPYL------
2r6fB           YIIDLGPEGGDRGGQIVAVGTPEEVAEVKESHTGRYL------
2r6fA           YIIDLGPEGGDRGGQIVAVGTPEEVAEVKESHTGRYL------
2yz2B           RVVVL------EKGKKVFDGTRMEFL-----------------
2yz2A           RVVVL------EKGKKVFDGTRMEFL-----------------
2hydA           KIVVI------ENGHIVETGTHRELIA----------------
1b0uA           HVIFLHQGKIEEEG-----------------------------
3bk7A           DVI----------------------------------------
1pf4A           EILVVDEGEIIERGR----------------------------
1mt0A           RIIVMEKGKIVEQGK----------------------------
3g60A           VI------AGFDGGVIVEQGNHDELM-----------------
3g5uA           VI------AGFDGGVIVEQGNHDELM-----------------
2ff7A           RIIVMEKGKIVEQGK----------------------------
3b5jA           RIIVMEKGKIVEQGK----------------------------
1yqtA           DII----------------------------------------
2fgkA           RIIVMEKGKIVEQGK----------------------------
2ffbA           RIIVMEKGKIVEQGK----------------------------
1xefA           RIIVMEKGKIVEQGK----------------------------
2ffaA           RIIVMEKGKIVEQGK----------------------------
1q12A           KIVVL------DAGRVAQVGKPLEL------------------
2oukB           RVLFM------DGGYIIEEGKPEDL------------------
2oljA           RVLFM------DGGYIIEEGKPEDL------------------
3fh6A           KIVVL------DAGRVAQVGKPLEL------------------
2awoC           KIVVL------DAGRVAQVGKPLEL------------------
2awoA           KIVVL------DAGRVAQVGKPLEL------------------
2awnC           KIVVL------DAGRVAQVGKPLEL------------------
2awnB           KIVVL------DAGRVAQVGKPLEL------------------
1mv5D           KIYFI------EKGQITGSGKHNELVA----------------
1mv5A           KIYFI------EKGQITGSGKHNELVA----------------
2r6gB           KIVVL------DAGRVAQVGKPLEL------------------
2r6gA           KIVVL------DAGRVAQVGKPLEL------------------
1ii8B           HVIRISLENGSSKVEVV--------------------------
1f2uD           HVIRISLENGSSKVEVV--------------------------
1f2uB           HVIRISLENGSSKVEVV--------------------------
1f2tB           HVIRISLENGSSKVEVV--------------------------
1jj7A           HILFLEGGAIREGG-----------------------------
2pcjA           -------------------------------------------
1f3oA           RIIYLKDG-----------------------------------
1us8B           HVIRISLENGSSKVEVV--------------------------
2ghiD           SIILLNK------GKIVEKGTHKDLL-----------------
2ghiA           SIILLNK------GKIVEKGTHKDLL-----------------
2cbzA           VIIVM------SGGKISEMGSYQELLA----------------
2ix3A           -------------------------------------------
2iwhB           -------------------------------------------