[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55679.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1e3aB.bssp"
#ERROR : Can't open dsspfile "1gkfB.bssp"
#ERROR : Can't open dsspfile "1fxhB.bssp"
#ERROR : Can't open dsspfile "1kehA.bssp"
#ERROR : Can't open dsspfile "1kecB.bssp"
#ERROR : Can't open dsspfile "1h2gB.bssp"
#ERROR : Can't open dsspfile "1gk9B.bssp"
#ERROR : Can't open dsspfile "1jx9B.bssp"
#ERROR : Can't open dsspfile "1oqzB.bssp"
#ERROR : Can't open dsspfile "1oqzA.bssp"
#ERROR : Can't open dsspfile "1gk1B.bssp"
#ERROR : Can't open dsspfile "2ae5B.bssp"
#ERROR : Can't open dsspfile "2ae3B.bssp"
#ERROR : Can't open dsspfile "1ai4B.bssp"
#ERROR : Can't open dsspfile "1fm2B.bssp"
#ERROR : Can't open dsspfile "1gk0B.bssp"
#ERROR : Can't open dsspfile "1ghdB.bssp"
#ERROR : Can't open dsspfile "1or0B.bssp"
#ERROR : Can't open dsspfile "1cp9B.bssp"
#ERROR : Can't open dsspfile "2advC.bssp"
#ERROR : Can't open dsspfile "1pnkA.bssp"
#ERROR : Can't open dsspfile "1kecA.bssp"
#ERROR : Can't open dsspfile "1h2gA.bssp"
#ERROR : Can't open dsspfile "1gm8A.bssp"
#ERROR : Can't open dsspfile "1gk9A.bssp"
#ERROR : Can't open dsspfile "1fxhA.bssp"
#ERROR : Can't open dsspfile "1e3aA.bssp"
#ERROR : Can't open dsspfile "1ai6A.bssp"
#ERROR : Can't open dsspfile "1gkfA.bssp"
#ERROR : Can't open dsspfile "1cp9A.bssp"
#ERROR : Can't open dsspfile "1or0A.bssp"
#ERROR : Can't open dsspfile "1gk1A.bssp"
#ERROR : Can't open dsspfile "1gk0A.bssp"
#ERROR : Can't open dsspfile "1ghdA.bssp"
#ERROR : Can't open dsspfile "1fm2A.bssp"
#ERROR : Can't open dsspfile "2ae5A.bssp"
#ERROR : Can't open dsspfile "2ae4A.bssp"
#ERROR : Can't open dsspfile "2ae3A.bssp"
#ERROR : Can't open dsspfile "2advA.bssp"
#ERROR : Can't open dsspfile "1or0C.bssp"

## Summary of PDB Search
:854
    3e-26  35%  1e3aB  [d.153.1] PENICILLIN AMIDASE BETA SUBUNIT
    8e-26  34%  1gkfB  [d.153.1] PENICILLIN G ACYLASE BETA SUBUNIT
    8e-26  34%  1fxhB  [d.153.1] PENICILLIN ACYLASE
    1e-25  32%  1kehA  [d.153.1] PRECURSOR OF CEPHALOSPORIN ACYLASE
    1e-25  34%  1kecB  [d.153.1] PENICILLIN ACYLASE BETA SUBUNIT
    1e-25  35%  1h2gB  [d.153.1] PENICILLIN G ACYLASE BETA SUBUNIT
    1e-25  34%  1gk9B  [d.153.1] PENICILLIN G ACYLASE BETA SUBUNIT
    2e-25  34%  1jx9B  [d.153.1] PENICILLIN G ACYLASE BETA SUBUNIT
    4e-25  33%  1oqzB  [d.153.1] GLUTARYL ACYLASE
    4e-25  33%  1oqzA  [d.153.1] GLUTARYL ACYLASE
    3e-24  33%  1gk1B  [d.153.1] CEPHALOSPORIN ACYLASE
    9e-24  33%  2ae5B  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    2e-23  33%  2ae3B  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-23  33%  1ai4B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    2e-21  37%  1fm2B  [d.153.1] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    1e-20  37%  1gk0B  [d.153.1] CEPHALOSPORIN ACYLASE
    1e-20  37%  1ghdB  [d.153.1] GLUTARYL-7-AMINOCEPHALOSPORANIC ACID ACYLASE
    8e-20  37%  1or0B  [d.153.1] GLUTARYL ACYLASE
    2e-19  30%  1cp9B  [d.153.1] PENICILLIN AMIDOHYDROLASE
    9e-19  32%  2advC  [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE
    2e-16  38%  1pnkA  [d.153.1] PENICILLIN AMIDOHYDROLASE
    2e-16  38%  1kecA  [d.153.1] PENICILLIN ACYLASE ALPHA SUBUNIT
    2e-16  38%  1h2gA  [d.153.1] PENICILLIN G ACYLASE ALPHA SUBUNIT
    2e-16  38%  1gm8A  [d.153.1] PENICILLIN G ACYLASE ALPHA SUBUNIT
    2e-16  38%  1gk9A  [d.153.1] PENICILLIN G ACYLASE ALPHA SUBUNIT
    2e-16  38%  1fxhA  [d.153.1] PENICILLIN ACYLASE
    2e-16  38%  1e3aA  [d.153.1] PENICILLIN AMIDASE ALPHA SUBUNIT
    2e-16  38%  1ai6A  [d.153.1] PENICILLIN AMIDOHYDROLASE
    6e-15  39%  1gkfA  [d.153.1] PENICILLIN G ACYLASE ALPHA SUBUNIT
    8e-15  28%  1cp9A  [d.153.1] PENICILLIN AMIDOHYDROLASE
    4e-07  31%  1or0A  [d.153.1] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-07  31%  1gk1A  [d.153.1] CEPHALOSPORIN ACYLASE
    4e-07  31%  1gk0A  [d.153.1] CEPHALOSPORIN ACYLASE
    4e-07  31%  1ghdA  [d.153.1] GLUTARYL-7-AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-07  31%  1fm2A  [d.153.1] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-07  31%  2ae5A  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-07  31%  2ae4A  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-07  31%  2ae3A  [x.x.x] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
    4e-07  31%  2advA  [x.x.x] GLUTARYL 7- AMINOCEPHALOSPORANIC ACID ACYLASE
    1e-06  30%  1or0C  [d.153.1] GLUTARYL 7-AMINOCEPHALOSPORANIC ACID ACYLASE
:854

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSAPVTVYRDEYGITHLYADT
1e3aB           ----------------------------------------------------------------------
1gkfB           ----------------------------------------------------------------------
1fxhB           ----------------------------------------------------------------------
1kehA           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
1kecB           ----------------------------------------------------------------------
1h2gB           ----------------------------------------------------------------------
1gk9B           ----------------------------------------------------------------------
1jx9B           ----------------------------------------------------------------------
1oqzB           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
1oqzA           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
1gk1B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2ae3B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1fm2B           ----------------------------------------------------------------------
1gk0B           ----------------------------------------------------------------------
1ghdB           ----------------------------------------------------------------------
1or0B           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1pnkA           --------------------------------------------------SSEIKIVRDEYGMPHIYAND
1kecA           --------------------------------------------------SSEIKIVRDEYGMPHIYAND
1h2gA           --------------------------------------------------SSEIKIVRDEYGMPHIYAND
1gm8A           --------------------------------------------------SSEIKIVRDEYGMPHIYAND
1gk9A           --------------------------------------------------SSEIKIVRDEYGMPHIYAND
1fxhA           --------------------------------------------------SSEIKIVRDEYGMPHIYAND
1e3aA           --------------------------------------------------SSEIKIVRDEYGMPHIYAND
1ai6A           --------------------------------------------------SSEIKIVRDEYGMPHIYAND
1gkfA           --------------------------------------------------SSEIKIVRDEYG-PHIYAND
1cp9A           --------------------------------------------------STQIKIERDNYGVPHIYAND
1or0A           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
1gk1A           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
1gk0A           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
1ghdA           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
1fm2A           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
2ae5A           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
2ae4A           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
2ae3A           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
2advA           ---------------------------------------------------APIAAYKDGYGVPHIYGVD
1or0C           ----------------------------------------------------------DGYGVPHIYGVD


                         .         .         *         .         .         .         .:140
query           PEDLFTAQGYVHAQDRFWSMDFNRHVTAGRLAELFGADQVPTDAYLRTMGWRRVAEAEYDLLAEETRRYL
1e3aB           ----------------------------------------------------------------------
1gkfB           ----------------------------------------------------------------------
1fxhB           ----------------------------------------------------------------------
1kehA           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
1kecB           ----------------------------------------------------------------------
1h2gB           ----------------------------------------------------------------------
1gk9B           ----------------------------------------------------------------------
1jx9B           ----------------------------------------------------------------------
1oqzB           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
1oqzA           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
1gk1B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2ae3B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1fm2B           ----------------------------------------------------------------------
1gk0B           ----------------------------------------------------------------------
1ghdB           ----------------------------------------------------------------------
1or0B           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1pnkA           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1kecA           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1h2gA           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1gm8A           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1gk9A           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1fxhA           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1e3aA           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1ai6A           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1gkfA           TWHLFYGYGYVVAQDRLFQMEMARRSTQGTVAEVLGKDFVKFDKDIRRNYWPDAIRAQIAALSPEDMSIL
1cp9A           TYSLFYGYGYAVAQDRLFQMEMAKRSTQGTVSEVFGKDYISFDKEIRNNYWPDSIHKQINQLPSQEQDIL
1or0A           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
1gk1A           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
1gk0A           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
1ghdA           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
1fm2A           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
2ae5A           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
2ae4A           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
2ae3A           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
2advA           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL
1or0C           APSAFYGYGWAQARSHGDNILRLYGEARGKGAEYWGPDYEQTTVWLLTNGVPERAQQWYAQQSPDFRANL


                         +         .         .         .         .         *         .:210
query           DAYAEGVNAYLEGKSATEVSLEYAVLAATNSEYEIEPWSAVDSLAWLKAMAWDLAGNMHDEIARASLLxx
1e3aB           ----------------------------------------------------------------------
1gkfB           ----------------------------------------------------------------------
1fxhB           ----------------------------------------------------------------------
1kehA           DAFAAGINAYAQ----------------------------------------------------------
1kecB           ----------------------------------------------------------------------
1h2gB           ----------------------------------------------------------------------
1gk9B           ----------------------------------------------------------------------
1jx9B           ----------------------------------------------------------------------
1oqzB           DAFAAGINAYAQ----------------------------------------------------------
1oqzA           DAFAAGINAYAQ----------------------------------------------------------
1gk1B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2ae3B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1fm2B           ----------------------------------------------------------------------
1gk0B           ----------------------------------------------------------------------
1ghdB           ----------------------------------------------------------------------
1or0B           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1pnkA           QGYADGMNAWID----------------------------------------------------------
1kecA           QGYADGMNAWID----------------------------------------------------------
1h2gA           QGYADGMNAWID----------------------------------------------------------
1gm8A           QGYADGMNAWID----------------------------------------------------------
1gk9A           QGYADGMNAWID----------------------------------------------------------
1fxhA           QGYADGMNAWID----------------------------------------------------------
1e3aA           QGYADGMNAWID----------------------------------------------------------
1ai6A           QGYADGMNAWID----------------------------------------------------------
1gkfA           QGYADGMNAWID----------------------------------------------------------
1cp9A           RGYADGMNAWIKQINTKPDDL----MPKQFIDYDFLPWTSFDVAMIMVGTLANRFSDMNSEIDNLALL--
1or0A           DAFAAGINAYAQ----------------------------------------------------------
1gk1A           DAFAAGINAYAQ----------------------------------------------------------
1gk0A           DAFAAGINAYAQ----------------------------------------------------------
1ghdA           DAFAAGINAYAQ----------------------------------------------------------
1fm2A           DAFAAGINAYAQ----------------------------------------------------------
2ae5A           DAFAAGINAYAQ----------------------------------------------------------
2ae4A           DAFAAGINAYAQ----------------------------------------------------------
2ae3A           DAFAAGINAYAQ----------------------------------------------------------
2advA           DAFAAGINAYAQ----------------------------------------------------------
1or0C           DAFAAGINAYAQ----------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e3aB           ----------------------------------------------------------------------
1gkfB           ----------------------------------------------------------------------
1fxhB           ----------------------------------------------------------------------
1kehA           ----------------------------------------------------------------------
1kecB           ----------------------------------------------------------------------
1h2gB           ----------------------------------------------------------------------
1gk9B           ----------------------------------------------------------------------
1jx9B           ----------------------------------------------------------------------
1oqzB           ----------------------------------------------------------------------
1oqzA           ----------------------------------------------------------------------
1gk1B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2ae3B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1fm2B           ----------------------------------------------------------------------
1gk0B           ----------------------------------------------------------------------
1ghdB           ----------------------------------------------------------------------
1or0B           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1pnkA           ----------------------------------------------------------------------
1kecA           ----------------------------------------------------------------------
1h2gA           ----------------------------------------------------------------------
1gm8A           ----------------------------------------------------------------------
1gk9A           ----------------------------------------------------------------------
1fxhA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1gkfA           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1or0A           ----------------------------------------------------------------------
1gk1A           ----------------------------------------------------------------------
1gk0A           ----------------------------------------------------------------------
1ghdA           ----------------------------------------------------------------------
1fm2A           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
2ae3A           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
1or0C           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           RTFGPASSDLGSNSWVVSGEHTASGLPLLANDPHLGAVMPSIWYQMGLHCTTVDESCPFDVTGFTFPGLT
1e3aB           ----------GSNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
1gkfB           -----------SNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
1fxhB           -----------SNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
1kehA           RTLGPDLADQGANSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
1kecB           -----------SNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
1h2gB           -----------SNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
1gk9B           -----------SNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
1jx9B           -----------SNMWVIGKSKAQDAKAIMVNGPQAGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
1oqzB           RTLGPDLADQGSNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
1oqzA           RTLGPDLADQGSNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
1gk1B           -----------SNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
2ae5B           ------------NSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
2ae3B           -----------SNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
1ai4B           -----------SNMWVIGKSKAQDAKAIMVNGPQFGWYAPAYTYGIGLH------GAGYDVTGNTPFAYP
1fm2B           -----------SNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
1gk0B           -----------SNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
1ghdB           -----------SNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
1or0B           -----------SNSWAVAPGKTANGNALLLQNPHLSWTTDYFTYYEA-HLVTPD----FEIYGATQIGLP
1cp9B           -----------SNVWLVGKTKASGAKAILLNGPQFGWFNPAYTYGIGLH------GAGFNIVGNTPFAYP
2advC           ------------------------------------------------HLVTPD----FEIYGATQIGLP
1pnkA           ----------------------------------------------------------------------
1kecA           ----------------------------------------------------------------------
1h2gA           ----------------------------------------------------------------------
1gm8A           ----------------------------------------------------------------------
1gk9A           ----------------------------------------------------------------------
1fxhA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1gkfA           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1or0A           ----------------------------------------------------------------------
1gk1A           ----------------------------------------------------------------------
1gk0A           ----------------------------------------------------------------------
1ghdA           ----------------------------------------------------------------------
1fm2A           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
2ae3A           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
1or0C           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           GVVIGANDTIAWGFTNLGPDVIDLYLEKLDGDSAIVDGAPEPLETRTETIRVAGGDDVEITVRSSRHGPL
1e3aB           GLVFGHNGVISWGSTAGFGDDVDIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
1gkfB           GLVFGHNGVISWGSTAGFGDDVDIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
1fxhB           GLVFGHNGVISWGSTAGFGDDVDIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
1kehA           VIRFAFNQRM--GITNTVNGMVGAYRLTLQDGGYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
1kecB           GLVFGHNGVISWGSTAGFGDDVDIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
1h2gB           GLVFGHNGVISWGSTGLGDDV-DIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
1gk9B           GLVFGHNGVISWGSTAGFGDDVDIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
1jx9B           GLVFGHNGVISWGSTAGFGDDVDIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
1oqzB           VIRFAFNQRM--GITNTVNGMVGAYRLTLQDGGYLYDGQVRPFERPQASYRLRQADDKPLEIRSSVHGPV
1oqzA           VIRFAFNQRM--GITNTVNGMVGAYRLTLQDGGYLYDGQVRPFERPQASYRLRQADDKPLEIRSSVHGPV
1gk1B           VIRFAFNQRM--GITNTVNGMVGAYRLTLQDGGYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
2ae5B           VIRFAFNQRM--GITNTVNGMVGAYRLTLQDGGYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
2ae3B           VIKFAFNQRM--GITNTVNGMVGAYRLTLQDGGYLYDGQVRPFERPQASYRLRQADDKPLEIRSSVHGPV
1ai4B           GLVFGHNGVISWGSTAGFGDDVDIFAERLSAEKPLHNGKWVKMLSREETITVKNGQAETFTVWRTVHGNI
1fm2B           VIRFAFNQR---GITNTGVGATNYRLTLQDG-GYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
1gk0B           VIRFAFNQR---GITNTGVGATNYRLTLQDG-GYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
1ghdB           VIRFAFNQR---GITNTGVGATNYRLTLQDG-GYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
1or0B           VIRFAFNQR---GITNTGVGATNYRLTLQDG-GYLYDGQVRPFERPQASYRLRQADDKPLEIRSSVHGPV
1cp9B           AILFGHNGHVSWGSTAGFGDGVDIFAEQVDPNSYLHQGQWKKMLSRQETLNVKGEQPITFEIYRTVHGNV
2advC           VIRFAFNQRM--GITNTVNGMVGAYRLTLQDGGYLYDGQVRPFERRQASYRLRQADDKPLEIRSSVHGPV
1pnkA           ----------------------------------------------------------------------
1kecA           ----------------------------------------------------------------------
1h2gA           ----------------------------------------------------------------------
1gm8A           ----------------------------------------------------------------------
1gk9A           ----------------------------------------------------------------------
1fxhA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1gkfA           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1or0A           ----------------------------------------------------------------------
1gk1A           ----------------------------------------------------------------------
1gk0A           ----------------------------------------------------------------------
1ghdA           ----------------------------------------------------------------------
1fm2A           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
2ae3A           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
1or0C           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LSDPELGAQLRTFAAKAPVTPEGEPAETAQDGDYAVAISWTALTPGRTADAIFLLNRARTFDEFREAART
1e3aB           LQTDQT---TQTAYAKS----------RAWDGEVASLLAWTHQM------------KAKNWQEWTQQAAK
1gkfB           LQTDQ-------------TTQTAYAKSRAWDGEVASLLAWTHQM------------KAKNWQEWTQQAAK
1fxhB           LQTDQ-------------TTQTAYAKSRAWDGELASLLAWTHQM------------KAKNWQEWTQQAAK
1kehA           FE--------------------------RADGT-AVAVRVAGLDRPGMLEQYFDMITAHSFDDYEAAMAR
1kecB           LQTDQT---TQTAYAKS----------RAWDGELASLLAWTHQM------------KAKNWQEWTQQAAK
1h2gB           LQTDQT---TQTAYAKS----------RAWDGEVASLLAWTHQM------------KAKNWQEWTQQAAK
1gk9B           LQTDQT---TQTAYAKS----------RAWDGEVASLLAWTHQM------------KAKNWQEWTQQAAK
1jx9B           LQTDQT---TQTAYAKS----------RAWDGELASLLAWTHQM------------KAKNWQEWTQQAAK
1oqzB           FE--------------------------RADGT-AVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
1oqzA           FE--------------------------RADGT-AVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
1gk1B           FE--------------------------RADGT-AVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
2ae5B           FE--------------------------RADGT-AVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
2ae3B           FE--------------------------RADGT-AVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
1ai4B           LQTDQ-------------TTQTAYAKSRAWDGEVASLLAWTHQMXXXXXXXXXXXXXXXXL---------
1fm2B           FE--------------------------RADGT-AVAVRVAGLDPG--LEQYFDIT-AHSFDDYEAAAR-
1gk0B           FE--------------------------RADGT-AVAVRVAGLDPG--LEQYFDIT-ADSFDDY-EAALA
1ghdB           FE--------------------------RADGT-AVAVRVAGLDPG--LEQYFDIT-ADSFDDY-EAALA
1or0B           FE--------------------------RADGT-AVAVRVAGLDPG--LEQYFDIT-ADSFDDY-EAALA
1cp9B           VK-------------RDKTTHTAYSKARAWDGELTSLMAWVKQGQAQ--------NWQQWLDQAQNQALT
2advC           FE--------------------------RADGT-AVAVRVAGLDRPGMLEQYFDMITADSFDDYEAALAR
1pnkA           ----------------------------------------------------------------------
1kecA           ----------------------------------------------------------------------
1h2gA           ----------------------------------------------------------------------
1gm8A           ----------------------------------------------------------------------
1gk9A           ----------------------------------------------------------------------
1fxhA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1gkfA           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1or0A           ----------------------------------------------------------------------
1gk1A           ----------------------------------------------------------------------
1gk0A           ----------------------------------------------------------------------
1ghdA           ----------------------------------------------------------------------
1fm2A           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
2ae3A           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
1or0C           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           FEVPAQNLIYADTSGNIGYQAPGKIPVRGKGDGRWPAPGWDSDYDWKEYLPFEELPTVVNPDSGFIVTAN
1e3aB           -QALTINWYYADVNGNIGYVHTGAYPDRQSGDPRLPVPG-TGKWDWKGLLPFEMNPKVYNPQSGYIANWN
1gkfB           -QALTINWYYADVNGNIGYVHTGAYPDRQSGDPRLPVPG-TGKWDWKGLLPFEMNPKVYNPQSGYIANAN
1fxhB           -QALTINWYYADVNGNIGYVHTGAYPDRQSGDPRLPVPG-TGKWDWKGLLPFEMNPKVYNPQSGYIANAN
1kehA           MQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1kecB           -QALTINWYYADVNGNIGYVHTGAYPDRQSGDPRLPVPG-TGKWDWKGLLPFEMNPKVYNPQSGYIANWN
1h2gB           -QALTINWYYADVNGNIGYVHTGAYPDRQSGDPRLPVPG-TGKWDWKGLLPFEMNPKVYNPQSGYIANWN
1gk9B           -QALTINWYYADVNGNIGYVHTGAYPDRQSGDPRLPVPG-TGKWDWKGLLPFEMNPKVYNPQSGYIANWN
1jx9B           -QALTINWYYADVNGNIGYVHTGAYPDRQSGDPRLPVPG-TGKWDWKGLLPFEMNPKVYNPQSGYIANWN
1oqzB           MQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1oqzA           MQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1gk1B           MQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
2ae5B           MQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
2ae3B           MQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1ai4B           ----TINWYYADVNGNIGYVHTGAYPDRQSGDPRLPVPG-TGKWDWKGLLPFEMNPKVYNPQSGYIANWN
1fm2B           -QVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQGPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1gk0B           RQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1ghdB           RQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1or0B           RQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1cp9B           I-----NWYYADKDGNIGYVHTGHYPDRQNHDPRLPVSG-TGEWDWKGIQPFANNPKVYNPKSGYIANWN
2advC           MQVPTFNIVYADREGTINYSFNGVAPKRAEGDAFWQVPGDSSRYLWTETHPLDDLPRVTNPPGGFVQNSN
1pnkA           ----------------------------------------------------------------------
1kecA           ----------------------------------------------------------------------
1h2gA           ----------------------------------------------------------------------
1gm8A           ----------------------------------------------------------------------
1gk9A           ----------------------------------------------------------------------
1fxhA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1gkfA           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1or0A           ----------------------------------------------------------------------
1gk1A           ----------------------------------------------------------------------
1gk0A           ----------------------------------------------------------------------
1ghdA           ----------------------------------------------------------------------
1fm2A           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
2ae3A           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
1or0C           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           QAVVDSGYPHLLTTDWDYGYRSQRVVTLLEAAIADGGLTVEDMVDIQLDNENSGARALVPYLVExxxxxx
1e3aB           NS-PQKDYPDLFAFLWGGADRVTEIDRLLE---QKPRLTADQAWDVQTSRQDLNLRLFLPTL--------
1gkfB           SPQKDYPASDLFAFLWGGADRVTEIDRLLE---QKPRLTADQAWDVQTSRQDLNLRLFLPTL--------
1fxhB           SPQKDYPASDLFAFLWGGADRVTEIDRLLE---QKPRLTADQAWDVQTSRQDLNLRLFLPTL--------
1kehA           DTYCPANHPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQFSHRAVMADRTLPDLI-------
1kecB           NS-PQKDYPDLFAFLWGGADRVTEIDRLLE---QKPRLTADQAWDVQTSRQDLNLRLFLPTL--------
1h2gB           NS-PQKDYPDLFAFLWGGADRVTEIDRLLE---QKPRLTADQAWDVQTSRQDLNLRLFLPTL--------
1gk9B           NS-PQKDYPDLFAFLWGGADRVTEIDRLLE---QKPRLTADQAWDVQTSRQDLNLRLFLPTL--------
1jx9B           NS-PQKDYPDLFAFLWGGADRVTEIDRLLE---QKPRLTADQAWDVQTSRQDLNLRLFLPTL--------
1oqzB           DXXXXKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLI-------
1oqzA           DXXXXKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLI-------
1gk1B           DXXXXKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLI-------
2ae5B           DXXXXKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLI-------
2ae3B           DXXXXKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLI-------
1ai4B           NS-PQKDYPDLFAFLWGGADRVTEIDRLLE---QKPRLTADQAWDVQTSRQDLNLRLFLPTL--------
1fm2B           DTYCPANHPSYLAPQTPHSLRAQQSVRLSE----------------------------------------
1gk0B           DXXXXKDFPSYLAPQTPHSLRAQQSVRLSE----------------------------------------
1ghdB           DXXXXKDFPSYLAPQTPHSLRAQQSVRLSE----------------------------------------
1or0B           DXXXXKDFPSYLAPQTPHSLRAQQSVRLSE----------------------------------------
1cp9B           NSPA-KNYPDLFAFLWGSADRVKEIDNRIEAY---DKLTADDMWAIQTSRVDLNHRLFTPFLTQ------
2advC           DXXXXKDFPSYLAPQTPHSLRAQQSVRLMS---ENDDLTLERFMALQLSHRAVMADRTLPDLI-------
1pnkA           ----------------------------------------------------------------------
1kecA           ----------------------------------------------------------------------
1h2gA           ----------------------------------------------------------------------
1gm8A           ----------------------------------------------------------------------
1gk9A           ----------------------------------------------------------------------
1fxhA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1gkfA           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1or0A           ----------------------------------------------------------------------
1gk1A           ----------------------------------------------------------------------
1gk0A           ----------------------------------------------------------------------
1ghdA           ----------------------------------------------------------------------
1fm2A           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
2ae3A           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
1or0C           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e3aB           ----------------------------------------------------------------------
1gkfB           ----------------------------------------------------------------------
1fxhB           ----------------------------------------------------------------------
1kehA           ----------------------------------------------------------------------
1kecB           ----------------------------------------------------------------------
1h2gB           ----------------------------------------------------------------------
1gk9B           ----------------------------------------------------------------------
1jx9B           ----------------------------------------------------------------------
1oqzB           ----------------------------------------------------------------------
1oqzA           ----------------------------------------------------------------------
1gk1B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2ae3B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1fm2B           ----------------------------------------------------------------------
1gk0B           ----------------------------------------------------------------------
1ghdB           ----------------------------------------------------------------------
1or0B           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1pnkA           ----------------------------------------------------------------------
1kecA           ----------------------------------------------------------------------
1h2gA           ----------------------------------------------------------------------
1gm8A           ----------------------------------------------------------------------
1gk9A           ----------------------------------------------------------------------
1fxhA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1gkfA           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1or0A           ----------------------------------------------------------------------
1gk1A           ----------------------------------------------------------------------
1gk0A           ----------------------------------------------------------------------
1ghdA           ----------------------------------------------------------------------
1fm2A           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
2ae3A           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
1or0C           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e3aB           ----------------------------------------------------------------------
1gkfB           ----------------------------------------------------------------------
1fxhB           ----------------------------------------------------------------------
1kehA           ----------------------------------------------------------------------
1kecB           ----------------------------------------------------------------------
1h2gB           ----------------------------------------------------------------------
1gk9B           ----------------------------------------------------------------------
1jx9B           ----------------------------------------------------------------------
1oqzB           ----------------------------------------------------------------------
1oqzA           ----------------------------------------------------------------------
1gk1B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2ae3B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1fm2B           ----------------------------------------------------------------------
1gk0B           ----------------------------------------------------------------------
1ghdB           ----------------------------------------------------------------------
1or0B           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1pnkA           ----------------------------------------------------------------------
1kecA           ----------------------------------------------------------------------
1h2gA           ----------------------------------------------------------------------
1gm8A           ----------------------------------------------------------------------
1gk9A           ----------------------------------------------------------------------
1fxhA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1gkfA           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1or0A           ----------------------------------------------------------------------
1gk1A           ----------------------------------------------------------------------
1gk0A           ----------------------------------------------------------------------
1ghdA           ----------------------------------------------------------------------
1fm2A           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
2ae3A           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
1or0C           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1e3aB           ----------------------------------------------------------------------
1gkfB           ----------------------------------------------------------------------
1fxhB           ----------------------------------------------------------------------
1kehA           ----------------------------------------------------------------------
1kecB           ----------------------------------------------------------------------
1h2gB           ----------------------------------------------------------------------
1gk9B           ----------------------------------------------------------------------
1jx9B           ----------------------------------------------------------------------
1oqzB           ----------------------------------------------------------------------
1oqzA           ----------------------------------------------------------------------
1gk1B           ----------------------------------------------------------------------
2ae5B           ----------------------------------------------------------------------
2ae3B           ----------------------------------------------------------------------
1ai4B           ----------------------------------------------------------------------
1fm2B           ----------------------------------------------------------------------
1gk0B           ----------------------------------------------------------------------
1ghdB           ----------------------------------------------------------------------
1or0B           ----------------------------------------------------------------------
1cp9B           ----------------------------------------------------------------------
2advC           ----------------------------------------------------------------------
1pnkA           ----------------------------------------------------------------------
1kecA           ----------------------------------------------------------------------
1h2gA           ----------------------------------------------------------------------
1gm8A           ----------------------------------------------------------------------
1gk9A           ----------------------------------------------------------------------
1fxhA           ----------------------------------------------------------------------
1e3aA           ----------------------------------------------------------------------
1ai6A           ----------------------------------------------------------------------
1gkfA           ----------------------------------------------------------------------
1cp9A           ----------------------------------------------------------------------
1or0A           ----------------------------------------------------------------------
1gk1A           ----------------------------------------------------------------------
1gk0A           ----------------------------------------------------------------------
1ghdA           ----------------------------------------------------------------------
1fm2A           ----------------------------------------------------------------------
2ae5A           ----------------------------------------------------------------------
2ae4A           ----------------------------------------------------------------------
2ae3A           ----------------------------------------------------------------------
2advA           ----------------------------------------------------------------------
1or0C           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxx
1e3aB           --------------
1gkfB           --------------
1fxhB           --------------
1kehA           --------------
1kecB           --------------
1h2gB           --------------
1gk9B           --------------
1jx9B           --------------
1oqzB           --------------
1oqzA           --------------
1gk1B           --------------
2ae5B           --------------
2ae3B           --------------
1ai4B           --------------
1fm2B           --------------
1gk0B           --------------
1ghdB           --------------
1or0B           --------------
1cp9B           --------------
2advC           --------------
1pnkA           --------------
1kecA           --------------
1h2gA           --------------
1gm8A           --------------
1gk9A           --------------
1fxhA           --------------
1e3aA           --------------
1ai6A           --------------
1gkfA           --------------
1cp9A           --------------
1or0A           --------------
1gk1A           --------------
1gk0A           --------------
1ghdA           --------------
1fm2A           --------------
2ae5A           --------------
2ae4A           --------------
2ae3A           --------------
2advA           --------------
1or0C           --------------