[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55697.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2vf8B.bssp"
#ERROR : Can't open dsspfile "2vf8A.bssp"
#ERROR : Can't open dsspfile "2vf7C.bssp"
#ERROR : Can't open dsspfile "2vf7B.bssp"
#ERROR : Can't open dsspfile "2vf7A.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2qm8B.bssp"
#ERROR : Can't open dsspfile "2qm8A.bssp"
#ERROR : Can't open dsspfile "2qm7B.bssp"
#ERROR : Can't open dsspfile "2qm7A.bssp"

## Summary of PDB Search
:243
    8e-26  31%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-25  30%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-21  32%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    6e-21  34%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    6e-21  34%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-20  34%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    5e-20  38%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    9e-20  30%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    7e-19  27%  2oukB  [x.x.x] PROTEIN ARTP
    7e-19  27%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    1e-18  30%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    8e-18  33%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-18  33%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    8e-18  30%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    8e-18  30%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    8e-18  32%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    8e-18  32%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-17  32%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-17  33%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-17  33%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-17  33%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-17  33%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    2e-17  31%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-17  31%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-17  32%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-17  33%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-17  33%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-17  33%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    9e-17  33%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-16  31%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-16  31%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-16  31%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-16  35%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    8e-16  34%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    8e-16  34%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    8e-16  28%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-15  28%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    1e-15  34%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-15  29%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-15  29%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    3e-15  29%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    3e-15  29%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    4e-15  30%  1ji0A  [c.37.1] ABC TRANSPORTER
    6e-15  28%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    1e-14  30%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-14  28%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    7e-14  25%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    7e-14  25%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    9e-14  32%  1yqtA  [x.x.x] RNASE L INHIBITOR
    2e-13  35%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    6e-13  27%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    4e-12  30%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-12  28%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    7e-12  23%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    9e-12  34%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-11  29%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    1e-11  29%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    1e-11  27%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    3e-11  30%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-11  30%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-11  31%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    4e-11  31%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-11  33%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-11  31%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-10  26%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    1e-10  26%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    2e-10  27%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    3e-10  27%  2d2fA  [x.x.x] SUFC PROTEIN
    4e-10  30%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    4e-10  36%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    4e-10  26%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    5e-10  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-10  28%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    8e-10  31%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-09  31%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    1e-09  30%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-09  30%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-09  30%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  28%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-09  30%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-09  31%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    2e-09  31%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    2e-09  31%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    3e-09  30%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09  30%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09  30%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-09  27%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-09  27%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    7e-09  30%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    9e-09  28%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-08  28%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  28%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-08  34%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-08  28%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  26%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  25%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-08  25%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-08  27%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  28%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-08  28%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    8e-08  27%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    8e-08  27%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    1e-07  27%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    1e-07  28%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-07  28%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-07  25%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    6e-07  36%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-07  36%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-07  27%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    3e-06  32%  2vf8B  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-06  32%  2vf8A  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    3e-06  32%  2vf7C  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    3e-06  32%  2vf7B  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    3e-06  32%  2vf7A  [x.x.x] EXCINUCLEASE ABC, SUBUNIT A.
    3e-06  23%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    4e-06  33%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    4e-06  33%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    5e-06  25%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-04  30%  2qm8B  [x.x.x] GTPASE/ATPASE
    1e-04  30%  2qm8A  [x.x.x] GTPASE/ATPASE
    3e-04  30%  2qm7B  [x.x.x] GTPASE/ATPASE
    5e-04  30%  2qm7A  [x.x.x] GTPASE/ATPASE
:243

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxTPPALEVREVTVRYGDVLALDNVTVEIGRGVVCGLLGANGSGKSTLLKTIAELVTPQSGHVRIHGLPP
2nq2D           --------------------AFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVYQS--
2nq2C           -----ALSVENLGFYYAENFLFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHRPIQGKIEVYQS--
3gfoA           ------LKVEELNYNYSDTHALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILKPSSGRILFDNKPI
2it1B           ------IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIDVTELPP
2it1A           ------IKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYKPTSGKIDVTELPP
1g291           ---------------FGEVTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEEPSRGQIYIGDKLV
2onkA           -----------------------NVDFEMGRDY-CVLLGPTGAGKSVFLELIAGIVKPDRGEVRLNGITP
3dhwC           ------------------IQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLERPTEGSVLVDGQEL
2oukB           ------IDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRNLLEDFXXXXXXXXXXNLKA
2oljA           ------IDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSGKSTFLRNLLEDFXXXXXXXXXXNLKA
1sgwA           ------LEIRDLSVGY-DKPVLERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLKPLKGEIIYNGVPI
2yz2B           --------------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERK
2yz2A           --------------------ALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIEPTSGDVLYDGERK
1oxvA           ----------------GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLV
1oxsC           ----------------GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLV
1mt0A           ---------RNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2ff7A           ---------RNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
1vplA           ----------------------------------------NGAGKTTTLRIISTLIKPSSGIVTVFGKEP
3fh6A           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
2awoA           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
2awnB           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
1q12A           ------VQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
2fgkA           ---------RNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2ffbA           ---------RNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
3b5jA           ---------RNIRFRYDSPVILDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2r6gB           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
2r6gA           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
1l2tB           ------IKLKNVTKTYGEIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKT
1l2tA           ------IKLKNVTKTYGEIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDKPTEGEVYIDNIKT
1xefA           ---------RNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2ffaA           ---------RNIRFRYDSPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDL
2yyzA           ----PSIRVVNLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYKPTSGEVLVNDIPP
2d62A           -------EVKLINIRFGDVTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEEPTRGQIYIEDNLV
1z47B           ----------------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVRVTDLPP
1z47A           ----------------GGARSVRGVSFQIREGEMVGLLGPSGSGKTTILRLIAGLERPTKGDVRVTDLPP
1b0uA           ------LHVIDLHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEKPSEGAIIVNGQNI
1g6hA           --TMEILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYITNKEP
2awoC           ------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
1g9xA           --TMEILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYITNKEP
1gajA           ------LRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLKADEGRVYITNKEP
3fvqB           -----ALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGLPV
3fvqA           -----ALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQPDSGEISLSGLPV
1ji0A           ------LEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVRAQKGKIIFNGQKP
2pcjA           ---------------------LKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDAPTEGKVFLEGKEV
3bk7A           ---------------------------EIRKGEVIGIVGPNGIGKTTFVKMLAGVEEPTEGKVEW-----
1pf4A           ------VDVKDVTFTYQEKPALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYDVDSGSICLDGHDV
3g60A           ---------------------LQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEI
3g5uA           ---------------------LQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEI
1yqtA           ---------------------------EIKKGEVIGIVGPNGIGKTTFVK-LAGVEEPTEGKIEW-----
2pjzA           --------------------SLENINLEVGEKVI--ILGPNGSGKTTLLRAISGLL-PYSGNIFINGMEV
1oxxK           ----------------GKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLV
1f3oA           ------IKLKNVTKTYKGIYALKNVNLNIKEGEFVSI-GPSGSGKSTL-NIIGCLDKPTEGEVYIDNIKT
1jj7A           -----------------DVLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQLLLDGKPL
3d31A           --------------------SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHVPDSGRILLDG---
2ihyB           ---------------------LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPG
2ix3A           ----------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA--------NGQVDGFPT
2iwhB           ----------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKSTLMRAIA--------NGQVDGFPT
2hydA           ------IDIDHVSFQYNDNEALKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYDVTSGQILIDGHNI
2ixfC           -----------------NVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2ixfA           -----------------NVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2qi9C           ---------------------------EVRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPA
2ixfD           -----------------NVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2awnC           ------------SVQLQNVTVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLG--------------
1l7vC           ---------------------------EVRAGEILHLVGPNGAGKSTLL---ARAGTSGKGSIQFAGQPA
1mv5D           ------LSARHVDFAYDDSQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPI
1mv5A           ------LSARHVDFAYDDSQILRDISFEAQPNSIIAFAGPSGGGKSTIFSLLERFYQPTAGEITIDGQPI
1v43A           ------VKLENLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEEPTEGRIDVTYLPP
2d2fA           ------LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAPEYTVERGEILLDGLSP
2ixeA           -----------------NVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2ihyA           ---------------------LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEPATSGTVNLFGKPG
2ghiA           ---------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNV
2pzfA           --TTTEVVMENVTAFWGGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
2ghiC           ---------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNV
2ixeD           -----------------NVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
2cbzA           -----SITVRNATFTWADPPTLNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMDKVEGHVAI-----
2pzgA           ----------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
2pzeB           ----------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
2pzeA           ----------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
1xmiB           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
2d2eA           ------LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAGKSTLGKILAPEYTVERGEILLDGSPD
2ix8A           ----------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKST-LRAIA--------NGQVDGFPT
2iw3B           ----------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKST-LRAIA--------NGQVDGFPT
2iw3A           ----------EFSLAYGAKILLNKTQLRLKRARRYGICGPNGCGKST-LRAIA--------NGQVDGFPT
1xmiE           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
1xmiC           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
1xmiA           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
2pzgB           ----------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
1xmiD           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
2pzfB           ----------------GGTPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
2ixgA           -----------------NVQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQPTGGKVLLDGEPL
1r10A           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0zD           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0zC           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0zB           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0zA           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0xD           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0xC           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0xB           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0xA           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0wC           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0wB           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1r0wA           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1q3hD           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1q3hC           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1q3hB           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1q3hA           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
2awnA           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
1xfaA           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1xf9D           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1xf9C           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1xf9B           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
1xf9A           ---------------------LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELEASEGIIK-HS---
2bbsA           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK------
2zu0C           ------LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGLSP
2d3wA           ------LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGLSP
2bbtB           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK------
2bbtA           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK------
2bbsB           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK------
2ghiB           ---------------------LKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNV
3b60A           ------LEFRNVTFTYPEVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDL
1z2rA           -----AAEFRNVTFTYPEVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYDIDEGHILMDGHDL
2bboA           ---------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
1xmjA           --------VMENVTAFWETPVLKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELEPSEGKIK-HS---
2d3wD           ------LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGLSP
2awoD           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
2awnD           -----SVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLRMNDTPP
2ghiD           -----------VNIEFSDVRTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRFYDAE-GDIKIGGKNV
2vf8B           ----------------------------------------------------------------------
2vf8A           ----------------------------------------------------------------------
2vf7C           ----------------------------------------------------------------------
2vf7B           ----------------------------------------------------------------------
2vf7A           ----------------------------------------------------------------------
2d3wB           ------LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGLSP
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
2d3wC           ------LSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAEDYEVTGGTVEFKGLSP
2qm8B           ---------------------IDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDP
2qm8A           ---------------------IDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDP
2qm7B           ---------------------IDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDP
2qm7A           ---------------------IDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDP


                         .         .         *         .         .         .         .:140
query           AQARKNGLLGYVPQSEQVDWAFPVRVIDVVMMGRYGHMGLTRRPRKSDRDAVAEALERTGLTDLAHRQIG
2nq2D           --------IGFVPQFFSSPFAYSV--LDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREFT
2nq2C           --------IGFVPQFFSSPFAYSV--LDIVLMGRSTHINTFAKPKSHDYQVAMQALDYLNLTHLAKREFT
3gfoA           DYSRKGIMIGIVFQDPD-NQLFSASVYQDVSFGAVN----MKLPEDEIRKRVDNALKRTGIEHLKDKPTH
2it1B           ----KDRNVGLVFQ----NWALYPHM--TVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPW
2it1A           ----KDRNVGLVFQ----NWALYPHM--TVYKNIAFPLELRKAPREEIDKKVREVAKMLHIDKLLNRYPW
1g291           ADPEKG--IFVPPKDRDIAMVFQSYAL-------YPHMTLRKVPRQEIDQRVREVAELLGLTELLNRKPR
2onkA           LPPERRGI-GFVPQ----DYAFPH--LSVYRNIAYGLXXXXXXXXXXXXXXMAEKL---GIAHLLDRKPA
3dhwC           TTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEVKRRVTELLSLVGLGDKHDSYPS
2oukB           KDTNLNKVREEVGMVFQRFNLFPMTVLNNITLAP---MKVRKWPREKAEAKAMELLDKVGLKDKAHAYPD
2oljA           KDTNLNKVREEVGMVFQRFNLFPMTVLNNITLAP---MKVRKWPREKAEAKAMELLDKVGLKDKAHAYPD
1sgwA           TKVK--GKIFFLPEEIIVPRKISVEDYLKAVASLYG--------VKVNKNEIMDALESVEVLDL-KKKLG
2yz2B           KEIRRNGIAFQYPE----DQFFAERVFDEVAFAVKNFY-----PDRDPVPLVKKAMEFVGLDSFKDRVPF
2yz2A           KEIRRNGIAFQYPE----DQFFAERVFDEVAFAVKNFY-----PDRDPVPLVKKAMEFVGLDSFKDRVPF
1oxvA           A---SNGKLIVPPEDRKIGMVFQTWAL-YPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAILDIHHHFPR
1oxsC           A---SNGKLIVPPEDRKIGMVFQTWAL-YPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAILDIHHHFPR
1mt0A           ALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGEKVIYAAKLAGAHDFISEL--REGYNTIVGEQGA
2ff7A           ALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGEKVIYAAKLAGAHDFISEL--REGYNTIVGEQGA
1vplA           HEVRK--LISYLPEE-----AGAYRNMQGIEYLRFV-AGFYASSSSEIEEMVERATEIAGLGEKIKDRVS
3fh6A           AERG----VGMVFQSYAL---YPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD---RKPK
2awoA           AERG----VGMVFQSYAL---YPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD---RKPK
2awnB           AERG----VGMVFQSYAL---YPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD---RKPK
1q12A           AERG----VGMVFQSYAL---YPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD---RKPK
2fgkA           ALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGEKVIYAAKLAGAHDFISEL--REGYNTIVGEQGA
2ffbA           ALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGEKVIYAAKLAGAHDFISEL--REGYNTIVGEQGA
3b5jA           ALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGEKVIYAAKLAGAHDFISEL--REGYNTIVGEQGA
2r6gB           AERG----VGMVFQSYAL---YPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ---LAHLLDRKPK
2r6gA           AERG----VGMVFQSYAL---YPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQ---LAHLLDRKPK
1l2tB           NDLDDDELIGFVQQFNLIPLLTALENVELPLIFKYGAMGEERRKRALECLKMAELEER-----FANHKPN
1l2tA           NDLDDDELIGFVQQFNLIPLLTALENVELPLIFKYGAMGEERRKRALECLKMAELEER-----FANHKPN
1xefA           ALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGEKVIYAAKLAGAHDFISEL--REGYNTIVGEQGA
2ffaA           ALADPNWLRRQVGVVLQDNVLLNRSIIDNISLANPGEKVIYAAKLAGAHDFISEL--REGYNTIVGEQGA
2yyzA           -KYREVGMVFYPHMTVFENIAFPLR---------------ARRISKDEEKRVVEIARKLLIDNLLDRKPT
2d62A           ADPEKGV---FVPPKEQSYALYPHTVYDNIAFP----LKLRKVPKQEIDKRVREVAE-LGLTELLNRKPR
1z47B           -QKRNVGLV-----FQNYALFQHMTVYDNVSFGL-----REKRVPKDEMDAVRELLRFMRLESYANRFPH
1z47A           -QKRNVGLV-----FQNYALFQHMTVYDNVSFGL-----REKRVPKDEMDAVRELLRFMRLESYANRFPH
1b0uA           NLVRKDGQLKVADKNQRLTMVFQMTVLENVMEAPIQVLGLSKHDA---RERALKYLAKVGIDERAQGKYP
1g6hA           AELYHYGIVRQTPQPLKEMTVLENLLIGEICPGESPLNSLFYKPKEEEMEKAFKILEFLKLSHLYDRKAG
2awoC           AE-RGVGMVALYPHSVAENMSFGLKLA-----------GAKKEVINQRVNQVAEVLQLAHLLD---RKPK
1g9xA           AELYHYGIVRTFQTPQ------PLKEMTVLENLLIGEINPGESPLNSEEEMVEKALEFLKLSHLYDRKAG
1gajA           AELYHYGIVRTFQTPQ------PLKEMTVLENLLIGEINPGESPLNSEEEMVEKALEFLKLSHLYDRKAG
3fvqB           RERR----LGYLVQEGVL---FP--HLTVYRNIAYG-LGNGKGRTAQERQRIEAMLELTGISELAGRYPH
3fvqA           RERR----LGYLVQEGVL---FP--HLTVYRNIAYG-LGNGKGRTAQERQRIEAMLELTGISELAGRYPH
1ji0A           AHVINRG-IALVPEGRRI---FPELTV-------YENLGAYNR---KDKEGIKRDLEFPRLKERLKQLGG
2pcjA           DYTNRNRKLGFVFQFHYLIPELTALENVIVPMLKMG------KPKKEAKERGEYLLSELGLGDKLSRKPY
3bk7A           -----DLTVAYKPQYIKAEYEGTV----------YELLSKIDSSKLNSNFYKTELLKPLGIIDLYDRNVE
1pf4A           RDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIEQAARQAHAMEFIENMGLDTVIGENGT
3g60A           KQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEAIHQFID--SLPDKYNTRVG
3g5uA           KQLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVSYEEIVRAAKEAIHQFID--SLPDKYNTRVG
1yqtA           -----DLTVAYKPQYIKADYEGTV----------YELLSKIDASKLNSNFYKTELLKPLGIIDLYDREVN
2pjzA           RKIRN-----YIRYSTNLPEAYEIGVTDIVY--------LYEELKGLDRDLFLEMLKALKLEEILRRKLY
1oxxK           A---SNGKLIVPPEDRKIGMVFQTWAL-YPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAILDIHHHFPR
1f3oA           NDLDDDELIGFVQQFNLIPLLTALENVELPLIFKYRGASGEERRKRALECLKAELEER-----FANHKPN
1jj7A           PQYEHRYLHRQVAAVGQEPQVFGRSLQENIA------YGLTQKPTMEEITAAAVKSGASGLPQGYDTEVS
3d31A           -----KDVTDLSPEKHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIKDPKRVLDTARDLKIEHLLDRNPL
2ihyB           SAETVRQHIGFVSHSLLEKFQEGERVIDVVISGAFKSIGVYQDIDDEIRNEAHQLLKLVG-SAKAQQYIG
2ix3A           QEECRTVYVEHDIDGTHSD----TSVLDFVFESGVG-----------TKEAIKDKLIEFGFTDMIAMPIS
2iwhB           QEECRTVYVEHDIDGTHSD----TSVLDFVFESGVG-----------TKEAIKDKLIEFGFTDMIAMPIS
2hydA           KDFLTGSLRNQIGLVQQDNILFSDTVKENILLGR---------PTATDEEVVEAALPQGYDTEVGERGV-
2ixfC           VQYDHHYLHTQVAAVGQEPLLFGRSFRENIA------YGLTRTPTMEEITAVAMESGASGFPQGYDTEVG
2ixfA           VQYDHHYLHTQVAAVGQEPLLFGRSFRENIA------YGLTRTPTMEEITAVAMESGASGFPQGYDTEVG
2qi9C           WSATKLALRAYLSQQQTPPFATPV-----------WHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTN
2ixfD           VQYDHHYL------------HTQVAAVGQLLFGRSFRYGLTRTPTMEEITAVAMESGASGFPQGYDTEVG
2awnC           --------VGMVFQSYAL---YPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLD---RKPK
1l7vC           WSATKLALRAYLSQQQTPPFATPV-----------WHYLTLHQHDKTRTELLNDVAGALALDDKLGRSTN
1mv5D           SLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGV-
1mv5A           SLENWRSQIGFVSQDSAIMAGTIRENLTYGLEGDYTDEDLWQVLDLAFARSFVENMPDQLNTEVGERGV-
1v43A           KDRNISMVFQHMTVYENI--AFP----------------LKKFPKDEIDKRVRWAAELLQIEELLNRYPA
2d2fA           DERARKGLFLAFQYPVEVPGVTIANFLRLALQAKLGEVGVAEFWTK-----VKKALELLDWDELSRYLNE
2ixeA           VQYDHHYLHTQVAAVGQEPLLFGRSFRENIA------YGLTRTPTMEEITAVAMESGASGFPQGYDTEVG
2ihyA           YSAETRQHIGFVSHSLLEKFQEGERVIDVVISGAID---------DEIRNEAHQLLKLVG-SAKAQQYIG
2ghiA           NKYNRNSIIGIVPQDTIL---FNETIKYNILYGKLDATDVIKATKSAQLYDFIEALPKKWDTIVGNKGM-
2pzfA           ---------GRISFCSQFSWIMPGTIIIGVSYDEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
2ghiC           NKYNRNSIIGIVPQ----DTILFNETIKYNIL--YGKLDATEEVIKATKSAFIEALPKKWDTI-----VG
2ixeD           VQYDHHYL------------HTQVAAVGPLLFGRSFRYGLTRTPTMEEITAVA---MESGAHDFGYDTEV
2cbzA           -----KGSVAYVPQQA---WIQNDSLRENILFG----CQLEEPYYRSVIQACAEILPSGDRTEIGEKGVN
2pzgA           ---------GRISFCSQFSWIMPGTIKENIIFGEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
2pzeB           ---------GRISFCSQFSWIMPGTIKENIIFGEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
2pzeA           ---------GRISFCSQFSWIMPGTIKENIIFGEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
1xmiB           ---------GRISFCSQFSWIMPGTIKENIIAGV-----------SYDEYRYRSVIKACQLEEDISKIVL
2d2eA           ERARKGLFLAFYPVVPGVTIANFLRLALQAKLGR--EVGVAEFWTK-----VKKALE---LLDWDESYLS
2ix8A           QEECRTVYVEHDIDGTHSD----TSVLDFVFESGVG-----------TKEAIKDKLIEFGFTD-EIAPIS
2iw3B           QEECRTVYVEHDIDGTHSD----TSVLDFVFESGVG-----------TKEAIKDKLIEFGFTD-EIAPIS
2iw3A           QEECRTVYVEHDIDGTHSD----TSVLDFVFESGVG-----------TKEAIKDKLIEFGFTD-EIAPIS
1xmiE           ---------GRISFCSQFSWIMPGTIKENIIAGEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
1xmiC           ---------GRISFCSQFSWIMPGTIKENIIAGEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
1xmiA           ---------GRISFCSQFSWIMPGTIKENIIAGEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
2pzgB           ---------GRISFCSQFSWIMPGTIKENIIFGEYRYRSVIKACQLEED--ISKFAEKDNIV------LG
1xmiD           ---------GRISFCSQFSWIMPGTIKENIIAGEYRYRSVIKACQLEEDISKFAEKDNIVLGEIT-----
2pzfB           ---------GRISFCSQFSWIMPGTIIIGVSYDEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
2ixgA           VQYDHHYLHTQVAAVGQEPLLFGRSFRENIA------YGLTRTPTMEEITAVAMESGASGFPQGYDTEVG
1r10A           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0zD           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0zC           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0zB           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0zA           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0xD           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0xC           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0xB           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0xA           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0wC           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0wB           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1r0wA           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1q3hD           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1q3hC           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1q3hB           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1q3hA           ---------GRVSFCSQFSWIMPGTIKENIIFG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
2awnA           AERG----VGMVFQS------YALEVINQRV------------------NQVAEVLA-------------
1xfaA           ---------GRVSFCSQFSWIMPGTIKENIIRG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1xf9D           ---------GRVSFCSQFSWIMPGTIKENIISG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1xf9C           ---------GRVSFCSQFSWIMPGTIKENIISG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1xf9B           ---------GRVSFCSQFSWIMPGTIKENIISG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
1xf9A           ---------GRVSFCSQFSWIMPGTIKENIISG----VSYDEYRYKSVVKACQLQQDITKFAEQDNTVLG
2bbsA           ----HSGRISFCSQNS---WIMPGTIKENIIGVSYDEYRY--------RSVIKACQLEEDISKFAEKDLI
2zu0C           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMEDLLTRSVN
2d3wA           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMEDLLTRSVN
2bbtB           ----HSGRISFCSQNS---WIMPGTIKENIIGVSYDEYRY--------RSVIKACQLEEDISKFAEKDLG
2bbtA           ----HSGRISFCSQNS---WIMPGTIIIGVSYDEYRYRSVIKACQLEEKFAEKDNIVLGGIT--------
2bbsB           ----HSGRISFCSQNS---WIMPGTIIIGVSYDEYRYRSVIKACQLEEKFAEKDNIVLGGIT--------
2ghiB           NKYNRNSIIGIVPQDTIL---FNETIKYNILYGKLDATDVIKATKSAQLYDFIEALPKKWDTIVGNKM--
3b60A           REYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYS---REQIEEAARMAYAMDDNGLDTIIGENGV
1z2rA           REYTLASLRNQVALVSQNVHLFNDTVANNIAYARTEEYS---REQIEEAARMAYAMDDNGLDTIIGENGV
2bboA           ---------GRISFCSQFSWIMPGTIKENIIFGEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
1xmjA           ---------GRISFCSQFSWIMPGTIIIGVSYDEYRYRSVIKACQEEDISKFAEVLGEGGIT--------
2d3wD           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMEDLLTRSVN
2awoD           AE--------------------------------------------------------------------
2awnD           AE--------------------------------------------------------------------
2ghiD           NKYNRNSIIGIVPQ-------------DTILFNETIKYNILYGKLDATDEEVIKATKSAQLYDFIEADTI
2vf8B           ----------------------------------------------ADESAIFRALDTLREVGLGYLRLG
2vf8A           ----------------------------------------------ADESAIFRALDTLREVGLGYLRLG
2vf7C           ----------------------------------------------ADESAIFRALDTLREVGLGYLRLG
2vf7B           ----------------------------------------------ADESAIFRALDTLREVGLGYLRLG
2vf7A           ----------------------------------------------ADESAIFRALDTLREVGLGYLRLG
2d3wB           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMEDLLTRSVN
2r6fB           -----------------------------------------------------ETLYDVGLGYKLGQPAT
2r6fA           -----------------------------------------------------ETLYDVGLGYKLGQPAT
2d3wC           EDRAGEGIFMAFQYPVEIPGVSNQFFLQTALNAVRSYRGQETLDRFDFQDLMEEKIALLKMEDLLTRSVN
2qm8B           SSTRTGG---------------------------------------------------------------
2qm8A           SSTRTGG---------------------------------------------------------------
2qm7B           SSTRR-----------------------------------------------------------------
2qm7A           SSTR------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           ALSGGQRKRAFIARGIAQGATVFLLDEPFAGVDKPSERTIVRVLREMRDEGATLLVSTHDLAGVGELCDE
2nq2D           SLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLQSQNMTVVFTTHQPNQVVAIANK
2nq2C           SLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLQSQNMTVVFTTHQPNQVVAIANK
3gfoA           CLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKEGXXXXXXXXXXXXVPLYCDN
2it1B           QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKEGITTVYVTHDQAEALAMADR
2it1A           QLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKEGITTVYVTHDQAEALAMADR
1g291           ELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDKLRVRMRAELKKLQRQLGVTTIYVTHDQVEAMTMGDR
2onkA           RLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRVQREFDVPILHVTHDLIEAAMLADE
3dhwC           NLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDIRRLGLTILLITHEMDVVKRICD-
2oukB           SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDR
2oljA           SLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANEGMTMVVVTHEMGFAREVGDR
1sgwA           ELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKILEILKEKGIVIISSREELS----YCDV
2yz2B           FLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDR
2yz2A           FLSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVEKWKTLGKTVILISHDIETVINHVDR
1oxvA           ELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHDPADIFAIAD-
1oxsC           ELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHDPADIFAIAD-
1mt0A           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTV------
2ff7A           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTV------
1vplA           TYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQEGLTILVSSHNMLEVEFLCDR
3fh6A           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
2awoA           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
2awnB           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
1q12A           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
2fgkA           GLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTV------
2ffbA           GLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTV------
3b5jA           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAHRLSTV------
2r6gB           ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
2r6gA           ALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
1l2tB           QLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEGKTVVVVTHDI---------
1l2tA           QLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEGKTVVVVTHDI---------
1xefA           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAARLSTV------
2ffaA           GLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKI-CKGRTVIIIAARLSTV------
2yyzA           QLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQEGITSVYVTHDQAEAMTMASR
2d62A           ELSGGQRQRVALGRAIIRRPKVF-LDEPLSNLDAKLRVKRAELKKLQRQLGVTTIYVTHDQV---EATGD
1z47B           ELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEGVTSVFVTHDQEEALEVADR
1z47A           ELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEGVTSVFVTHDQEEALEVADR
1b0uA           VLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEEGKTMVVVTHEMGFARHVSSH
1g6hA           ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDH
2awoC           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
1g9xA           ELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDH
1gajA           ELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLELKAKGITFLIIEHRLDIVLNYIDH
3fvqB           ELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHDREEALQYADR
3fvqA           ELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREMIAALRANGKSAVFVSHDREEALQYADR
1ji0A           TLSGGEQQLA-IGRALSRPK---LLDEPSLGLAPILVSEVFEVIQKINQEGTTILLVEQNALGALKVAHY
2pcjA           ELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDIFLKINEGGTSIVMVTHE----------
3bk7A           DLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNKTALVVEHDVLMIDYVSDR
1pf4A           SLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDELQ-KNKTVLVIAHRLSTI-EQADE
3g60A           QLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAR-EGRTCIVIAHRLSTIQNADLI
3g5uA           QLSGGQKQRIAIARALVRQPHILLLDEATSALDTESEKVVQEALDKAR-EGRTCIVIAHRLSTIQNADLI
1yqtA           ELSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLEKNEKTALVVEHDV---------
2pjzA           KLSAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIKEYGKEG---ILVTHEL---------
1oxxK           ELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRGVTLLVVSHDPADIFAIAD-
1f3oA           QLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKKLNEEDGKTVVVVTHDI---------
1jj7A           QLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESRYSRSVLLITQH--LSLVEQADH
3d31A           TLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNLTVLHITHDQTEARIMADR
2ihyB           YLSTGEKQRV-IARALGQ-PQVLILDEPAAGLD-------------------------------------
2ix3A           ALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSITISHDSVFLDNVCEY
2iwhB           ALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSITISHDSVFLDNVCEY
2hydA           KLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEALDVLSKDRTTLIVA-HRLSTITH-ADK
2ixfC           QLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLS--------
2ixfA           QLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLS--------
2qi9C           QLSGGEWQRVRLAAVVLQAGQLLLLDEP-NSLDVAQQSALDKILSALSQQGLA-IVSSHDLNHTLRHAHR
2ixfD           QLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEASRTVLLITHQLS--------
2awnC           ALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
1l7vC           QLSGGEWQRVRLAAVVLQAGQLLLLDEP-NSLDVAQQSALDKILSALCQQGLA-IVSSHDLNHTLRHAHR
1mv5D           KISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLM-KGRTTLVIAHRLSTI------
1mv5A           KISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKALDSLM-KGRTTLVIAHRLSTI------
1v43A           QLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKKVTTIYVTHDQVEAMTMGDR
2d2fA           GFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPD
2ixeA           QLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLS--------
2ihyA           YLSTGEKQRV-IARALGQ-PQVLILDEPAAGLD-------------------------------------
2ghiA           KLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLR-KNRTLIIIAHRLSTISS-AES
2pzfA           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2ghiC           GMKLGERQRIAIARCLLKDPKIVIFDEATSSLDSKTEYLFQKAVEDLR-KNRTLIIIAHRLSTISS-AES
2ixeD           QLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLS--------
2cbzA           -LSGGQKQRVSLARAVYSNADIYLFDDPLSAVD-------------------------------------
2pzgA           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2pzeB           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2pzeA           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
1xmiB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2d2eA           RLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDIDALKVVARGVNAMRGPNFGALVITHYQRILNYIQPD
2ix8A           ALSGGWKKLA-LARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSITISHDSVFLDNVCEY
2iw3B           ALSGGWKKLA-LARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSITISHDSVFLDNVCEY
2iw3A           ALSGGWKKLA-LARAVLRNADILLLDEPTNHLDTVNVAWLVNYLNTC---GITSITISHDSVFLDNVCEY
1xmiE           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
1xmiC           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
1xmiA           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2pzgB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
1xmiD           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2pzfB           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2ixgA           QLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEASRTVLLITQQLS--------
1r10A           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0zD           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0zC           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0zB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0zA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0xD           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0xC           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0xB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0xA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0wC           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0wB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1r0wA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1q3hD           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1q3hC           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1q3hB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1q3hA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
2awnA           -----------IGRTLVAEPSVFLLDEPLSNLDAALRQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADK
1xfaA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1xf9D           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1xf9C           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1xf9B           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
1xf9A           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFEVCKLMANKTRILVTSKMEHL---RKADK
2bbsA           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2zu0C           GFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTH-----------
2d3wA           GFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDGKRSFIIVTH-----------
2bbtB           TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2bbtA           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2bbsB           -LSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2ghiB           KLSGGERQRIAIARCLLKDPKIVIFDE--ATSDSKTEYLFQKAVEDLR-KNRTLIIIAH-----------
3b60A           LLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQ-KNRTSLVIAHRLSTI------
1z2rA           LLSXXXXXXXXXXXXXXXDSPILILDEATSALDTESERAIQAALDELQ-KNRTSLVIAHRLSTI------
2bboA           -LSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
1xmjA           -LSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFEVCKLMANKTRILVTSKMEHL---KKADK
2d3wD           GFSGGEKKRNDILQMAVLEPELCILDES-DGLDIDALKVVADGVNSLRDGKRSFIIVTH-----------
2awoD           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
2ghiD           VLSGGERQRIAIARCLLKDPKIVIFD------DSKTEYLFQKAVEDNR----TLIIIAHRLSTISS-AES
2vf8B           QLSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKM---------
2vf8A           QLSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKM---------
2vf7C           QLSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKM---------
2vf7B           QLSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKM---------
2vf7A           QLSGGEAQRIKLARRSGRGGTVYVLDEPTTGLHPADVERLQRQLVKLVDAGNTVIAVEHKM---------
2d3wB           GFSGGEKKRNDILQMAVLEPELCILDES-DSLDIDALKVVADGVNSLRDGKRSFIIVTH-----------
2r6fB           TLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNL---------
2r6fA           TLSGGEAQRVKLAAELSNGRTLYILDEPTTGLHVDDIARLLDVLHRLVDNGDTVLVIEHNL---------
2d3wC           GFSGGEKKRNDILQMAVLEPELCILDE---SDDIDALKVVADGVNSLRDGKRSFIIVTH-----------
2qm8B           ----------------------------------------------------------------------
2qm8A           ----------------------------------------------------------------------
2qm7B           ----------------------------------------------------------------------
2qm7A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AILLHRRVLAHGSPDRVLVPELMLRAFGLEEPx
2nq2D           TLLLNKQNFKFGETRNILTSENLTALFHL----
2nq2C           TLLLNKQNFKFGETRNILTSENLTALFHL----
3gfoA           VFVMKERVILQGNPKEVFAEKEVIRKVNLRLP-
2it1B           AVIREGEILQVGTPDEV----------------
2it1A           AVIREGEILQVGTPDEV----------------
1g291           IAVMNRGVLQQGSPDEV----------------
2onkA           AVMLNGRIVEKG---------------------
3dhwC           ---------------------------------
2oukB           VLFMDGYIIEEGKPE------------------
2oljA           VLFMDGYIIEEGKPE------------------
1sgwA           NENLHK---------------------------
2yz2B           VVVLEK---------------------------
2yz2A           VVVLEK---------------------------
1oxvA           ---------------------------------
1oxsC           ---------------------------------
1mt0A           ---------------------------------
2ff7A           ---------------------------------
1vplA           IALIH----------------------------
3fh6A           IVVLDARVAQVGKP-------------------
2awoA           IVVLDARVAQVGKP-------------------
2awnB           IVVLDARVAQVGKP-------------------
1q12A           IVVLDARVAQVGKP-------------------
2fgkA           ---------------------------------
2ffbA           ---------------------------------
3b5jA           ---------------------------------
2r6gB           IVVLDARVAQVGKP-------------------
2r6gA           IVVLDARVAQVGKP-------------------
1l2tB           ---------------------------------
1l2tA           ---------------------------------
1xefA           ---------------------------------
2ffaA           ---------------------------------
2yyzA           AVFNQGKLVQYGTPDEV----------------
2d62A           RIAVNKGELQQGTPDEV----------------
1z47B           VLVLHENVEQFGTPEEV----------------
1z47A           VLVLHENVEQFGTPEEV----------------
1b0uA           VIFLHQKIEEEGDPEQV----------------
1g6hA           LVMFNGQIIAEG---------------------
2awoC           IVVLDARVAQVGKP-------------------
1g9xA           LVMFNGQIIAEG---------------------
1gajA           LVMFNGQIIAEG---------------------
3fvqB           AVMKQGRILQTASP-------------------
3fvqA           AVMKQGRILQTASP-------------------
1ji0A           GYVLETQIVLEGKASELLDNEVRKAYLGV----
2pcjA           ---------------------------------
3bk7A           LIVFEGEPGRHG---------------------
1pf4A           ILVV-----------------------------
3g60A           VVIQNGKVKEHGTHQQLL---------------
3g5uA           VVIQNGKVKEHGTHQQLL---------------
1yqtA           ---------------------------------
2pjzA           ---------------------------------
1oxxK           ---------------------------------
1f3oA           ---------------------------------
1jj7A           ILFLEGGAIREGGTHQQLM--------------
3d31A           AVVMDGKLIQVGKPEEI----------------
2ihyB           ---------------------------------
2ix3A           II-------------------------------
2iwhB           II-------------------------------
2hydA           IVVIENGHIVETGTHRELI--------------
2ixfC           ---------------------------------
2ixfA           ---------------------------------
2qi9C           AWLLKGGKLASGRREEVLTPPNLAQAYG-----
2ixfD           ---------------------------------
2awnC           IVVLDARVAQVGKP-------------------
1l7vC           AWLLKGGKLASGRREEVLTPPNLAQAYG-----
1mv5D           ---------------------------------
1mv5A           ---------------------------------
1v43A           IAVMNRQLLQIGSPTEV----------------
2d2fA           KVMMDGRVVATGGPELAL---------------
2ixeA           ---------------------------------
2ihyA           ---------------------------------
2ghiA           IILLNK---------------------------
2pzfA           ILILH----------------------------
2ghiC           IILLNK---------------------------
2ixeD           ---------------------------------
2cbzA           ---------------------------------
2pzgA           ILILH----------------------------
2pzeB           ILILH----------------------------
2pzeA           ILILH----------------------------
1xmiB           ILILH----------------------------
2d2eA           KVMMDGRVVATGGPELAL---------------
2ix8A           II-------------------------------
2iw3B           II-------------------------------
2iw3A           II-------------------------------
1xmiE           ILILH----------------------------
1xmiC           ILILH----------------------------
1xmiA           ILILH----------------------------
2pzgB           ILILH----------------------------
1xmiD           ILILH----------------------------
2pzfB           ILILH----------------------------
2ixgA           ---------------------------------
1r10A           ILILHQ---------------------------
1r0zD           ILILHQ---------------------------
1r0zC           ILILHQ---------------------------
1r0zB           ILILHQ---------------------------
1r0zA           ILILHQ---------------------------
1r0xD           ILILHQ---------------------------
1r0xC           ILILHQ---------------------------
1r0xB           ILILHQ---------------------------
1r0xA           ILILHQ---------------------------
1r0wC           ILILHQ---------------------------
1r0wB           ILILHQ---------------------------
1r0wA           ILILHQ---------------------------
1q3hD           ILILHQ---------------------------
1q3hC           ILILHQ---------------------------
1q3hB           ILILHQ---------------------------
1q3hA           ILILHQ---------------------------
2awnA           IVVLDARVAQVGKP-------------------
1xfaA           ILILHQ---------------------------
1xf9D           ILILHQ---------------------------
1xf9C           ILILHQ---------------------------
1xf9B           ILILHQ---------------------------
1xf9A           ILILHQ---------------------------
2bbsA           ILILH----------------------------
2zu0C           ----YQRILDYIKPDYVHV--------------
2d3wA           ----YQRILDYIKPDYVHV--------------
2bbtB           ILILH----------------------------
2bbtA           ILILH----------------------------
2bbsB           ILILH----------------------------
2ghiB           ---------------------------------
3b60A           ---------------------------------
1z2rA           ---------------------------------
2bboA           ILILH----------------------------
1xmjA           ILILH----------------------------
2d3wD           ----YQRILDYIKPDYVHV--------------
2awoD           ---------------------------------
2awnD           ---------------------------------
2ghiD           IILLNK---------------------------
2vf8B           ---------------------------------
2vf8A           ---------------------------------
2vf7C           ---------------------------------
2vf7B           ---------------------------------
2vf7A           ---------------------------------
2d3wB           ---------------------------------
2r6fB           ---------------------------------
2r6fA           ---------------------------------
2d3wC           ----YQRILDYIKPDYVHV--------------
2qm8B           ---------------------------------
2qm8A           ---------------------------------
2qm7B           ---------------------------------
2qm7A           ---------------------------------