[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55880.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2ghiC.bssp"
#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2ghiD.bssp"
#ERROR : Can't open dsspfile "2ghiB.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2bboA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1xmjA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "2r6fB.bssp"
#ERROR : Can't open dsspfile "2r6fA.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"

## Summary of PDB Search
:252
    5e-50  45%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-50  45%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    7e-44  46%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    9e-44  47%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-40  39%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    1e-36  42%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    1e-36  42%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    2e-34  40%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-34  40%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-33  38%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    6e-32  39%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-32  39%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-32  39%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-32  39%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    1e-31  38%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    1e-31  38%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-31  40%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-30  38%  2oukB  [x.x.x] PROTEIN ARTP
    2e-30  38%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    2e-27  38%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    2e-27  34%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    8e-27  38%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-26  34%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    6e-26  41%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-25  34%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    9e-25  34%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    1e-24  39%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    4e-24  37%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    9e-23  32%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    9e-23  32%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    5e-21  32%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    2e-20  34%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-20  34%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    2e-20  34%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    2e-20  34%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    4e-20  37%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    5e-20  33%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-20  33%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-20  33%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-19  33%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-19  33%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-19  33%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    3e-19  33%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    3e-19  33%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-18  32%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    2e-18  31%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-18  32%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-18  30%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    6e-18  33%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-18  33%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-18  39%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-17  32%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    2e-17  32%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    4e-17  31%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    9e-17  30%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    2e-16  30%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    4e-16  29%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    6e-16  32%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    2e-15  32%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    7e-14  30%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-13  32%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-13  31%  2ghiC  [x.x.x] TRANSPORT PROTEIN
    2e-13  34%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-13  30%  2ghiD  [x.x.x] TRANSPORT PROTEIN
    3e-13  33%  2ghiB  [x.x.x] TRANSPORT PROTEIN
    5e-13  29%  1ji0A  [c.37.1] ABC TRANSPORTER
    6e-13  29%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-12  31%  1yqtA  [x.x.x] RNASE L INHIBITOR
    1e-12  29%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-12  29%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-12  29%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-12  29%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-12  29%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    5e-12  27%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    2e-11  24%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-11  30%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-11  29%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-11  29%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-10  29%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-10  28%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  28%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  29%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-10  28%  2bboA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-10  30%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    1e-09  29%  1xmjA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    1e-09  30%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    2e-09  32%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    2e-09  32%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    7e-09  30%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-09  34%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-08  32%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    1e-08  32%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    1e-08  32%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-08  29%  2d2eA  [x.x.x] SUFC PROTEIN
    2e-08  30%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  30%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  30%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  30%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    2e-08  28%  2d2fA  [x.x.x] SUFC PROTEIN
    3e-08  42%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-08  41%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-08  29%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  29%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-08  32%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    3e-07  23%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    1e-06  31%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    2e-06  35%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    1e-05  32%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    1e-05  32%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    1e-05  32%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    2e-05  44%  2r6fB  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    2e-05  44%  2r6fA  [x.x.x] EXCINUCLEASE ABC SUBUNIT A
    7e-04  28%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    0.001  29%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
:252

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xPTPPAPSGTAEPHAVVVQGLTKVYPTGGEPVRALDGVDVSFARGAFTAIMGPSGSGKSTLMHCMAGLDT
1l2tB           ---------------IKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDK
1l2tA           ---------------IKLKNVTKTYKMGEEIIYALKNVNLNIKEGEFVSIMGPSGSGKSTMLNIIGCLDK
2pcjA           ----------------------------------LKGISLSVKKGEFVSIIGASGSGKSTLLYILGLLDA
1f3oA           ---------------IKLKNVTKTYK-GEEIIYALKNVNLNIKEGEFVSI-GPSGSGKSTL-NIIGCLDK
3dhwC           ---------------IKLSNITKVFHQGTRTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLER
2it1B           ---------------------------------ALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYK
2it1A           ---------------------------------ALNNINLKIKDGEFMALLGPSGSGKSTLLYTIAGIYK
1oxvA           ---------------IIVKNVSKVFKKG--KVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDV
1oxsC           ---------------IIVKNVSKVFKKG--KVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDV
1g291           --------------------LVDVWKVFGE-VTAVREMSLEVKDGEFMILLGPSGCGKTTTLRMIAGLEE
3fh6A           --------------SVQLQNVTKAW---GEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
2awoA           --------------SVQLQNVTKAW---GEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
2awnB           --------------SVQLQNVTKAW---GEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
1q12A           ---------------VQLQNVTKAW---GEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
2r6gB           --------------SVQLQNVTKAW---GEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
2r6gA           --------------SVQLQNVTKAW---GEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
2yyzA           -------------------------------VKAVDGVSFEVKDGEFVALLGPSGCGKTTTLLMLAGIYK
2oukB           -------------------------------LEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLED
2oljA           -------------------------------LEVLKGINVHIREGEVVVVIGPSGSGKSTFLRCLNLLED
2onkA           -------------------------------------LNVDFEMGRYCVLLGPTGAGKSVFLELIAGIVK
3d31A           ---------------------------------SLDNLSLKVESGEYFVILGPTGAGKTLFLELIAGFHV
2awoC           -------------------------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
1oxxK           ---------------IIVKNVSKVFKKG--KVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDV
2awnC           -------------------------------------INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLG-
1z47B           -------------------GVEKIYPGGARSVR---GVSFQIREGEMVGLLGPSGSGKTTILRLIAGLER
1z47A           -------------------GVEKIYPGGARSVR---GVSFQIREGEMVGLLGPSGSGKTTILRLIAGLER
2d62A           -------------------------------VTAVKDLSLEIKDGEFLVLLGPSGCGKTTTLR-IAGLEE
1b0uA           ---------------------------GGHEV--LKGVSLQARAGDVXXXXXXXXXXKSTFLRCINFLEK
3fvqB           ----------------------------------LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQ
3fvqA           ----------------------------------LNDISLSLDPGEILFIIGASGCGKTTLLRCLAGFEQ
1v43A           ---------------------------------AVNKLNLTIKDGEFLVLLGPSGCGKTTTLRMIAGLEE
3g60A           ---------------VQFSGVVFNYPTRPS-IPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYD
3g5uA           ---------------VQFSGVVFNYPTRPS-IPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYD
1mt0A           ----------------------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYI
2ff7A           ----------------------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYI
3gfoA           -----------EDYILKVEELNYNYSDG---THALKGINMNIKRGEVTAILGGNGVGKSTLFQNFNGILK
2fgkA           ----------------------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYI
2ffbA           ----------------------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYI
3b5jA           ----------------------------------LDNINLSIKQGEVIGIVGRAGSGKSTLTKLIQRFYI
2ixfD           ---------------VKFQDVSFAYPNHPN-VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQ
2ixfC           ---------------VKFQDVSFAYPNHPN-VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQ
2ixfA           ---------------VKFQDVSFAYPNHPN-VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQ
1xefA           ----------------------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYI
2ffaA           ----------------------------------LDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYI
2hydA           ----------------------------------LKDINLSIEKGETVAFVGMSGGGKSTLINLIPRFYD
2ixeD           ---------------VKFQDVSFAYPNHPN-VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQ
2ixeA           ---------------VKFQDVSFAYPNHPN-VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQ
1jj7A           ---------------VQFQDVSFAYPNRPD-VLVLQGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQ
2yz2B           --------------------------------KALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIE
2yz2A           --------------------------------KALENVSLVINEGECLLVAGNTGSGKSTLLQIVAGLIE
2awnA           --------------SVQLQNVTKAW---GEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
1mv5D           --------------------------------------DISFEANSIIAFAGPSGGGKSTIFSLLERFYQ
1mv5A           --------------------------------------DISFEANSIIAFAGPSGGGKSTIFSLLERFYQ
2ixgA           ---------------VKFQDVSFAYPNHPN-VQVLQGLTFTLYPGKVTALVGPNGSGKSTVAALLQNLYQ
1g9xA           --------------------------------KALDGVSISVCKGDVTLIIGPNGSGKSTLINVITGFLK
1g6hA           --------------------------------KALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLK
1gajA           --------------------------------KALDGVSISVNKGDVTLIIGPNGSGKSTLINVITGFLK
1pf4A           ---------------VDVKDVTFTYQGKEKP--ALSHVSFSIPQGKTVALVGRSGSGKSTIANLFTRFYD
2ghiA           --------------------------------RTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-Y
3bk7A           -------------------------------------------KGEVIGIVGPNGIGKTTFVKMLAGVEE
2nq2D           --------------------------------QAFQQLNFDLNKGDILAVLGQNGCGKSTLLDLLLGIHR
2ghiC           --------------------------------RTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-Y
2nq2C           -------------------------------------------KGDILAVLGQNGCGKSTLLDLLLGIHR
2ghiD           --------------------------------RTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-Y
2ghiB           --------------------------------RTLKSINFFIPSGTTCALVGHTGSGKSTIAKLLYRF-Y
1ji0A           -------------------------------IHAIKGIDLKVPRGQIVTLIGANGAGKTTTLSAIAGLVR
2pzgB           ---------------VVMENVTAFWEEGGTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
1yqtA           -------------------------------------------KGEVIGIVGPNGIGKTTFVK-LAGVEE
2pzfB           ---------------VVMENVTAFWEEGGTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2pzgA           ---------------VVMENVTAFWEEGGTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2pzeB           ---------------VVMENVTAFWEEGGTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2pzeA           ---------------VVMENVTAFWEEGGTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
1xmiB           ----------------------------GTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2cbzA           -------------NSITVRNATFTWARSDPPT--LNGITFSIPEGALVAVVGQVGCGKSSLLSALLAEMD
1vplA           ----------------------------------------------------PNGAGKTTTLRIISTLIK
2pzfA           ---------------VVMENVTAFW--GGTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2bbsA           ---------------VVMENVTAFWEEGGTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2bbtA           ---------------VVMENVTAFWEEGGTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
1xmiD           ----------------------------GTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2bbtB           ----------------------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2bbsB           ----------------------------------LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
1xmiE           ----------------------------GTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
1xmiC           ----------------------------GTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
1xmiA           ----------------------------GTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2bboA           ---------------VVMENVTAFWEEGGTPV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2pjzA           --------------------------------------------GEKVIILGPNGSGKTTLLRAISGL-L
1xmjA           ---------------VVMENVTAFWET---PV--LKDINFKIERGQLLAVAGSTGAGKTSLLMMIMGELE
2ihyA           ----------------------------------LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEP
2zu0C           ----------------------------------LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREE
2d3wA           ----------------------------------LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREE
2ihyB           ----------------------------------LKKISWQIAKGDKWILYGLNGAGKTTLLNILNAYEP
2d3wD           ----------------------------------LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREE
2ix3A           ----------------------------------LNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQV
2iwhB           ----------------------------------LNKTQLRLKRARRYGICGPNGCGKSTLMRAIANGQV
2d3wC           ----------------------------------LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREE
2d2eA           ----------------------------------LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPT
1xf9D           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1xf9C           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1xf9B           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1xf9A           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
2d2fA           ----------------------------------LKGVNLVVPKGEVHALMGPNGAGKSTLGKILAGDPT
2awoD           --------------SVQLQNVTKAW---GEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
2awnD           --------------SVQLQNVTKAW---GEVVVSKD-INLDIHEGEFVVFVGPSGCGKSTLLRMIAGLET
1xfaA           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r10A           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0zD           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0zC           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0zB           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0zA           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0xD           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0xC           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0xB           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0xA           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0wC           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0wB           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1r0wA           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1q3hD           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1q3hC           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1q3hB           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
1q3hA           ----------------------------GNPV--LKNINLNIEKGEMLAITGSTGSGKTSLLMLILGELE
2d3wB           ----------------------------------LRGLSLDVHPGEVHAIMGPNGSGKSTLSATLAGREE
1sgwA           ----------------------------------LERITMTIEKGNVVNFHGPNGIGKTTLLKTISTYLK
2qi9C           ---------------------TRLGPLSGE-VRA----------GEILHLVGPNGAGKSTL---LARAGT
1l7vC           ---------------------TRLGPLSGE-VRA----------GEILHLVGPNGAGKSTL---LARAGT
2ix8A           -PEPGYLEGVKTKQKAIVK-VTNEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELL
2iw3B           -PEPGYLEGVKTKQKAIVK-VTNEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELL
2iw3A           -PEPGYLEGVKTKQKAIVK-VTNEFQYPGTSKPQITDINFQCSLSSRIAVIGPNGAGKSTLINVLTGELL
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1z2rA           --------------AAEFRNVTFTYP--GREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYD
3b60A           ------------------RNVTFTYP--GREVPALRNINLKIPAGKTVALVGRSGSGKSTIASLITRFYD


                         .         .         *         .         .         .         .:140
query           PTSGSVRLGATELTALSDKQLTLLRRDRIGFVFQSFNLLPMLTARQNILLPSQISKRKVDPERFRHIVEV
1l2tB           PTEGEVYIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAGEERRKRALEC
1l2tA           PTEGEVYIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGAGEERRKRALEC
2pcjA           PTEGKVFLEGKEVDYTNEKELSLLRNRKLGFVFQFHYLIPELTALENVIVPKMGKPKKEAKERGEYLLSE
1f3oA           PTEGEVYIDNIKTNDLDDDELTKIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRGASEERRKRALEC
3dhwC           PTEGSVLVDGQELTTLSESELTKARR-QIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDERRVTELLSL
2it1B           PTSGKIYFDEKDVTELPPKDRN------VGLVFQNWALYPHMTVYKNIAFPLELRKREEIDKKVREVAKM
2it1A           PTSGKIYFDEKDVTELPPKDRN------VGLVFQNWALYPHMTVYKNIAFPLELRKREEIDKKVREVAKM
1oxvA           PSTGELYFD-DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPMKMSKEEIR-KRVEEVAKI
1oxsC           PSTGELYFD-DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPMKMSKEEIR-KRVEEVAKI
1g291           PSRGQIYIG-DKLVADPEKGIFVPPKDRIAMVFQSYALYPHMTVYDNIAFPLKLRKRQEIDQRVREVAEL
3fh6A           ITSGDLFIGEKRMNDTPPAERG------VGMVFQSYALYPHLSVAENMSFGLKLAKKEVINQRVNQVAEV
2awoA           ITSGDLFIGEKRMNDTPPAERG------VGMVFQSYALYPHLSVAENMSFGLKLAKKEVINQRVNQVAEV
2awnB           ITSGDLFIGEKRMNDTPPAERG------VGMVFQSYALYPHLSVAENMSFGLKLAKKEVINQRVNQVAEV
1q12A           ITSGDLFIGEKRMNDTPPAERG------VGMVFQSYALYPHLSVAENMSFGLKLAKKEVINQRVNQVAEV
2r6gB           ITSGDLFIGEKRMNDTPPAERG------VGMVFQSYALYPHLSVAENMSFGLKLAKKEVINQRVNQVAEV
2r6gA           ITSGDLFIGEKRMNDTPPAERG------VGMVFQSYALYPHLSVAENMSFGLKLAKKEVINQRVNQVAEV
2yyzA           PTSGEIYFDDVLVNDIPPKYR------EVGMVFQNYALYPHMTVFENIAFPRRISKDEVE-KRVVEIARK
2oukB           FXXXXXXXXXXNLKA-KDTNLNKVREE-VGMVFQRFNLFPHMTVLNNITLPMKVRKREKAEAKAMELLDK
2oljA           FXXXXXXXXXXNLKA-KDTNLNKVREE-VGMVFQRFNLFPHMTVLNNITLPMKVRKREKAEAKAMELLDK
2onkA           PDRGEVRLNGADITPLPPE------RRGIGFVPQDYALFPHLSVYRNIAYGLXXXXXXXXXXXXXXMAEK
3d31A           PDSGRILLDGKDVTDLSPE------KHDIAFVYQNYSLFPHMNVKKNLEFGMRMKKIK-DPKRVLDTARD
2awoC           ITSGDLFIGEKRMNDTPPAERG------VGMVA----LYPHLSVAENMSFGLKLAKKEVINQRVNQVAEV
1oxxK           PSTGELYFD-DRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPMKMSKEEI-RKRVEEVAKI
2awnC           ----------------------------VGMVFQSYALYPHLSVAENMSFGLKLAKKEVINQRVNQVAEV
1z47B           PTKGDVWIGGKRVTDLPP------QKRNVGLVFQNYALFQHMTVYDNVLREKRVPKDEMD-ARVRELLRF
1z47A           PTKGDVWIGGKRVTDLPP------QKRNVGLVFQNYALFQHMTVYDNVLREKRVPKDEMD-ARVRELLRF
2d62A           PTRGQIYI-EDNLVADPEKGVFVPPKERDVAVFQSYALYPH-TVYDNIAFPRKVPKQEID-KRVREVAEL
1b0uA           PSEGAIIVNGQNINLVRDKQLRLLRT-RLTMVFQHFNLWSHMTVLENVMAPIQVSKHDARERALKYLAKV
3fvqB           PDSGEISLSGK--TIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRAMLEL
3fvqA           PDSGEISLSGK--TIFSKNTNLPVRERRLGYLVQEGVLFPHLTVYRNIAYGLGNGKGRTAQERQRAMLEL
1v43A           PTEGRIYFGDRDVTYLPPKDRN------ISMVFQH------MTVYENIAFPKKFPKDEID-KRVRWAAEL
3g60A           PMAGSVFLDGKEIKQLNVQWL----RAQLGIVSQEPILFDCSIA-ENIAYGD--NSRVVSYEEIVRAAKE
3g5uA           PMAGSVFLDGKEIKQLNVQWL----RAQLGIVSQEPILFDCSIA-ENIAYGD--NSRVVSYEEIVRAAKE
1mt0A           PENGQVLIDGHDL-ALADPNW--LRR-QVGVVLQDNVLL-----NRSIIDNISLANPGMSVEKVIYAAKL
2ff7A           PENGQVLIDGHDL-ALADPNW--LRR-QVGVVLQDNVLL-----NRSIIDNISLANPGMSVEKVIYAAKL
3gfoA           PSSGRILFDNKPID-YSRKGIMKLR-ESIGIVFQDDNQLFSASVYQNMKLPEDEIRKRVD-----NALKR
2fgkA           PENGQVLIDGHDL-ALADPNW--LRR-QVGVVLQDNVLL-----NRSIIDNISLANPGMSVEKVIYAAKL
2ffbA           PENGQVLIDGHDL-ALADPNW--LRR-QVGVVLQDNVLL-----NRSIIDNISLANPGMSVEKVIYAAKL
3b5jA           PENGQVLIDGHDL-ALADPNW--LRR-QVGVVLQDNVLL-----NRSIIDNISLANPGMSVEKVIYAAKL
2ixfD           PTGGKVLLDGEPLVQYDHHYL----HTQVAAVGQ---LLFGRSFRENIAYGLT---RTPTMEEITAVAME
2ixfC           PTGGKVLLDGEPLVQYDHHYL----HTQVAAVGQE-PLLFGRSFRENIAYGLT---RTPTMEEITAVAME
2ixfA           PTGGKVLLDGEPLVQYDHHYL----HTQVAAVGQE-PLLFGRSFRENIAYGLT---RTPTMEEITAVAME
1xefA           PENGQVLIDGHDL-ALADPNW--LRR-QVGVVLQDNVLL-----NRSIIDNISLANPGMSVEKVIYAAKL
2ffaA           PENGQVLIDGHDL-ALADPNW--LRR-QVGVVLQDNVLL-----NRSIIDNISLANPGMSVEKVIYAAKL
2hydA           VTSGQILIDGHNIKDF----LTGSLRNQIGLVQQD-NILFSDTVKENILLPTATDEEVVEAAKMANAHDF
2ixeD           PTGGKVLLDGEPLVQYDHHYLHT----------QVAAVGPLLFGRSFRENIAYGLTRTPTMEEITAVAME
2ixeA           PTGGKVLLDGEPLVQYDHHYL----HTQVAAVGQE-PLLFGRSFRENIAYGLT---RTPTMEEITAVAME
1jj7A           PTGGQLLLDGKPLPQYEHRYLHR-QVAAVGQEPQVFNIAYGLTQKPTM---EEITAAAVKSGAHSFISGL
2yz2B           PTSGDVLYDGER-----KKGYEIRRNIGIAFQYPEDQFFA-----ERVFDEVAFAVKNFYPDRVKKAMEF
2yz2A           PTSGDVLYDGER-----KKGYEIRRNIGIAFQYPEDQFFA-----ERVFDEVAFAVKNFYPDRVKKAMEF
2awnA           ITSGDLFIGEKRMND------TPPAERGVGMVFQSYAL-------------------EVINQRVNQVAEV
1mv5D           PTAGEITIDGQPIDNISLENW----RSQIGFVSQDSAIMAG-TIRENLTYGLE---GDYTDEDLWQVLDL
1mv5A           PTAGEITIDGQPIDNISLENW----RSQIGFVSQDSAIMAG-TIRENLTYGLE---GDYTDEDLWQVLDL
2ixgA           PTGGKVLLDGEPLVQYDHHYL----HTQVAAVGQE-PLLFGRSFRENIAYGLT---RTPTMEEITAVAME
1g9xA           ADEGRVYFENKDIT---NKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIPGEIPKEEEMVEKAFKILEF
1g6hA           ADEGRVYFENKDIT---NKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIPGEIPKEEEMVEKAFKILEF
1gajA           ADEGRVYFENKDIT---NKEPAELYHYGIVRTFQTPQPLKEMTVLENLLIPGEIPKEEEMVEKAFKILEF
1pf4A           VDSGSICLDGHDVR---DYKLTNLRR-HFALVSQNVHLFND-TIANNIAYAAEGEYTREQIERQAHAMEF
2ghiA           DAEGDIKIGGKNVNKYNRNSI----RSIIGIVPQD-TILFNETIKYNILY----GKLDATDEEVIKATKS
3bk7A           PTEGKVEW---DLTVAYKPQY--IKAEYEGTVYE---------------LLSKIDSSKLNSNFYKELLKP
2nq2D           PIQGKIEVYQS-----------------IGFVPQFFSS-PFAYSVLDIVLMGRSTHINTFAKPKSHDYQV
2ghiC           DAEGDIKIGGKNVNKYNRNSI----RSIIGIVPQD-TILFNETIKYNILYG------KLDAEEVIKATKS
2nq2C           PIQGKIEVYQS-----------------IGFVPQFFSS-PFAYSVLDIVLMGRSTHINTFAKPKSHDYQV
2ghiD           DAEGDIKIGGKNVNKYNRNSI----RSIIGIVPQD-TILFNETIKYNILY----GKLDATDEEVIKATKS
2ghiB           DAEGDIKIGGKNVNKYNRNSI----RSIIGIVPQD-TILFNETIKYNILY----GKLDATDEEVIKATKS
1ji0A           AQKGKIIFNGQDIT---NKPAHVINRG-IALVPEGRRIFPELTVYENLGAYNRKDKEGIKRDLEWIFSLF
2pzgB           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYRSVIKA
1yqtA           PTEGKIEW---DLTVAYKPQY--IKADYEGTVYE---------------LLSKIDASKLNSNFYKELLKP
2pzfB           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENIIGVSY------DEYRYRSVIKA
2pzgA           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYRSVIKA
2pzeB           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYRSVIKA
2pzeA           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYRSVIKA
1xmiB           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENI-----IAGVSYDEYRYRSVIKA
2cbzA           KVEGHVAIKGSVAYV---PQQAWIQNDSL---------------RENILFGCQLEE-----PYYRSVIQA
1vplA           PSSGIVTVGKNVVEEPHEVRKLISYLPEEAGAYRNMQGIEYL----RFVAGFYASSSSEIEEMVERATEI
2pzfA           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENIIGVSY------DEYRYRSVIKA
2bbsA           PSEGKIK-----------------HSGRISFCSQNSWIMPG-TIKENIIGVSY------DEYRYRSVIKA
2bbtA           PSEGKIK-----------------HSGRISFCSQNSWIMPG-TIKENIIGVSY------DEYRYRSVIKA
1xmiD           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENI-----IAGVSYDEYRYRSVIKA
2bbtB           PSEGKIK-----------------HSGRISFCSQNSWIMPG-TIKENIIGVSY------DEYRYRSVIKA
2bbsB           PSEGKIK-----------------HSGRISFCSQNSWIMPG-TIKENIIGVSY------DEYRYRSVIKA
1xmiE           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENI-----IAGVSYDEYRYRSVIKA
1xmiC           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENI-----IAGVSYDEYRYRSVIKA
1xmiA           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENI-----IAGVSYDEYRYRSVIKA
2bboA           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYRSVIKA
2pjzA           PYSGNIFINGMEVRKIRN------------YIRYSTNLPEAVTVNDIVYLYEEL--KGLDRDLFLEMLKA
1xmjA           PSEGKIK-----------------HSGRISFCSQFSWIMPG-TIKENIIGVSY------DEYRYRSVIKA
2ihyA           ATSGTVNLGKPGYSAETVRQ-------HIGFV--SHSLLEKFQEGERVI--DVVISGAIDDEEAHQLLKL
2zu0C           VTGGTVEFKGKDLLALSPE-------DRAGGIFMAFQYPVEIPGVSNQFF-LQTALNAVRSYRGQETLDR
2d3wA           VTGGTVEFKGKDLLALSPE-------DRAGGIFMAFQYPVEIPGVSNQFF-LQTALNAVRSYRGQETLDR
2ihyB           ATSGTVNLGKPGKVGYSAETV----RQHIGFV--SHSLLEKFQEGERVIFKSIGVYQDIDDEEAHQLLKL
2d3wD           VTGGTVEFKGKDLLALSPE-------DRAGGIFMAFQYPVEIPGVSNQFF-LQTALNAVRSYRGQETLDR
2ix3A           PTQEECRTVYVE----HDIDGTHSDTSVLDFVFES-----------GVGTKEAIKDKLIE----------
2iwhB           PTQEECRTVYVE----HDIDGTHSDTSVLDFVFES-----------GVGTKEAIKDKLIE----------
2d3wC           VTGGTVEFKGKDLLALSPE-------DRAGGIFMAFQYPVEIPGVSNQFF-LQTALNAVRSYRGQETLDR
2d2eA           VERGEILLDGENILELSPDE-----RARKGFLAFQYPVVPGVTIANRLALQAKLGREVGVAEFWTKVKKA
1xf9D           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENI-----ISGVSYDEYRYKSVVDI
1xf9C           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENI-----ISGVSYDEYRYKSVVDI
1xf9B           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENI-----ISGVSYDEYRYKSVVDI
1xf9A           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENI-----ISGVSYDEYRYKSVVDI
2d2fA           VERGEILLDGENILELSPDERA---RKGLFLAFQYPVEVPGVTIANRLALQAKLGREVGVAEFWTKVKKA
2awoD           ITSGDLFIG-------------------------------------------------------------
2awnD           ITSGDLFIG-------------------------------------------------------------
1xfaA           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENI-----IRGVSYDEYRYKSVVDI
1r10A           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0zD           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0zC           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0zB           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0zA           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0xD           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0xC           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0xB           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0xA           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0wC           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0wB           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1r0wA           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1q3hD           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1q3hC           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1q3hB           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
1q3hA           ASEGIIK-----------------HSGRVSFCSQFSWIMPG-TIKENIIFGVSY-----DEYRYKSVVDI
2d3wB           VTGGTVEFKGKDLLALSPE-------DRAGGIFMAFQYPVEIPGVSNQFF-LQTALNAVRSYRGQETLDR
1sgwA           PLKGEIIYNGVPITKVKGK---------IFFLPEEIIVPRKISVEDYLKAVASLYGVKVNKNEIMDALES
2qi9C           SGKGSIQFAGQPLEAWSATKLALHR----AYLSQQ-QTPPFATPVWHYLTLHQHDKTRT--ELLNDVAGA
1l7vC           SGKGSIQFAGQPLEAWSATKLALHR----AYLSQQ-QTPPFATPVWHYLTLHQHDKTRT--ELLNDVAGA
2ix8A           PTSGEV----------------------------------------------------------------
2iw3B           PTSGEV----------------------------------------------------------------
2iw3A           PTSGEV----------------------------------------------------------------
2r6fB           ----------------------------------------------------------------------
2r6fA           ----------------------------------------------------------------------
1z2rA           IDEGHILMDGHDLREYTLASL----RNQVALVSQNVHL--------------------------------
3b60A           IDEGHILMDGHDLREYTLASL----RNQVALVSQNVHL--------------------------------


                         +         .         .         .         .         *         .:210
query           TGLADRLEHLPAKLSGGQQQRVAVARALVGSPEVLYADEPTGNLDSRSGAEVLSFLRDSVRELGQTIVMV
1l2tB           LKMAELEEHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVV
1l2tA           LKMAELEEHKPNQLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLKKLNEEDGKTVVVV
2pcjA           LGLGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDFLK--INEGGTSIVMV
1f3oA           AELEERFNHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTG-EKIQLLKKLNEEDGKTVVVV
3dhwC           VGLGDKHDSYPSNLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLKDINRRLGLTILLI
2it1B           LHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYV
2it1A           LHIDKLLNRYPWQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDALLRLEVRAELKRLQKELGITTVYV
1oxvA           LDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVV
1oxsC           LDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVV
1g291           LGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDAKLRVRMRAELKKLQRQLGVTTIYV
3fh6A           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
2awoA           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
2awnB           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
1q12A           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
2r6gB           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
2r6gA           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
2yyzA           LLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLDANLRMIMRAEIKHLQQELGITSVYV
2oukB           VGLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMVVV
2oljA           VGLKDKAHAYPDSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMKQLANE-GMTMVVV
2onkA           LGIAHLLDRKPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLKTKGVLMEELRFVQREFDVPILHV
3d31A           LKIEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQENAREMLSVLHKKNKLTVLHI
2awoC           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
1oxxK           LDIHHVLNHFPRELSGXXXXXXXXXXXXXKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVV
2awnC           LQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
1z47B           MRLESYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFV
1z47A           MRLESYANRFPHELSGGXXXXXXXXXXXXXXXXXXXFDEPFAAIDTQIRRELRTFVRQVHDEMGVTSVFV
2d62A           -GLTELLNRKPRELSGGQRQRVALGRAIIRRPKV-FLDEPLSNLDAKLRVK-RAELKKLQRQLGVTTIYV
1b0uA           -GIDERAQKYPVHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQQLAEE-GKTMVVV
3fvqB           TGISELAGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFV
3fvqA           TGISELAGRYPHELSGGXXXXXXXXXXXXPDPELILLDEPFSALDEQLRRQIREDMIAALRANGKSAVFV
1v43A           LQIEELLNRYPAQLSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYV
3g60A           ANIHQFIDSLPDKLSGGQKQRIAIARALVRQPHILLLDEATSALDTES-EKVVQEALDKARE-GRTCIVI
3g5uA           ANIHQFIDSLPDKLSGGQKQRIAIARALVRQPHILLLDEATSALDTES-EKVVQEALDKARE-GRTCIVI
1mt0A           AGAHDFISELRAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIII
2ff7A           AGAHDFISELRAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIII
3gfoA           TGI----EHLKDKLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLLVEMQKELGXXXXXX
2fgkA           AGAHDFISELRAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK--GRTVIII
2ffbA           AGAHDFISELRAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMRNMHKICK--GRTVIII
3b5jA           AGAHDFISELRAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIII
2ixfD           SGAHDFISGFPQQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLI
2ixfC           SGAHDFISGFPQQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLI
2ixfA           SGAHDFISGFPQQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRLLYESPEWASRTVLLI
1xefA           AGAHDFISELRAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIII
2ffaA           AGAHDFISELRAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMRNMHKICK--GRTVIII
2hydA           IGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDLESESIIQEAL--DVLSKDRTTLIV
2ixeD           SGAHDFISGFPVQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLI
2ixeA           SGAHDFISGFPQQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLI
1jj7A           PGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQVEQLLYESPERYSRSVLLI
2yz2B           VGLDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLD-REGKTDLLRIVEKWKTLGKTVILI
2yz2A           VGLDSFKDRVPFFLSGGEKRRVAIASVIVHEPDILILDEPLVGLD-REGKTDLLRIVEKWKTLGKTVILI
2awnA           ---------------------LAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
1mv5D           AFARSFVENMPVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKAL-DSLMK-GRTTLVI
1mv5A           AFARSFVENMPVKISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMVQKAL-DSLMK-GRTTLVI
2ixgA           SGAHDFISGFPQQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRLLYESPEWASRTVLLI
1g9xA           LKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLE-LKAKGITFLII
1g6hA           LKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGVAPGLAHDIFNHVLE-LKAKGITFLII
1gajA           LKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGVAPGLAHDIFNHVLE-LKAKGITFLII
1pf4A           IGLDTVIGENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAIQAALDE--LQKNKTVLVI
2ghiA           AQLYDFIEALPKKLSGGERQRIAIARCLLKDPKIVIFDEATSSLDSKT--EYL--FQKAVEDLNRTLIII
3bk7A           LGIIDLYDRNVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIRHLMEKNEKTALVV
2nq2D           AMQALNLTHLAKRLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFT
2ghiC           AQLYDFIEALPKKMKLGERQRIAIARCLLKDPKIVIFDEATSSLDSKT--EYL--FQKAVEDLNRTLIII
2nq2C           AMQALNLTHLAKRLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSLLIDLAQSQNMTVVFT
2ghiD           AQLYDFIEALPKKLSGGERQRIAIARCLLKDPKIVIFD------DSKT-----EYLFQKAVEDNRTLIII
2ghiB           AQLYDFIEALPKKLSGGERQRIAIARCLLKDPKIVIFDEAT----SDSKTEYL--FQKAVEDLNRTLIII
1ji0A           PRLKERLKQLGGTLSGGEQQ-LAIGRAL-SRPKLL--DEPSLGLAPILVSEVFEVIQ-KINQEGTTILLV
2pzgB           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
1yqtA           LGIIDLYDREVNELSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIR-HLEKNEKTALVV
2pzfB           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2pzgA           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2pzeB           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2pzeA           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
1xmiB           CQLEEDISKIVLTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2cbzA           CALLPDLEILPSNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVDAHVGKHIFENVIGPKGMLNKTRILV
1vplA           AGLGEKIKDRVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILKQASQE-GLTILVS
2pzfA           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2bbsA           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2bbtA           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
1xmiD           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2bbtB           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2bbsB           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
1xmiE           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
1xmiC           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
1xmiA           CQLEEDISKFAEKLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2bboA           CQLEEDISKFAEKLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2pjzA           LKLGEELRRKLYKLSAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRY----IKEYGKEGILV
1xmjA           CQLEEDISKFAEKLSEGQQAKISLARAVYKDADLYLLDSPFGYLDVLTEKEIFESCVCKLM-ANKTRILV
2ihyA           VGSAKAQQYI-GYLSTGEKQRV-IARAL-GQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYV
2zu0C           FDFQDLMEEKIALLSGGEKKRNDILQMAVLEPELCILDESDSGLDI-DALKVVADGVNSLRDGKRSFIIV
2d3wA           FDFQDLMEEKIALLSGGEKKRNDILQMAVLEPELCILDESDSGLDI-DALKVVADGVNSLRDGKRSFIIV
2ihyB           VGSAKAQQYI-GYLSTGEKQRV-IARAL-GQPQVLILDEPAAGLDFIAREXXXXXXXXXXXXYPTLAIYV
2d3wD           FDFQDLMEEKIALLSGGEKKRNDILQMAVLEPELCILDESDGDIDAKVVADGVNSLRDGKR----SFIIV
2ix3A           FGFTDEMIAMPSALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYL----NTCGITSITI
2iwhB           FGFTDEMIAMPSALSGGWKMKLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYL----NTCGITSITI
2d3wC           FDFQDLMEEKIALLSGGEKKRNDILQMAVLEPELCILDES----DDIDALKVVADGVNSLRDGKRSFIIV
2d2eA           LELLDWDEYLSRYLNEGEKKRNEILQLLVLEPTYAVLDETDSGLDI-DALKVVARGVNAMRGPNFGALVI
1xf9D           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1xf9C           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1xf9B           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1xf9A           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
2d2fA           LELLDWDEYLNEGFSGGEKKRNEILQLLVLEPTYAVLDETDSGLDI-DALKVVARGVNAMRGPNFGALVI
2awoD           -------------------------------PSVFLLDEP---LDAALRVQMRIEISRLHKRLGRTMIYV
2awnD           -------------------------------PSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV
1xfaA           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r10A           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0zD           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0zC           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0zB           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0zA           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0xD           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0xC           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0xB           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0xA           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0wC           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0wB           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1r0wA           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1q3hD           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1q3hC           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1q3hB           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
1q3hA           TKFAEQLGEGGVTLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQVFESCVCKLM-ANKTRILV
2d3wB           FDFQDLMEEKIALLSGGEKKRNDILQMAVLEPELCILDE-SDSLDI-DALKVVADGVNSLRDGKRSFIIV
1sgwA           VEVLDLKKKL-GELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLKSILEILKEKGIVII--
2qi9C           LALDDKLGRSTNQLSGGEWQRVRLAAVVLPAGQLLLLDEP-NSLDV-AQQSALDKILSALSQQGLAIVSS
1l7vC           LALDDKLGRSTNQLSGGEWQRVRLAAVVLPAGQLLLLDEP------------------------------
2ix8A           -GFTDEIAPISA-LSGGWK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYL----NTCGITSITI
2iw3B           -GFTDEIAPISA-LSGGWK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYL----NTCGITSITI
2iw3A           -GFTDEIAPISA-LSGGWK-KLALARAVLRNADILLLDEPTNHLDTVNVAWLVNYL----NTCGITSITI
2r6fB           -------------LSGGEAQRIRLATQ-IGSTGVLYVDEPSIGLHQRDNDRLIATLKS--RDLGNTLIVV
2r6fA           -------------LSGGEAQRIRLATQ-IGSTGVLYVDEPSIGLHQRDNDRLIATLKS--RDLGNTLIVV
1z2rA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           THDPIAASYADRVVFLRDGRVVDDVTHPTPQLILDRxxxxxx
1l2tB           THDINVARFGERIIYLKDGEV---------------------
1l2tA           THDINVARFGERIIYLKDGEV---------------------
2pcjA           THERELAELTHRTLEMKDGKVVGEIT----------------
1f3oA           THDINVARFGERIIYLKDGEV---------------------
3dhwC           THEDVVKRICDCVAVISNGELIEQDT----------------
2it1B           THDQAALAMADRIAVIREGEIL--------------------
2it1A           THDQAALAMADRIAVIREGEIL--------------------
1oxvA           SHDP--------------------------------------
1oxsC           SHDP--------------------------------------
1g291           THDQVAMTMGDRIAVMNRG-VLQQVGSP--------------
3fh6A           THDQVAMTLADKIVVLDAGRV---------------------
2awoA           THDQVAMTLADKIVVLDAGRV---------------------
2awnB           THDQVAMTLADKIVVLDAGRV---------------------
1q12A           THDQVAMTLADKIVVLDAGRV---------------------
2r6gB           THDQVAMTLADKIVVLDAGRV---------------------
2r6gA           THDQVAMTLADKIVVLDAGRV---------------------
2yyzA           THDQAAMTMASRIAVFNQGKLVQ---YGTPDEVYD-------
2oukB           THEGFAREVGDRVLFMDGGYIIEE---GKPEDLFDR------
2oljA           THEGFAREVGDRVLFMDGGYIIEE---GKPEDLFDR------
2onkA           THDLIAAMLADEVAVMLNGRIVE-------------------
3d31A           THDQTEARMADRIAVVMDGKLI--------------------
2awoC           THDQVAMTLADKIVVLDAGRV---------------------
1oxxK           SHDP--------------------------------------
2awnC           THDQVAMTLADKIVVLDAGRV---------------------
1z47B           THDEEALEVADRVLVLHEGNV---------------------
1z47A           THDEEALEVADRVLVLHEGNV---------------------
2d62A           THDQVEAT-GDRI-----------------------------
1b0uA           THEGFARHVSSHVIFLHQGKIEEE------------------
3fvqB           SHDEEALQYADRIAVMKQGRIL--------------------
3fvqA           SHDEEALQYADRIAVMKQGRIL--------------------
1v43A           THDQVAMTMGDRIAVMNRGQLL--------------------
3g60A           AHRLSTIQNADLIVVIQNGKVKEHGTH---------------
3g5uA           AHRLSTIQNADLIVVIQNGKVKEHGTH---------------
1mt0A           AHRLSTVKNADRIIVMEKGKIVEQGKH---------------
2ff7A           AHRLSTVKNADRIIVMEKGKIVEQGKH---------------
3gfoA           XXXXXXVPYCDNVFVMKEGRVI--------------------
2fgkA           AHRLSTVKNADRIIVMEKGKIVEQGKH---------------
2ffbA           AHRLSTVKNADRIIVMEKGKIVEQGKH---------------
3b5jA           AHRLSTVKNADRIIVMEKGKIVEQGKH---------------
2ixfD           THQLSLAERAHHILFLKEGSVCEQGTH---------------
2ixfC           THQLSLAERAHHILFLKEGSVCEQGTH---------------
2ixfA           THQLSLAERAHHILFLKEGSVCEQGTH---------------
1xefA           AARLSTVKNADRIIVMEKGKIVEQGKH---------------
2ffaA           AARLSTVKNADRIIVMEKGKIVEQGKH---------------
2hydA           AHRLSTITHADKIVVIENGHIVETGTH---------------
2ixeD           TQQLSLAERAHHILFLKEGSVCEQGTH---------------
2ixeA           TQQLSLAERAHHILFLKEGSVCEQGTH---------------
1jj7A           TQHLSLVEQADHILFLEGGAIREGGTH---------------
2yz2B           SHDETVINHVDRVVVLEKGKKVFDGT----------------
2yz2A           SHDETVINHVDRVVVLEKGKKVFDGT----------------
2awnA           THDQVAMTLADKIVVLDAGRV---------------------
1mv5D           AHRLSTIVDADKIYFIEKGQITGSGKH---------------
1mv5A           AHRLSTIVDADKIYFIEKGQITGSGKH---------------
2ixgA           TQQLSLAERAHHILFLKEGSVCEQGTH---------------
1g9xA           EHRDIVLNYIDHLYVMFNGQII--------------------
1g6hA           EHRDIVLNYIDHLYVMFNGQII--------------------
1gajA           EHRDIVLNYIDHLYVMFNGQII--------------------
1pf4A           AHRLSTIEQADEILVVDEGEIIERGRH---------------
2ghiA           AHRLSTISSAESIILLNKGKIVEKGTH---------------
3bk7A           EHDVLMIDYSDRLI----------------------------
2nq2D           THQP--------------------------------------
2ghiC           AHRLSTISSAESIILLNKGKIVEKGTH---------------
2nq2C           THQP--------------------------------------
2ghiD           AHRLSTISSAESIILLNKGKIVEKGTH---------------
2ghiB           AHRTI--SSAESIILLNKGKIVEKGTH---------------
1ji0A           EQNALGA-----------------------------------
2pzgB           TSKMEHLKKADKILILHEG-----------------------
1yqtA           EHDVLIDYVSDRLVF---------------------------
2pzfB           TSKMEHLKKADKILILHEG-----------------------
2pzgA           TSKMEHLKKADKILILHEG-----------------------
2pzeB           TSKMEHLKKADKILILHEG-----------------------
2pzeA           TSKMEHLKKADKILILHEG-----------------------
1xmiB           TSKMEHLKKADKILILHEG-----------------------
2cbzA           THSMSYLPQVDVIIVMSGGKI---------------------
1vplA           SHNMLEVEFCDRIALIHNGTIVETGT----------------
2pzfA           TSKMEHLKKADKILILHEG-----------------------
2bbsA           TSKMEHLKKADKILILHEG-----------------------
2bbtA           TSKMEHLKKADKILILHEG-----------------------
1xmiD           TSKMEHLKKADKILILHEG-----------------------
2bbtB           TSKMEHLKKADKILILHEG-----------------------
2bbsB           TSKMEHLKKADKILILHEG-----------------------
1xmiE           TSKMEHLKKADKILILHEG-----------------------
1xmiC           TSKMEHLKKADKILILHEG-----------------------
1xmiA           TSKMEHLKKADKILILHEG-----------------------
2bboA           TSKMEHLKKADKILILHEG-----------------------
2pjzA           THE---------------------------------------
1xmjA           TSKMEHLKKADKILILHEG-----------------------
2ihyA           THEEITANFS-KILLLKDGQSI--------------------
2zu0C           THYQRILDYPDYVHVLYQGRIV--------------------
2d3wA           THYQRILDYPDYVHVLYQGRIV--------------------
2ihyB           THEEITANFS-KILLLKDGQSI--------------------
2d3wD           THYQRILDYPDYVHVLYQGRIV--------------------
2ix3A           SHDSV-------------------------------------
2iwhB           SHDSV-------------------------------------
2d3wC           THYQRILDYPDYVHVLYQGRIV--------------------
2d2eA           THYQRILNYPDKVHVMMDGRVV--------------------
1xf9D           TSKMEHLRKADKILILHQG-----------------------
1xf9C           TSKMEHLRKADKILILHQG-----------------------
1xf9B           TSKMEHLRKADKILILHQG-----------------------
1xf9A           TSKMEHLRKADKILILHQG-----------------------
2d2fA           THYQRILNYPDKVHVMMDGRVV--------------------
2awoD           THDQVAMTLADKIVVLDAGRV---------------------
2awnD           THDQVAMTLADKIVVLDAGRV---------------------
1xfaA           TSKMEHLRKADKILILHQG-----------------------
1r10A           TSKMEHLRKADKILILHQG-----------------------
1r0zD           TSKMEHLRKADKILILHQG-----------------------
1r0zC           TSKMEHLRKADKILILHQG-----------------------
1r0zB           TSKMEHLRKADKILILHQG-----------------------
1r0zA           TSKMEHLRKADKILILHQG-----------------------
1r0xD           TSKMEHLRKADKILILHQG-----------------------
1r0xC           TSKMEHLRKADKILILHQG-----------------------
1r0xB           TSKMEHLRKADKILILHQG-----------------------
1r0xA           TSKMEHLRKADKILILHQG-----------------------
1r0wC           TSKMEHLRKADKILILHQG-----------------------
1r0wB           TSKMEHLRKADKILILHQG-----------------------
1r0wA           TSKMEHLRKADKILILHQG-----------------------
1q3hD           TSKMEHLRKADKILILHQG-----------------------
1q3hC           TSKMEHLRKADKILILHQG-----------------------
1q3hB           TSKMEHLRKADKILILHQG-----------------------
1q3hA           TSKMEHLRKADKILILHQG-----------------------
2d3wB           THYRILDYIPDYVHVLYQGRIV--------------------
1sgwA           ------------------------------------------
2qi9C           HDLNHTLRHAHRAWLLKGGKL---------------------
1l7vC           ------------------------------------------
2ix8A           SHDSV-------------------------------------
2iw3B           SHDSV-------------------------------------
2iw3A           SHDSV-------------------------------------
2r6fB           EHDTLAADY---------------------------------
2r6fA           EHDTLAADY---------------------------------
1z2rA           ------------------------------------------
3b60A           ------------------------------------------