[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ55924.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2vuyB.bssp"
#ERROR : Can't open dsspfile "2vuyA.bssp"
#ERROR : Can't open dsspfile "2vr5B.bssp"
#ERROR : Can't open dsspfile "2vr5A.bssp"
#ERROR : Can't open dsspfile "2vncA.bssp"
#ERROR : Can't open dsspfile "2vncB.bssp"
#ERROR : Can't open dsspfile "1bf2A.bssp"
#ERROR : Can't open dsspfile "2wanA.bssp"
#ERROR : Can't open dsspfile "2e8yA.bssp"
#ERROR : Can't open dsspfile "3faxA.bssp"
#ERROR : Can't open dsspfile "3fawA.bssp"
#ERROR : Can't open dsspfile "2fhbA.bssp"
#ERROR : Can't open dsspfile "2fh8A.bssp"
#ERROR : Can't open dsspfile "2fh6A.bssp"
#ERROR : Can't open dsspfile "2fgzA.bssp"
#ERROR : Can't open dsspfile "2bhuA.bssp"
#ERROR : Can't open dsspfile "1ehaA.bssp"
#ERROR : Can't open dsspfile "1eh9A.bssp"
#ERROR : Can't open dsspfile "1smaA.bssp"
#ERROR : Can't open dsspfile "1gviA.bssp"
#ERROR : Can't open dsspfile "2bhzA.bssp"
#ERROR : Can't open dsspfile "2bhyA.bssp"
#ERROR : Can't open dsspfile "1j0jA.bssp"
#ERROR : Can't open dsspfile "1j0hA.bssp"
#ERROR : Can't open dsspfile "1wzaA.bssp"
#ERROR : Can't open dsspfile "1ea9C.bssp"
#ERROR : Can't open dsspfile "1lwhA.bssp"
#ERROR : Can't open dsspfile "1cygA.bssp"
#ERROR : Can't open dsspfile "3dhuA.bssp"
#ERROR : Can't open dsspfile "1jf6A.bssp"
#ERROR : Can't open dsspfile "2wkgA.bssp"
#ERROR : Can't open dsspfile "2wcsA.bssp"
#ERROR : Can't open dsspfile "2wc7A.bssp"
#ERROR : Can't open dsspfile "1m7xD.bssp"
#ERROR : Can't open dsspfile "1m7xC.bssp"
#ERROR : Can't open dsspfile "1m7xA.bssp"
#ERROR : Can't open dsspfile "1m7xB.bssp"
#ERROR : Can't open dsspfile "1wzmA.bssp"
#ERROR : Can't open dsspfile "1wzlA.bssp"
#ERROR : Can't open dsspfile "1wzkA.bssp"
#ERROR : Can't open dsspfile "1g1yA.bssp"
#ERROR : Can't open dsspfile "1bvzA.bssp"
#ERROR : Can't open dsspfile "3dhuB.bssp"
#ERROR : Can't open dsspfile "1cgwA.bssp"
#ERROR : Can't open dsspfile "1vfmA.bssp"
#ERROR : Can't open dsspfile "1vb9A.bssp"
#ERROR : Can't open dsspfile "1jf5A.bssp"
#ERROR : Can't open dsspfile "1v3kA.bssp"
#ERROR : Can't open dsspfile "1v3jA.bssp"
#ERROR : Can't open dsspfile "1uktA.bssp"
#ERROR : Can't open dsspfile "1ua7A.bssp"
#ERROR : Can't open dsspfile "1pezA.bssp"
#ERROR : Can't open dsspfile "1pamA.bssp"
#ERROR : Can't open dsspfile "1kckA.bssp"
#ERROR : Can't open dsspfile "1d7fA.bssp"
#ERROR : Can't open dsspfile "1bagA.bssp"
#ERROR : Can't open dsspfile "1uksA.bssp"
#ERROR : Can't open dsspfile "1tcmA.bssp"
#ERROR : Can't open dsspfile "1pj9A.bssp"
#ERROR : Can't open dsspfile "1kclA.bssp"
#ERROR : Can't open dsspfile "1cxlA.bssp"
#ERROR : Can't open dsspfile "1cgyA.bssp"
#ERROR : Can't open dsspfile "1cgvA.bssp"
#ERROR : Can't open dsspfile "1cdgA.bssp"
#ERROR : Can't open dsspfile "1a47A.bssp"
#ERROR : Can't open dsspfile "2z1kA.bssp"
#ERROR : Can't open dsspfile "2taaA.bssp"
#ERROR : Can't open dsspfile "3bmvA.bssp"
#ERROR : Can't open dsspfile "1ot2A.bssp"
#ERROR : Can't open dsspfile "1d3cA.bssp"
#ERROR : Can't open dsspfile "1eo5A.bssp"
#ERROR : Can't open dsspfile "1qhoA.bssp"
#ERROR : Can't open dsspfile "1ot1A.bssp"
#ERROR : Can't open dsspfile "1dtuA.bssp"
#ERROR : Can't open dsspfile "3dc0A.bssp"
#ERROR : Can't open dsspfile "2ze0A.bssp"
#ERROR : Can't open dsspfile "2guyA.bssp"
#ERROR : Can't open dsspfile "1cgxA.bssp"
#ERROR : Can't open dsspfile "4cgtA.bssp"
#ERROR : Can't open dsspfile "1avaA.bssp"
#ERROR : Can't open dsspfile "1g5aA.bssp"
#ERROR : Can't open dsspfile "3bshA.bssp"
#ERROR : Can't open dsspfile "2aaaA.bssp"
#ERROR : Can't open dsspfile "1mvyA.bssp"
#ERROR : Can't open dsspfile "1jgiA.bssp"

## Summary of PDB Search
:707
      0.0  52%  2vuyB  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
      0.0  52%  2vuyA  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
      0.0  52%  2vr5B  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
      0.0  52%  2vr5A  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
      0.0  53%  2vncA  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
      0.0  54%  2vncB  [x.x.x] GLYCOGEN OPERON PROTEIN GLGX
    5e-86  36%  1bf2A  [x.x.x] ISOAMYLASE
    4e-33  30%  2wanA  [x.x.x] PULLULANASE
    1e-30  33%  2e8yA  [x.x.x] AMYX PROTEIN
    1e-27  30%  3faxA  [x.x.x] RETICULOCYTE BINDING PROTEIN
    7e-27  30%  3fawA  [x.x.x] RETICULOCYTE BINDING PROTEIN
    4e-19  29%  2fhbA  [x.x.x] PULLULANASE
    4e-19  29%  2fh8A  [x.x.x] PULLULANASE
    4e-19  29%  2fh6A  [x.x.x] PULLULANASE
    4e-19  29%  2fgzA  [x.x.x] PULLULANASE
    2e-15  35%  2bhuA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    3e-15  38%  1ehaA  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
    3e-15  38%  1eh9A  [b.1.18 - c.1.8 - b.71.1] GLYCOSYLTREHALOSE TREHALOHYDROLASE
    2e-12  30%  1smaA  [b.1.18 - c.1.8 - b.71.1] MALTOGENIC AMYLASE
    4e-12  31%  1gviA  [b.1.18 - c.1.8 - b.71.1] MALTOGENIC AMYLASE
    6e-11  37%  2bhzA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    6e-11  37%  2bhyA  [x.x.x] MALTOOLIGOSYLTREHALOSE TREHALOHYDROLASE
    2e-10  30%  1j0jA  [b.1.18 - c.1.8 - b.71.1] NEOPULLULANASE
    3e-10  31%  1j0hA  [b.1.18 - c.1.8 - b.71.1] NEOPULLULANASE
    4e-09  32%  1wzaA  [x.x.x] ALPHA-AMYLASE A
    9e-09  29%  1ea9C  [b.1.18 - c.1.8 - b.71.1] CYCLOMALTODEXTRINASE
    3e-08  36%  1lwhA  [c.1.8 - b.71.1] 4-ALPHA-GLUCANOTRANSFERASE
    2e-07  27%  1cygA  [x.x.x] CYCLODEXTRIN GLUCANOTRANSFERASE
    4e-07  30%  3dhuA  [x.x.x] ALPHA-AMYLASE
    5e-07  28%  1jf6A  [b.1.18 - c.1.8 - b.71.1] ALPHA AMYLASE II
    8e-07  30%  2wkgA  [x.x.x] ALPHA AMYLASE, CATALYTIC REGION
    8e-07  30%  2wcsA  [x.x.x] ALPHA AMYLASE, CATALYTIC REGION
    8e-07  30%  2wc7A  [x.x.x] ALPHA AMYLASE, CATALYTIC REGION
    8e-07  30%  1m7xD  [b.1.18 - c.1.8 - b.71.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME
    8e-07  31%  1m7xC  [b.1.18 - c.1.8 - b.71.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME
    8e-07  30%  1m7xA  [b.1.18 - c.1.8 - b.71.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME
    1e-06  31%  1m7xB  [b.1.18 - c.1.8 - b.71.1] 1,4-ALPHA-GLUCAN BRANCHING ENZYME
    1e-06  27%  1wzmA  [x.x.x] ALPHA-AMYLASE II
    1e-06  27%  1wzlA  [x.x.x] ALPHA-AMYLASE II
    1e-06  27%  1wzkA  [x.x.x] ALPHA-AMYLASE II
    1e-06  27%  1g1yA  [b.1.18 - c.1.8 - b.71.1] ALPHA-AMYLASE II
    1e-06  27%  1bvzA  [b.1.18 - c.1.8 - b.71.1] PROTEIN (ALPHA-AMYLASE II)
    2e-06  32%  3dhuB  [x.x.x] ALPHA-AMYLASE
    4e-06  27%  1cgwA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    5e-06  27%  1vfmA  [x.x.x] NEOPULLULANASE 2
    5e-06  27%  1vb9A  [b.1.18 - c.1.8 - b.71.1 (1jibA)] ALPHA-AMYLASE II
    5e-06  27%  1jf5A  [b.1.18 - c.1.8 - b.71.1] ALPHA AMYLASE II
    9e-06  28%  1v3kA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    9e-06  28%  1v3jA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    9e-06  28%  1uktA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    9e-06  34%  1ua7A  [c.1.8 - b.71.1] ALPHA-AMYLASE
    9e-06  27%  1pezA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    9e-06  28%  1pamA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    9e-06  27%  1kckA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    9e-06  28%  1d7fA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    9e-06  34%  1bagA  [x.x.x] ALPHA-1,4-GLUCAN-4-GLUCANOHYDROLASE
    1e-05  29%  1uksA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    1e-05  27%  1tcmA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    1e-05  26%  1pj9A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    1e-05  27%  1kclA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    1e-05  27%  1cxlA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN
    1e-05  27%  1cgyA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    1e-05  27%  1cgvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    1e-05  27%  1cdgA  [x.x.x] CYCLODEXTRIN GLYCOSYL-TRANSFERASE
    2e-05  29%  1a47A  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    3e-05  37%  2z1kA  [x.x.x] (NEO)PULLULANASE
    3e-05  28%  2taaA  [c.1.8 - b.71.1] TAKA-AMYLASE A
    3e-05  29%  3bmvA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    5e-05  27%  1ot2A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    5e-05  27%  1d3cA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLODEXTRIN
    6e-05  27%  1eo5A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
    8e-05  42%  1qhoA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] ALPHA-AMYLASE
    1e-04  27%  1ot1A  [c.1.8 - b.71.1 - b.1.18 - b.3.1] CYCLOMALTODEXTRIN
    1e-04  27%  1dtuA  [c.1.8 - b.71.1 - b.1.18 - b.3.1] PROTEIN (CYCLODEXTRIN
    1e-04  31%  3dc0A  [x.x.x] ALPHA-AMYLASE
    1e-04  29%  2ze0A  [x.x.x] ALPHA-GLUCOSIDASE
    2e-04  27%  2guyA  [x.x.x] ALPHA-AMYLASE A
    2e-04  25%  1cgxA  [x.x.x] CYCLOMALTODEXTRIN GLUCANOTRANSFERASE
    2e-04  27%  4cgtA  [x.x.x] CYCLODEXTRIN GLYCOSYLTRANSFERASE
    3e-04  31%  1avaA  [c.1.8 - b.71.1] BARLEY ALPHA-AMYLASE 2(CV MENUET)
    5e-04  32%  1g5aA  [c.1.8 - b.71.1] AMYLOSUCRASE
    5e-04  29%  3bshA  [x.x.x] ALPHA-AMYLASE TYPE A ISOZYME
    5e-04  32%  2aaaA  [x.x.x] ALPHA-AMYLASE
    9e-04  32%  1mvyA  [c.1.8 - b.71.1] AMYLOSUCRASE
    9e-04  32%  1jgiA  [c.1.8 - b.71.1] AMYLOSUCRASE
:707

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxPGHAYPLGATYDGSGTNFSLFSEVATGVELCLFDDDGAETRVPLTEQDGHVWHGYLPTVGPGQ
2vuyB           -------PGDPYPLGSNWDDDGVNFSLFSENAEKVELLLYNQKYPKEIIEVKNKTGDIWHVFVPGLRPGQ
2vuyA           -------PGDPYPLGSNWDDDGVNFSLFSENAEKVELLLYNQKYPKEIIEVKNKTGDIWHVFVPGLRPGQ
2vr5B           -------PGDPYPLGSNWDDDGVNFSLFSENAEKVELLLYNQKYPKEIIEVKNKTGDIWHVFVPGLRPGQ
2vr5A           -------PGDPYPLGSNWDDDGVNFSLFSENAEKVELLLYNQKYPKEIIEVKNKTGDIWHVFVPGLRPGQ
2vncA           -------PGDPYPLGSNWDDDGVNFSLFSENAEKVELLLYNQKYPKEIIEVKNKTGDIWHVFVPGLRPGQ
2vncB           -------PGDPYPLGSNWDDDGVNFSLFSENAEKVELLLYNQKYPKEIIEVKNKTGDIWHVFVPGLRPGQ
1bf2A           -------------LGASYDAQQANFRVYSSQATRIVLYLYSAGYGSATYTLSPAGSGVWAVTVPVITGAV
2wanA           -------------LGNVYSKDATSFRVWAPTASNVQLLLYNSEGSITKLEMQKSDNGTWK--LQVSGNLE
2e8yA           ----------------------------------------------------------------------
3faxA           ------------------DGSKVEASLWSPSADSVTMIIYDKDNQNRVVPLVKNNKGVWQTILDTLGIKN
3fawA           ------------------DGSKVEASLWSPSADSVTMIIYDKDNQNRVVPLVKNNKGVWQTILDTLGIKN
2fhbA           ----------------------------------------------------------------------
2fh8A           ----------------------------------------------------------------------
2fh6A           ----------------------------------------------------------------------
2fgzA           ----------------------------------------------------------------------
2bhuA           -------------LGATPGGAGTRFRLWTSTARTVAVRV---NGTEH--VMTSLGGGIYELELP-VGPGA
1ehaA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
1smaA           ----------------------------------------------------------------------
1gviA           ----------------------------------------------------------------------
2bhzA           -------------LGATPGGAGTRFRLWTSTARTVAVRV---NGTEH---VTSLGGGIYELELP-VGPGA
2bhyA           -------------LGATPGGAGTRFRLWTSTARTVAVRV---NGTEH---VTSLGGGIYELELP-VGPGA
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1jf6A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1m7xD           ----------------------------------------------------------------------
1m7xC           ----------------------------------------------------------------------
1m7xA           ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
1m7xB           ----------------TMDGTGTRFSVWAPNARRVSVVGQFNDGRRHPMRLRKESG-IWELFIPGAHNGQ
1wzmA           ----------------------------------------------------------------------
1wzlA           ----------------------------------------------------------------------
1wzkA           ----------------------------------------------------------------------
1g1yA           ----------------------------------------------------------------------
1bvzA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1vfmA           ----------------------------------------------------------------------
1vb9A           ----------------------------------------------------------------------
1jf5A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1ua7A           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
2z1kA           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           RYGYRVHGPYDPERGLRCNPNKLLVDPYAKAIDGQIHWHESLFDYHFADPGRVNNHDSAPYVPTCVVVSP
2vuyB           LYAYRVYGPYKPELGLRFNPNKVLIDPYAKAINGSVIWNDAVFGYKIGDQNQYDERDSGEYVPKSVVINP
2vuyA           LYAYRVYGPYKPELGLRFNPNKVLIDPYAKAINGSVIWNDAVFGYKIGDQNQYDERDSGEYVPKSVVINP
2vr5B           LYAYRVYGPYKPELGLRFNPNKVLIDPYAKAINGSVIWNDAVFGYKIGDQNQYDERDSGEYVPKSVVINP
2vr5A           LYAYRVYGPYKPELGLRFNPNKVLIDPYAKAINGSVIWNDAVFGYKIGDQNQYDERDSGEYVPKSVVINP
2vncA           LYAYRVYGPYKPELGLRFNPNKVLIDPYAKAINGSVIWNDAVFGYKIGDQNQYDERDSGEYVPKSVVINP
2vncB           LYAYRVYGPYKPELGLRFNPNKVLIDPYAKAINGSVIWNDAVFGYKIGDQNQYDERDSGEYVPKSVVINP
1bf2A           YYGYRAWGPNWPANGDRFNPNKLLLDPYAQEVSQDPLNPSNQNGNVFASGASYRTTDSGIYAPKGVVLVP
2wanA           NWYYLYQVTVN-------GTTQTAVDPYARAISVNAT-RGMIVDLKATDPGWQGDHEQTPANPV------
2e8yA           ---------------------------YAVTVTGDLHGYEYLFCIQYAKAVTVNGEKG-------VVLRP
3faxA           YTGY--YYLYEIKRGDKVK----ILDPYAKSL---AEWDSNTVDIKTAKAAFVNPSQLGPQNLSFAKIAN
3fawA           YTGY--YYLYEIKRG---KDKVKILDPYAKSL---AEWDSNTVDIKTAKAAFVNPSQLGPQNLSFAKIAN
2fhbA           ----------------------------------------------------------------------
2fh8A           ----------------------------------------------------------------------
2fh6A           ----------------------------------------------------------------------
2fgzA           ----------------------------------------------------------------------
2bhuA           RYLFVLDGVPTP-------------DPYARFLPDGVHGEAEVVDFGT-----------------------
1ehaA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
1smaA           ----------------------------------------------------------------------
1gviA           ----------------------------------------------------------------------
2bhzA           RYLFVLDGVPTP-------------DPYARFLPDGVHGEAEVVDFGT-----------------------
2bhyA           RYLFVLDGVPTP-------------DPYARFLPDGVHGEAEVVDFGT-----------------------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1jf6A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1m7xD           ----------------------------------------------------------------------
1m7xC           ----------------------------------------------------------------------
1m7xA           LYKYEM---IDANGNLR-----LKSDPYA-----------------FEAQMRPETASLICGLPEKVVQTE
1m7xB           LYKYEM---IDANGNLR-----LKSDPYA--------------------------FEAQPETASLICGLP
1wzmA           ----------------------------------------------------------------------
1wzlA           ----------------------------------------------------------------------
1wzkA           ----------------------------------------------------------------------
1g1yA           ----------------------------------------------------------------------
1bvzA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1vfmA           ----------------------------------------------------------------------
1vb9A           ----------------------------------------------------------------------
1jf5A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1ua7A           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
2z1kA           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           FFDWGAEQHPNIPYHETVIYEAHVRGMTIRHPDVPPPLRGTYAGMAHPAIIEHLLSLGVTAVELMPIHHF
2vuyB           YFEWDDEDFKKVPLKDTVIYEVHVKGFTKLRLDLPENIRGTYEGLASEQMISYLKDLGITTVELMPVFHF
2vuyA           YFEWDDEDFKKVPLKDTVIYEVHVKGFTKLRLDLPENIRGTYEGLASEQMISYLKDLGITTVELMPVFHF
2vr5B           YFEWDDEDFKKVPLKDTVIYEVHVKGFTKLRLDLPENIRGTYEGLASEQMISYLKDLGITTVELMPVFHF
2vr5A           YFEWDDEDFKKVPLKDTVIYEVHVKGFTKLRLDLPENIRGTYEGLASEQMISYLKDLGITTVELMPVFHF
2vncA           YFEWDDEDFKKVPLKDTVIYEVHVKGFTKLRLDLPENIRGTYEGLASEQMISYLKDLGITTVELMPVFHF
2vncB           YFEWDDEDFKKVPLKDTVIYEVHVKGFTKLRLDLPENIRGTYEGLASEQMISYLKDLGITTVELMPVFHF
1bf2A           STQ-STGTKPTRAQKDDVIYEVHVRGFTEQDTSIPAQYRGTYYGAGLKA--SYLASLGVTAVEFLPVQET
2wanA           ---------------DEVIYEAHVRDFSI-DANSGMKNKGKYLAFTEHGTIDSLKELGITTVQLQPVEEF
2e8yA           DMKWTAPLKPFSHPVDAVIYETHLRDFSI-HENSGMINKGKYLALTETDTLAYVKELGVTHVELLPVNDF
3faxA           FKG----------RQDAVIYEAHVRDFTSDQSLDGKNQLGTFAAFSEK--LDYLQKLGVTHIQLLPVLSY
3fawA           FKG----------RQDAVIYEAHVRDFT-SDQSLDGKLKGTFAAFSEK--LDYLQKLGVTHIQLLPVLSY
2fhbA           ----------------------------------------------------------------------
2fh8A           ----------------------------------------------------------------------
2fh6A           ----------------------------------------------------------------------
2fgzA           ----------------------------------------------------------------------
2bhuA           -FDWTDADWHGIKLADCVFYEVHVGTFT---PE------GTYRAAAEK--LPYLKELGVTAIQVMPLAAF
1ehaA           ---------------DLIIYEIHVGTFT---PE------GTFEGVIRK--LDYLKDLGITAIEIMPIAQF
1eh9A           ---------------DLIIYEIHVGTFT---PE------GTFEGVIRK--LDYLKDLGITAIEIMPIAQF
1smaA           --------------------------------------------------LDYLADLGITGIYLTPIFRA
1gviA           --------------------------------------------------LDYLADLGITGIYLTPIFRA
2bhzA           -FDWTDADWHGIKLADCVFYEVHVGTFT---PE------GTYRAAAEK--LPYLKELGVTAIQV------
2bhyA           -FDWTDADWHGIKLADCVFYEVHVGTFT---PE------GTYRAAAEK--LPYLKELGVTAIQV------
1j0jA           ---------------DTVWYQIFPERFANGNPSISPPTPTSFFGGDLQGIIDHLVDLGITGIYLTPIFRS
1j0hA           ---------------DTVWYQIFPERFANGNPSISPPTPTSFFGGDLQGIIDHLVDLGITGIYLTPIFRS
1wzaA           ---------------------------------------------------ETIADLGVNGIWLMPIFKS
1ea9C           --------------------------------------------------LDHLSKLGVNAVYFTPLFKA
1lwhA           ---------------------------------------GDFRGLKNA--VSYLKELGIDFVWLMPVFSS
1cygA           ---------------------------------------GDWQGIINKINDGYLTDMGVTAIWISQPVEN
3dhuA           ---------------------------------------GNFAGVT--ADLQRIKDLGTDILWLLPINPI
1jf6A           ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
2wkgA           --------------------------------------------------LDYIQNLGINAIYFTPIFQS
2wcsA           --------------------------------------------------LDYIQNLGINAIYFTPIFQS
2wc7A           --------------------------------------------------LDYIQNLGINAIYFTPIFQS
1m7xD           ------------------IYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
1m7xC           ------------------IYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
1m7xA           ------ERKKANQFDAPIIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
1m7xB           EKVVQTEERKKANQFDAPIYEVHL-GSWRRHTDNNFWL--SYRELADQ-LVPYAKWMGFTHLELLPIN--
1wzmA           ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
1wzlA           ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
1wzkA           ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
1g1yA           ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
1bvzA           ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
3dhuB           ---------------------------------------GNFAGVT--ADLQRIKDLGTDILWLLPINPI
1cgwA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1vfmA           ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
1vb9A           ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
1jf5A           ---------------EAVIYQIFPERFANGDPSNDPPGTEQWAKDARPGVIDYLEELGVTALYFTPIFAS
1v3kA           ---------------------------------------GDWQGIINKINDGYLTGMGITAIWIQPVENI
1v3jA           ---------------------------------------GDWQGIINKINDGYLTGMGITAIWIQPVENI
1uktA           ---------------------------------------GDWQGIINKINDGYLTGMGITAIWIQPVENI
1ua7A           ---------------------------------------------------------GYTAIQTSPINQ-
1pezA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1pamA           ---------------------------------------GDWQGIINKINDGYLTGMGITAIWIQPVENI
1kckA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1d7fA           ---------------------------------------GDWQGIINKINDGYLTGMGITAIWIQPVENI
1bagA           ---------------------------------------------------------GYTAIQTSPINQ-
1uksA           ---------------------------------------GDWQGIINKINDGYLTGMGITAIWIQPVENI
1tcmA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1pj9A           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1kclA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1cxlA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1cgyA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1cgvA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1cdgA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1a47A           ------------------------------HTSLKKYFGGDWQGIINKINDGYLTGMGVTAIWISQIYAV
2z1kA           --------------------------------EAPPTLRGTLWGVAEK--LPYLLDLGVEAIYLNPVFAS
2taaA           ---------------------------------------GTWQGIIDK--LDYIQGMGFTAIWITPVTAQ
3bmvA           ------------------------------HTSLKKYFGGDWQGIINKINDGYLTGMGVTAIWIPQIYAV
1ot2A           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1d3cA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1eo5A           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1qhoA           --------------------------------------------------LPYLKQLGVTTIWLSPVLDN
1ot1A           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
1dtuA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
3dc0A           ---------------------------------------------------------GYTAIQTSPINQ-
2ze0A           -------------WKEGVAYQIYPRSFMDANGDGIGDLRGIIEKL------DYLVELGVDIVWICPIY--
2guyA           ---------------------------------------GTWQGIIDK--LDYIQGMGFTAIWITPVTAQ
1cgxA           ---------------------------------------GDWQGIINKINDGYLTGMGVTAIWIQPVENI
4cgtA           ---------------------------------------GDWQGLINKINDNYFSDLGVTALWIQPVENI
1avaA           ----------------------------------------------------------------------
1g5aA           --------------------------------------------------IPYFQELGLTYLHLMPLFKC
3bshA           --------------------------------------------------VDDIAAAGVTHVWLPP----
2aaaA           -----------------------------------------YCGGSWQGIIDHLEGMGFTAIWISPITEQ
1mvyA           --------------------------------------------------IPYFQELGLTYLYLMPLFKC
1jgiA           --------------------------------------------------IPYFQELGLTYLYLMPLFKC


                         .         .         .         +         .         .         .:280
query           LPEHALVARGLTNYWGYNTLAFFAPHSGYAATGTRGHQVQEFKTMVKALHQAGIEVILDVVYNHTAEGDH
2vuyB           IDQRFLTDKGLTNYWGYDPINFFSPECRYSSTGCLGGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNH
2vuyA           IDQRFLTDKGLTNYWGYDPINFFSPECRYSSTGCLGGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNH
2vr5B           IDQRFLTDKGLTNYWGYDPINFFSPECRYSSTGCLGGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNH
2vr5A           IDQRFLTDKGLTNYWGYDPINFFSPECRYSSTGCLGGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNH
2vncA           IDQRFLTDKGLTNYWGYDPINFFSPECRYSSTGCLGGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNH
2vncB           IDQRFLTDKGLTNYWGYDPINFFSPECRYSSTGCLGGQVLSFKKMVNELHNAGIEVIIDVVYNHTAEGNH
1bf2A           QNDANDVVPNSDNYWGYMTENYFSPDRRYAYNKAAGGPTAEFQAMVQAFHNAGIKVYMDVVYNHTAEGPT
2wanA           --NSIDETQPDTYNWGYDPRNYNVPEGAYATTPEGTARITELKQLIQSLHQQRIGVNMDVVYNHTFD---
2e8yA           AGVDEEKPLDAYN-WGYNPLHFFAPEGSYASNP---HDPQELKQMINTLHQHGLRVILDVVFNHVYKREN
3faxA           FYVNEMDKSRSTAYWGYDPQSYFALSGMYSEKPKDSARIAELKQLIHDIHKRGMGVILDVVYNHTAK---
3fawA           FYVNEMDKSRSTAYWGYDPQSYFALSGMYSEKPKDSARIAELKQLIHDIHKRGMGVILDVVYNHTAK---
2fhbA           ---NTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQLGMNVIMDVVYNHT---NA
2fh8A           ---NTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQLGMNVIMDVVYNHT---NA
2fh6A           ---NTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQLGMNVIMDVVYNHT---NA
2fgzA           ---NTLVAQTDSYNWGYDPFHYTVPEGSYATDPEGTARIKEFRTMIQAIKQLGMNVIMDVVYNHT---NA
2bhuA           DGQRG----------------WXXXXXXXXXXXXXXXXXEDLMALVDAAHRLGLGVFLDVVYNH------
1ehaA           PGKRD---------WGYDGVYLYAVQNSYG--GPEG-----FRKLVDEAHKKGLGVILDVVYNHVGEGNY
1eh9A           PGKRD---------WGYDGVYLYAVQNSYG--GPEG-----FRKLVDEAHKKGLGVILDVVYNHVGEGNY
1smaA           PSNHK-----------YDTADYFEPHFGDKET---------LKTLVKRCHEKGIRVMLDAVFNHC--GYE
1gviA           PSNHK-----------YDTADYFEPHFGDKET---------LKTLVKRCHEKGIRVMLDAVFNHC--GYE
2bhzA           ------------------PLAAFDGQRGWXXXXXXXXXXXEDLALVDAAHRLGLGVFLDVVYN------H
2bhyA           ------------------PLAAFDGQRGWXXXXXXXXXXXEDLALVDAAHRLGLGVFLDVVYN------H
1j0jA           PSNHK-----------YDTADYFEPHFGDKET---------LKTLIDRCHEKGIRVMLDAVFNHC--GYE
1j0hA           PSNHK-----------YDTADYFEPHFGDKET---------LKTLIDRCHEKGIRVMLDAVFNHC--GYE
1wzaA           -----------PSYHGYDVTDYYKINPDYGT-------LEDFHKLVEAAHQRGIKVIIDLPINHTSE---
1ea9C           TTNHK-----------YDTEDYFQIDPQFGDKDT-------LKKLVDLCHERGIRVLLDAVFNHS--GRT
1lwhA           ISFH-----------GYDVVDFYSFKAEYGSE-------REFKEMIEAFHDSGIKVVLDLPIHHTG-FLH
1cygA           VFSVMNDASGSASYHGYWARDFKKPNPFFGT-------LSDFQRLVDAAHAKGIKVIIDFAPNHTSPASE
3dhuA           ---------GEVNRKG--TLGSPYAIKDYRGINPEYGTLADFKALTDRAHELGMKVMLDIVYNHTSPDSV
1jf6A           PSHHK-----------YDT-------ADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
2wkgA           ASNHR-----------YHT------HDYYQVDPMLGGN-EAFKELLDAAHQRNIKVVLDGVFNHSSRGFF
2wcsA           ASNHR-----------YHT------HDYYQVDPMLGGN-EAFKELLDAAHQRNIKVVLDGVFNHSSRGFF
2wc7A           ASNHR-----------YHT------HDYYQVDPMLGGN-EAFKELLDAAHQRNIKVVLDGVFNHSSRGFF
1m7xD           --EHPF-----DGSWGYQPTGLYAPTRRF---GTR----DDFRYFIDAAHAAGLNVILDWVPGHFPTDD-
1m7xC           --EHPF-----DGSWGYQPTGLYAPTRRF---GTR----DDFRYFIDAAHAAGLNVILDWVPGHFPTDDF
1m7xA           --EHPF-----DGSWGYQPTGLYAPTRRF---GTR----DDFRYFIDAAHAAGLNVILDWVPGHFPTDD-
1m7xB           --EHPF-----DGSWGYQPTGLYAPTRRF---GTR----DDFRYFIDAAHAAGLNVILDWVPGHFPTDD-
1wzmA           PSHHK-----------YDT-------ADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
1wzlA           PSHHK-----------YDT-------ADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
1wzkA           PSHHK-----------YDT-------ADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
1g1yA           PSHHK-----------YDT-------ADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
1bvzA           PSHHK-----------YDT-------ADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
3dhuB           ---------GEVNRKG--TLGSPYAIKDYRGINPEYGTLADFKALTDRAHELGMKVMLDIVYNHTSPDSV
1cgwA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1vfmA           PSHHK-----------YDT-------ADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
1vb9A           PSHHK-----------YDT-------ADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
1jf5A           PSHHK-----------YDT-------ADYLAIDPQFGDLPTFRRLVDEAHRRGIKIILDAVFNHAGDQFF
1v3kA           Y--------SVINYSGVNNTAYHGYWADFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPASS
1v3jA           Y--------SVINYSGVNNTAYHGYWADFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPASS
1uktA           Y--------SVINYSGVNNTAYHGLWADFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPASS
1ua7A           VKEGNQGDKSMSNYWLYQPTSY---QIGNRYLGTE----QEFKEMCAAAEEYGIKVIVDAVINHTT-FDY
1pezA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1pamA           Y--------SVINYSGVNNTAYHGYWADFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPASS
1kckA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1d7fA           Y--------SVINYSGVNNTAYHGYWADFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPASS
1bagA           VKEGNQGDKSMSNYWLYQPTSY---QIGNRYLGTE----QEFKEMCAAAEEYGIKVIVDAVINHTT-FDY
1uksA           Y--------SVINYSGVNNTAYHGYWADFKKTNPAYGTMQDFKNLIDTAHAHNIKVIIDFAPNHTSPASS
1tcmA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1pj9A           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1kclA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1cxlA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1cgyA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1cgvA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1cdgA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1a47A           LPDSTF--GGSTSYHGYWARDFKRTNPYFGS-------FTDFQNLINTAHAHNIKVIIDFAPNHTSPASE
2z1kA           TANHR-----------YHTVDYFQVDPILGGNEALRH-------LLEVAHAHGVRVILDGVFNHTGRG--
2taaA           LPQDCAYGDAYTGYWQTD---IYSLNENYGTA-------DDLKALSSALHERGMYLMVDVVANH------
3bmvA           LPDSTF--GGSTSYHGYWARDFKRTNPYFGS-------FTDFQNLINTAHAHNIKVIIDFAPNHTSPASE
1ot2A           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIINFAPNHTSPASS
1d3cA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1eo5A           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
1qhoA           LD--TLAGTDNTGYHGYWTRDFIEEHFGNWTT---------FDTLVNDAHQNGIKVIVDFVPNHS-----
1ot1A           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIAFAPNHTSPASS
1dtuA           YSIINDSGVNNTAYHGYWARDFKKTNPAYGT-------IADFQNLIAAAHAKNIKVIIDFAPNHTSPASP
3dc0A           VKEGNKGDKSMGNYWLYQPTSY---QIGNRYLGSE----EEFKEMCAAAEEYGVKVIVDAVINHTT-SDY
2ze0A           --------RSPNADNGYDISDYYAIMDEFGT-------MDDFDELLAQAHRRGLKVILDLVINHTSD-EH
2guyA           LPQTTAYGDAYHGYWQQD---IYSLNENYGTA-------DDLKALSSALHERGMYLMVDVVANH------
1cgxA           Y--------SIINYSGVNNTAYHGYWADFKKTNPAYGTIADFQNLIAAAHAKNIKVIIDFAPNHTSPASS
4cgtA           FA--TINYSGVTNYWARD----FKKTNPYFGT------MADFQNLITTAHAKGIKIVIDFAPNHTSPADA
1avaA           -----IAAAGITHVWASQSVAEYMPGRLYDLDASKYGNKAQLKSLIGALHGKGVKAIADIVINHTAEKDG
1g5aA           PEGKSDGGYAVSSYRDVNP-----------ALGTIG----DLREVIAALHEAGISAVVDFIFNHTS----
3bshA           -PSHSVSNEG------------YMPGRLYDIDASKYGNAAELKSLIGALHGKGVQAIADIVINHRCADDS
2aaaA           LPQDTADGEAYHGYWQQK---IYDVNSNFGT-------ADNLKSLSDALHARGMYLMVDVV------PDH
1mvyA           PEGKSDGGYAVSSYRDVNP-----------ALGTIG----DLREVIAALHEAGISAVVDFIFNHTS----
1jgiA           PEGKSDGGYAVSSYRDVNP-----------ALGTIG----DLREVIAALHEAGISAVVDFIFNHTS----


                         .         *         .         .         .         .         +:350
query           MGPALSLRGIDNLAYYRVREDNPRYYLDYTGCGNSLNVRHPHSLQLIMDSLRYWVLDMHVDGFRFDLAAA
2vuyB           LGPTLSFRGIDNTAYYMLQPDNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFDLAAA
2vuyA           LGPTLSFRGIDNTAYYMLQPDNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFDLAAA
2vr5B           LGPTLSFRGIDNTAYYMLQPDNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFDLAAA
2vr5A           LGPTLSFRGIDNTAYYMLQPDNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFDLAAA
2vncA           LGPTLSFRGIDNTAYYMLQPDNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFDLAAA
2vncB           LGPTLSFRGIDNTAYYMLQPDNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTEMHVDGFRFDLAAA
1bf2A           TATIYSWRGLDNATYYELTSGN-QYFYDNTGIGANFNTYNTVAQNLIVDSLAYWANTMGVDGFRFDLASV
2wanA           ----VMVSDFDKIVYYRT---DXXXXXXXXXXXXEFATEHPMAQKFVLDSVNYWVNEYHVDGFRFDLMAL
2e8yA           SPFEKTVPG------YFFRHDECGKPSNGTGVGNDIASERRMARKFIADCVVYWLEEYNVDGFRFDLLGI
3faxA           ---TYLFEDIEPNYYHFMNEDSPRESFG----GGRLGTTHAMSRRVLVDSIKYLTSEFKVDGFRFDMMG-
3fawA           ---TYLFEDIEPNYYHFMNEDSPRESFG----GGRLGTTHAMSRRVLVDSIKYLTSEFKVDGFRFDMMG-
2fhbA           AGPTDRTSVLDKIVWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLML-
2fh8A           AGPTDRTSVLDKIVWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLML-
2fh6A           AGPTDRTSVLDKIVWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLML-
2fgzA           AGPTDRTSVLDKIVWYYQRLNETTGSVESATCCSDSAPEHRMFAKLIADSLAVWTTDYKIDGFRFDLML-
2bhuA           FGPSGNY-----LSSYA-----PSYFTDRSAWGMGLDYAEPHMRRYVTGNARMWLRDYHFDGLRLDILTE
1ehaA           MGPYFS----------------QKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHA
1eh9A           MGPYFS----------------QKYKTPWGLTFNFDDAESDEVRKFILENVEYWIKEYNVDGFRLDAVHA
1smaA           FAPFQDVLKNGAASRYKIRETEPRPNYDFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANE
1gviA           FAPFQDVLKNGAASRYKIRETEPRPNYDFVPHMPKLNTAHPEVKRYLLDVATYWIREFDIDGWRLDVANE
2bhzA           FGPSGNY-----LSSYA-----PSYFTDFSSAWGGLDYAEPHR-RYVTGNAR-WLRDYHFDGLRLDILTE
2bhyA           FGPSGNY-----LSSYA-----PSYFTDFSSAWGGLDYAEPHR-RYVTGNAR-WLRDYHFDGLRLDILTE
1j0jA           FAPFQDVWKNGESSKYKQTEPRPNYTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANE
1j0hA           FAPFQDVWKNGESSKYKQTEPRPNYTFAFVPQMPKLNTANPEVKRYLLDVATYWIREFDIDGWRLDVANE
1wzaA           RHPWFLKASRDKNSEYRTKLDGGRYYGYFWSGMPDLNYNNPEVQEKVIGIAKYW-LKQGVDGFRLDGAMH
1ea9C           FPPFVDVLKNGEKSKYKVVDGIPTYTFAFEPLMPKLNTEHPDVKEYLLKAAEYWIRETGIDGWRLDVANE
1lwhA           TWFQKALKGDPHYRDYYVREEDGRFYRGLFGFSPDLNYDNPQVFD-EMKRLVLHLLDMGVDGFRFDAA--
1cygA           TNPSYMENGYDNGTLLGGYTNDANMYFHHNGGTTDLNHQNPVIDRYLKDAVKMWI-DMGIDGIRMD----
3dhuA           LAPEWFYHDADGQLTNKVGDWSDVKDLDY---------GHHELWQYQIDTLLYW--SQFVDGYRCDVAPL
1jf6A           AFRDVLQKGIEDFPVSKTSRTNYETYAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLDVANE
2wkgA           FGPHSPWVNWFKIEGWPLSPYNGEFPANYVGAGNEFNHDNPEVREYIMEIAEYW-LKFGIDGWRLDV---
2wcsA           FGPHSPWVNWFKIEGWPLSPYNGEFPANYVGAGNEFNHDNPEVREYIMEIAEYW-LKFGIDGWRLDV---
2wc7A           FGPHSPWVNWFKIEGWPLSPYNGEFPANYVGAGNEFNHDNPEVREYIMEIAEYW-LKFGIDGWRLDV---
1m7xD           ----FALAEFDGTNLY--EHSNTLIY----------NYGRREVSNFLVGNALYWIERFGIDALRVDAVAS
1m7xC           ---ALAEFDGTNLYEHSLIYNYGRREVSNFLVGNAL----------------YWIERFGIDALRVDVASM
1m7xA           ----FALAEFDGTNLY---EHSTLIY----------NYGRREVSNFLVGNALYWIERFGIDALRVDAVAS
1m7xB           ----FALAEFDGTNLY---EHSTLIY----------NYGRREVSNFLVGNALYWIERFGIDALRVDAVAS
1wzmA           AFRDVLQKGIEDFPVSKTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLDVANE
1wzlA           AFRDVLQKGIEDFPVSKTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLDVANE
1wzkA           AFRDVLQKGIEDFPVSKTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLDVANE
1g1yA           AFRDVLQKGIEDFPVSKTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLDVANE
1bvzA           AFRDVLQKGIEDFPVSKTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLDVANE
3dhuB           L----------------ATEHPEWFYHDLTNVGDDLDYGHHELWQYQIDTLLYW--SQFVDGYRCDVAPL
1cgwA           DQPSFAENGYDNLGGYTNDTQNLFHHNGYKNLGDLADLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1vfmA           AFRDVLQKGIEDFPVSKTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLNVANE
1vb9A           AFRDVLQKGIEDFPVSKTSRTNYETFAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLNVANE
1jf5A           AFRDVLQKGIEDFPVSKTSRTNYETAAVQVPAMPKLRTENPEVKEYLFDVARFW-MEQGIDGWRLDVANE
1v3kA           DDPSFAENGYDNLGGYTNDTQNLFHHTDFSTIENGIDLNHNNSSVYLKDAIKMW-LDLGVDGIRVD----
1v3jA           DDPSFAENGYDNLGGYTNDTQNLFHHTDFSTIENGIDLNHNNSSVYLKDAIKMW-LDLGVDGIRVD----
1uktA           DDPSFAENGYDNLGGYTNDTQNLFHHTDFSTIENGIDLNHNNSSVYLKDAIKMW-LDLGVDGIRVD----
1ua7A           AAISNEVKSIPNWTHGNTQIKNWSDRWDVT--QNSLNTQNT-QVQSYLKRFLERALNDGADGFRFDAA--
1pezA           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMDV---
1pamA           DDPSFAENGYDNLGGYTNDTQNLFHHTDFSTIENGIDLNHNNSSVYLKDAIKMW-LDLGVDGIRVD----
1kckA           DQPSFAENGYDNLGGYTNDTQNLFHHNGYKGLYDLADLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1d7fA           DDPSFAENGYDNLGGYTNDTQNLFHHTDFSTIENGIDLNHNNSSVYLKDAIKMW-LDLGVDGIRVD----
1bagA           AAISNEVKSIPNWTHGNTQIKNWSDRWDVT--QNSLNTQNT-QVQSYLKRFLERALNDGADGFRFDAA--
1uksA           DDPSFAENGYDNLGGY--TNDTQNLFHHYGGTDLSLNHNNSSVDVYLKDAIKMW-LDLGVDGIRVD----
1tcmA           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1pj9A           DQPSFAENGTQNLFHHNGGTDFSSYEDGYRNLYDLADLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1kclA           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1cxlA           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1cgyA           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1cgvA           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1cdgA           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1a47A           TDPTYAENGYDNLGGY--TNDTNGYFHHYGGTDFSLNQQNSTIDSYLKSAIKVW-LDMGIDGIRLD----
2z1kA           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
3bmvA           TDPTYAENGYDNLGGY--TNDTNGYFHHYGGTDFSLNQQNSTIDSYLKSAIKVW-LDMGIDGIRLD----
1ot2A           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1d3cA           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMN----
1eo5A           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIR------
1qhoA           ----------------------------------------------------------------------
1ot1A           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
1dtuA           DQPSFAENGYDNLGGYTNDTQNLFHHTDFSTTENGIDLNHNNSTVYLKDAIKMW-LDLGIDGIRMD----
3dc0A           AAISNEIKSISNWTHGNTQIKNWSDRWDVT--QNSLNTQNT-QVQSYLKRFLERALNDGADGFRYDAA--
2ze0A           PWFIESRSSRDNPSAWQYDERTGQYYLHIFDVKQDLNWENSEVRQALYEMVNWW-LDKGIDGFRID----
2guyA           ----------------------------------------------------------------------
1cgxA           DQPSFAENG-------------------------------------------------------------
4cgtA           ENGRLYDNGTDTNGYFHHNGGSDFSSLEYKNLYDLADFNHNNATKYFKDAIKLW-LDMGVDGIRVD----
1avaA           RGIYCIFEGLDWGPHMICRDDRP--YADGTGNPDTLNLRVQKEL---VEWLNWLKADIGFDGWRFDFAKG
1g5aA           ----------------------------------------------------------------------
3bshA           RGIACIFEGGTDWGPHMICRDDTKYNLD-TGADFAAAPDIDHLNDRVQRELKEWLLDLGFDAWRLDFARG
2aaaA           MGYAGNGNDVD-----------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           LAREFHDVDRLSTFFDIVQQDPVISQVKLIAEPWDVGPGGYQVGNFPPLWTEWNGKYRDTVRDFWRGYPV
2vuyB           LARELYSVNMLNTFFIALQQDPILSQVKLIAEPWDVGQGGYQVGNFPYQWAEWNGKYRDSIRRFWRG-EA
2vuyA           LARELYSVNMLNTFFIALQQDPILSQVKLIAEPWDVGQGGYQVGNFPYQWAEWNGKYRDSIRRFWRG-EA
2vr5B           LARELYSVNMLNTFFIALQQDPILSQVKLIAEPWDVGQGGYQVGNFPYQWAEWNGKYRDSIRRFWRG-EA
2vr5A           LARELYSVNMLNTFFIALQQDPILSQVKLIAEPWDVGQGGYQVGNFPYQWAEWNGKYRDSIRRFWRG-EA
2vncA           LARELYSVNMLNTFFIALQQDPILSQVKLIAEPWDVGQGGYQVGNFPYQWAEWNGKYRDSIRRFWRG-EA
2vncB           LARELYSVNMLNTFFIALQQDPILSQVKLIAEPWDVGQGGYQVGNFPYQWAEWNGKYRDSIRRFWRG-EA
1bf2A           LGNSCLNGAYTASAFDAADSNVAINRIDLFAEPWAIGGNSYQLGGFPQGWSEWNGLFRDSLRELGSMTIY
2wanA           LGKD--TMAKISNELHAINPG-----IVLYGEPWTGGTSGLSSDQLVTKGQQKGGVFNDNIRNFATGDPN
2e8yA           L-----DID--TVLYMKEKATKAKPGILLFGEGWDLAPLPHELANAPRM--PGIGFFNDMFRDAVKGNTF
3faxA           ------DHDAAAIELAYKEAKAINPNMIMIGEGWRTGDQGKPVKPADQDWTDTVGVFSDDIRNSLKGFPS
3fawA           ------DHDAAAIELAYKEAKAINPNMIMIGEGWRTGDQGKPVKPADQDWTDTVGVFSDDIRNSLKGFPS
2fhbA           ----YHPKAQILSAWERIK--ALNPDIYFFGEGWDSNQSDFEIASQINLKGTGIGTFSDRLRDAVRGAGV
2fh8A           ----YHPKAQILSAWERIK--ALNPDIYFFGEGWDSNQSDFEIASQINLKGTGIGTFSDRLRDAVRGAGV
2fh6A           ----YHPKAQILSAWERIK--ALNPDIYFFGEGWDSNQSDFEIASQINLKGTGIGTFSDRLRDAVRGAGV
2fgzA           ----YHPKAQILSAWERIK--ALNPDIYFFGEGWDSNQSDFEIASQINLKGTGIGTFSDRLRDAVRGAGV
2bhuA           LAQEIHEL--------------------------------------------------------------
1ehaA           I---------------------------------------------------------------------
1eh9A           I---------------------------------------------------------------------
1smaA           IDHQFWREFRQAV--KALKPDVILGEIWHDAMPWLRGDQFDAVMNYP-----------------------
1gviA           IDHQFWREFRQA----VKALKPDVYILGLIAMPWLRGDQFDAVMNYP-----------------------
2bhzA           LAQEIHEL--------------------------------------------------------------
2bhyA           LAQEIHEL--------------------------------------------------------------
1j0jA           IDHEFWREFRQEV--KALKPDVILGQIWHDAMPWLRGDQFDAVMNYP-----------------------
1j0hA           IDHEF-----------------------------------------------------------------
1wzaA           IFPP-AQYDKNFTWWEKFRQEEEVKPVYLVGEVWDI----------------------------------
1ea9C           VSHQF-----------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3dhuA           VPLDF-----------------------------------------------------------------
1jf6A           VDHAF-----------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1m7xD           MGRENLEAIEFLRNTNRILGEQVSGAVTMVSRPQDMGGLGF--------WYKWNLGWMHDTLDYMKLDPV
1m7xC           IYRENLEAIEFLRNTNRILGEQVSGAVTMVSRPQDMGGLGF--------WYKWNLGWMHDTLDYMKLDPV
1m7xA           MGRENLEAIEFLRNTNRILGEQVSGAVTMVSRPQDMGGLGF--------WYKWNLGWMHDTLDYMKLDPV
1m7xB           M---------------------------------------------------------------------
1wzmA           VDHAF-----------------------------------------------------------------
1wzlA           VDHAF-----------------------------------------------------------------
1wzkA           VDHAF-----------------------------------------------------------------
1g1yA           VDHAF-----------------------------------------------------------------
1bvzA           VDHAF-----------------------------------------------------------------
3dhuB           VPLDF-----------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1vfmA           VDHAF-----------------------------------------------------------------
1vb9A           VDHAF-----------------------------------------------------------------
1jf5A           VDHAF-----------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1ua7A           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
2z1kA           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
1avaA           YSADVAKIDRSEPSFAVAE---------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3bshA           YSPEMAKV--------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           LPELASRISGSSDLYQADGRRPVASINFVTCHDGFTLADLVSYDRKHNEANGEDNRDGTDDNRSWNHGTE
2vuyB           LPEIANRLLGSPDIYLGNNKTPFASINYVTSHDGFTLEDLVSYNQKHNEANGFNNQDGMNENYSWNCGAE
2vuyA           LPEIANRLLGSPDIYLGNNKTPFASINYVTSHDGFTLEDLVSYNQKHNEANGFNNQDGMNENYSWNCGAE
2vr5B           LPEIANRLLGSPDIYLGNNKTPFASINYVTSHDGFTLEDLVSYNQKHNEANGFNNQDGMNENYSWNCGAE
2vr5A           LPEIANRLLGSPDIYLGNNKTPFASINYVTSHDGFTLEDLVSYNQKHNEANGFNNQDGMNENYSWNCGAE
2vncA           LPEIANRLLGSPDIYLGNNKTPFASINYVTSHDGFTLEDLVSYNQKHNEANGFNNQDGMNENYSWNCGAE
2vncB           LPEIANRLLGSPDI---NNKTPFASINYVTSHDGFTLEDLVSYN--HNEANGFNNQDGMNENYSWNCG--
1bf2A           VTQDANDFSGSSNLFQSSGRSPWNSINFIDVHDGMTLKDVYSCNGANNSQAWPPSDGGTSTNYSWDQGMS
2wanA           QVDVIK--NGVIGSIQDFTSAPSETINYVTSHDNMTLWDKI---LASNPSDTEADRIKMDELAH------
2e8yA           HLKATGFALGNGESAQAVMHEPSQSINYVESHDNHTFWDKMSF------ALPQEN-----DSR-------
3faxA           LQGIFKNIKAQPGNFEADS--PGDVVQYIAAHDNLTLHDVIA------KSINKDPKVAEEDIH-------
3fawA           LQGIFKNIKAQPGNFEADS--PGDVVQYIAAHDNLTLHDVIA------KSINKDPKVAEEDIH-------
2fhbA           LPNELTTLSDDQARHLADLTRLGMAGN---------LADFVLIDKDYNGAPGGYAADPTEDNQTLWDMIS
2fh8A           LPNELTTLSDDQARHLADLTRLGMAGN---------LADFVLIDKDYNGAPGGYAADPTEDNQTLWDMIS
2fh6A           LPNELTTLSDDQARHLADLTRLGMAGN---------LADFVLIDKDYNGAPGGYAADPTEDNQTLWDMIS
2fgzA           LPNELTTLSDDQARHLADLTRLGMAGN---------LADFVLIDKDYNGAPGGYAADPTEDNQTLWDMIS
2bhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
1smaA           LADAALRFFAKEDMSASEFADRLMHV-------------LHSYPKQVNEA---------AFNLLGSHDTP
1gviA           LADAALRFFAKEDMSASEFADRLMHV-------------LHSYPKQVNEA---------AFNLLGSHDTP
2bhzA           ----------------------------------------------------------------------
2bhyA           ----------------------------------------------------------------------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1jf6A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1m7xD           ----------------------------------------------------------------------
1m7xC           ----------------------------------------------------------------------
1m7xA           ----------------------------------------------------------------------
1m7xB           ----------------------------------------------------------------------
1wzmA           ----------------------------------------------------------------------
1wzlA           ----------------------------------------------------------------------
1wzkA           ----------------------------------------------------------------------
1g1yA           ----------------------------------------------------------------------
1bvzA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1vfmA           ----------------------------------------------------------------------
1vb9A           ----------------------------------------------------------------------
1jf5A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1ua7A           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
2z1kA           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           GPTTDSAIATLRRRQMRNMLTTLMLSQGVPMLSHGDEIGRTQHGNNNAYCQDNPISWVDWELARRNADLL
2vuyB           GPTNDQNVVICREKQKRNFMITLLVSQGTPMILGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSKFL
2vuyA           GPTNDQNVVICREKQKRNFMITLLVSQGTPMILGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSKFL
2vr5B           GPTNDQNVVICREKQKRNFMITLLVSQGTPMILGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSKFL
2vr5A           GPTNDQNVVICREKQKRNFMITLLVSQGTPMILGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSKFL
2vncA           GPTNDQNVVICREKQKRNFMITLLVSQGTPMILGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSKFL
2vncB           ----DQNVVICREKQKRNFMITLLVSQGTPMILGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSKFL
1bf2A           AGT---GAAVDQRRAARTGMAFEMLSAGTPLMQGGDEYLRTLQCNNNAYNLDSSANWLTYSWTTDQSNFY
2wanA           --------------------AVVFTSQGVPFMQGGEEMLRTKGGNDNSYNAGDSVNQFDWSRKAQFKDVF
2e8yA           -----------KRSRQRLAVAIILLAQGVPFIHSGQEFFRTKQGVENSYQSSDSINQLDWDRRETFKEDV
3faxA           -----------RRLRLGNVM--ILTSQGTAFIHSGQEYGRTKRLLNPDY---------------------
3fawA           -----------RRLRLGNVM--ILTSQGTAFIHSGQEYGRTKRLLNPDY---------------------
2fhbA           YKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNN----
2fh8A           YKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNN----
2fh6A           YKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNN----
2fgzA           YKAAQEADLDTRVRMQAVSLATVMLGQGIAFDQQGSELLRSKSFTRDSYDSGDWFNRVDYSLQDNN----
2bhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
1smaA           RLLT---VCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMT--GGNDPECRKCMV----WDPEKQNKELY
1gviA           RLLT---VCGGDVRKVKLLFLFQLTFTGSPCIYYGDEIGMT--GGNDPECRKCMV----WDPEKQNKELY
2bhzA           ----------------------------------------------------------------------
2bhyA           ----------------------------------------------------------------------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1jf6A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1m7xD           ----------------------------------------------------------------------
1m7xC           ----------------------------------------------------------------------
1m7xA           ----------------------------------------------------------------------
1m7xB           ----------------------------------------------------------------------
1wzmA           ----------------------------------------------------------------------
1wzlA           ----------------------------------------------------------------------
1wzkA           ----------------------------------------------------------------------
1g1yA           ----------------------------------------------------------------------
1bvzA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1vfmA           ----------------------------------------------------------------------
1vb9A           ----------------------------------------------------------------------
1jf5A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1ua7A           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
2z1kA           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           DFVRTLSXXXXXXXXXXXXXXXQGALPGRGKQRDIAWLRPDGTLMEDADWGRGWRALGVFLNGDAITEPD
2vuyB           EFVKKMIQFYRAHPAFRRERYFQGKKLFGMPLKDVTFYTLEGREVDEKTWSSPTQLVIFVLEGSVMDEIN
2vuyA           EFVKKMIQFYRAHPAFRRERYFQGKKLFGMPLKDVTFYTLEGREVDEKTWSSPTQLVIFVLEGSVMDEIN
2vr5B           EFVKKMIQFYRAHPAFRRERYFQGKKLFGMPLKDVTFYTLEGREVDEKTWSSPTQLVIFVLEGSVMDEIN
2vr5A           EFVKKMIQFYRAHPAFRRERYFQGKKLFGMPLKDVTFYTLEGREVDEKTWSSPTQLVIFVLEGSVMDEIN
2vncA           EFVKKM-------------IQFYRAHPAFRRERDVTFYTLEGREVDEKTWSSPTQLVIFVLEGSVMDEIN
2vncB           EFVKKM-------------IQFYRAHPAFRRERDVTFYTLEGREVDEKTWSSPTQLVIFVLEG-------
1bf2A           TFAQRLIAFRKAHPALRPSSWYSGS--------QLTWYQPSGAVADSNYWNNTSNAIAYAINGPSLGD--
2wanA           DYFSSM----------------------------------------------------------------
2e8yA           HYIRRL----------------------------------------------------------------
3faxA           ----------------------------------------------------------------------
3fawA           ----------------------------------------------------------------------
2fhbA           ----------------------------------------------------------------------
2fh8A           ----------------------------------------------------------------------
2fh6A           ----------------------------------------------------------------------
2fgzA           ----------------------------------------------------------------------
2bhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
1smaA           EHVKQL----------------------------------------------------------------
1gviA           EHVKQL----------------------------------------------------------------
2bhzA           ----------------------------------------------------------------------
2bhyA           ----------------------------------------------------------------------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1jf6A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1m7xD           ----------------------------------------------------------------------
1m7xC           ----------------------------------------------------------------------
1m7xA           ----------------------------------------------------------------------
1m7xB           ----------------------------------------------------------------------
1wzmA           ----------------------------------------------------------------------
1wzlA           ----------------------------------------------------------------------
1wzkA           ----------------------------------------------------------------------
1g1yA           ----------------------------------------------------------------------
1bvzA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1vfmA           ----------------------------------------------------------------------
1vb9A           ----------------------------------------------------------------------
1jf5A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1ua7A           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
2z1kA           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           RMGRRIRDDSFLLLLNAGINDVQFTLPGPSYSAAWETVVDTADPEVAGRPYLPAGSDVTVxxxxxxxxxx
2vuyB           MYGERIADDSFLIILNANPNNVKVKFP----KGKWELVISS-----------------------------
2vuyA           MYGERIADDSFLIILNANPNNVKVKFP----KGKWELVISS-----------------------------
2vr5B           MYGERIADDSFLIILNANPNNVKVKFP----KGKWELVISS-----------------------------
2vr5A           MYGERIADDSFLIILNANPNNVKVKFP----KGKWELVISS-----------------------------
2vncA           MYGERIADDSFLIILNANPNNVKVKFP----KGKWELVISS-----------------------------
2vncB           --------DSFLIILNANPNNVKVKFP----KGKWELVISS-----------------------------
1bf2A           -------SNSIYVAYNGWSSSVTFTLPAPPSGTQWYRVTDTCDWNDGASTFVAPGSETLI----------
2wanA           ----------------------------------------------------------------------
2e8yA           ----------------------------------------------------------------------
3faxA           ----------------------------------------------------------------------
3fawA           ----------------------------------------------------------------------
2fhbA           ----------------------------------------------------------------------
2fh8A           ----------------------------------------------------------------------
2fh6A           ----------------------------------------------------------------------
2fgzA           ----------------------------------------------------------------------
2bhuA           ----------------------------------------------------------------------
1ehaA           ----------------------------------------------------------------------
1eh9A           ----------------------------------------------------------------------
1smaA           ----------------------------------------------------------------------
1gviA           ----------------------------------------------------------------------
2bhzA           ----------------------------------------------------------------------
2bhyA           ----------------------------------------------------------------------
1j0jA           ----------------------------------------------------------------------
1j0hA           ----------------------------------------------------------------------
1wzaA           ----------------------------------------------------------------------
1ea9C           ----------------------------------------------------------------------
1lwhA           ----------------------------------------------------------------------
1cygA           ----------------------------------------------------------------------
3dhuA           ----------------------------------------------------------------------
1jf6A           ----------------------------------------------------------------------
2wkgA           ----------------------------------------------------------------------
2wcsA           ----------------------------------------------------------------------
2wc7A           ----------------------------------------------------------------------
1m7xD           ----------------------------------------------------------------------
1m7xC           ----------------------------------------------------------------------
1m7xA           ----------------------------------------------------------------------
1m7xB           ----------------------------------------------------------------------
1wzmA           ----------------------------------------------------------------------
1wzlA           ----------------------------------------------------------------------
1wzkA           ----------------------------------------------------------------------
1g1yA           ----------------------------------------------------------------------
1bvzA           ----------------------------------------------------------------------
3dhuB           ----------------------------------------------------------------------
1cgwA           ----------------------------------------------------------------------
1vfmA           ----------------------------------------------------------------------
1vb9A           ----------------------------------------------------------------------
1jf5A           ----------------------------------------------------------------------
1v3kA           ----------------------------------------------------------------------
1v3jA           ----------------------------------------------------------------------
1uktA           ----------------------------------------------------------------------
1ua7A           ----------------------------------------------------------------------
1pezA           ----------------------------------------------------------------------
1pamA           ----------------------------------------------------------------------
1kckA           ----------------------------------------------------------------------
1d7fA           ----------------------------------------------------------------------
1bagA           ----------------------------------------------------------------------
1uksA           ----------------------------------------------------------------------
1tcmA           ----------------------------------------------------------------------
1pj9A           ----------------------------------------------------------------------
1kclA           ----------------------------------------------------------------------
1cxlA           ----------------------------------------------------------------------
1cgyA           ----------------------------------------------------------------------
1cgvA           ----------------------------------------------------------------------
1cdgA           ----------------------------------------------------------------------
1a47A           ----------------------------------------------------------------------
2z1kA           ----------------------------------------------------------------------
2taaA           ----------------------------------------------------------------------
3bmvA           ----------------------------------------------------------------------
1ot2A           ----------------------------------------------------------------------
1d3cA           ----------------------------------------------------------------------
1eo5A           ----------------------------------------------------------------------
1qhoA           ----------------------------------------------------------------------
1ot1A           ----------------------------------------------------------------------
1dtuA           ----------------------------------------------------------------------
3dc0A           ----------------------------------------------------------------------
2ze0A           ----------------------------------------------------------------------
2guyA           ----------------------------------------------------------------------
1cgxA           ----------------------------------------------------------------------
4cgtA           ----------------------------------------------------------------------
1avaA           ----------------------------------------------------------------------
1g5aA           ----------------------------------------------------------------------
3bshA           ----------------------------------------------------------------------
2aaaA           ----------------------------------------------------------------------
1mvyA           ----------------------------------------------------------------------
1jgiA           ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxx
2vuyB           -------
2vuyA           -------
2vr5B           -------
2vr5A           -------
2vncA           -------
2vncB           -------
1bf2A           -------
2wanA           -------
2e8yA           -------
3faxA           -------
3fawA           -------
2fhbA           -------
2fh8A           -------
2fh6A           -------
2fgzA           -------
2bhuA           -------
1ehaA           -------
1eh9A           -------
1smaA           -------
1gviA           -------
2bhzA           -------
2bhyA           -------
1j0jA           -------
1j0hA           -------
1wzaA           -------
1ea9C           -------
1lwhA           -------
1cygA           -------
3dhuA           -------
1jf6A           -------
2wkgA           -------
2wcsA           -------
2wc7A           -------
1m7xD           -------
1m7xC           -------
1m7xA           -------
1m7xB           -------
1wzmA           -------
1wzlA           -------
1wzkA           -------
1g1yA           -------
1bvzA           -------
3dhuB           -------
1cgwA           -------
1vfmA           -------
1vb9A           -------
1jf5A           -------
1v3kA           -------
1v3jA           -------
1uktA           -------
1ua7A           -------
1pezA           -------
1pamA           -------
1kckA           -------
1d7fA           -------
1bagA           -------
1uksA           -------
1tcmA           -------
1pj9A           -------
1kclA           -------
1cxlA           -------
1cgyA           -------
1cgvA           -------
1cdgA           -------
1a47A           -------
2z1kA           -------
2taaA           -------
3bmvA           -------
1ot2A           -------
1d3cA           -------
1eo5A           -------
1qhoA           -------
1ot1A           -------
1dtuA           -------
3dc0A           -------
2ze0A           -------
2guyA           -------
1cgxA           -------
4cgtA           -------
1avaA           -------
1g5aA           -------
3bshA           -------
2aaaA           -------
1mvyA           -------
1jgiA           -------