[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56010.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3gfyA.bssp"
#ERROR : Can't open dsspfile "3gg0A.bssp"
#ERROR : Can't open dsspfile "3gfzA.bssp"
#ERROR : Can't open dsspfile "3gfxB.bssp"
#ERROR : Can't open dsspfile "3gfxA.bssp"
#ERROR : Can't open dsspfile "3gfyB.bssp"
#ERROR : Can't open dsspfile "1kcxA.bssp"

## Summary of PDB Search
:389
    6e-07  29%  3gfyA  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    1e-06  26%  3gg0A  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    1e-06  26%  3gfzA  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    1e-06  26%  3gfxB  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    1e-06  26%  3gfxA  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    5e-06  30%  3gfyB  [x.x.x] KLEBSIELLA PNEUMONIAE BLRP1
    6e-04  37%  1kcxA  [b.92.1 - c.1.9] DIHYDROPYRIMIDINASE RELATED PROTEIN-1
:389

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3gfyA           ----------------------------------------------------------------------
3gg0A           ----------------------------------------------------------------------
3gfzA           ----------------------------------------------------------------------
3gfxB           ----------------------------------------------------------------------
3gfxA           ----------------------------------------------------------------------
3gfyB           ----------------------------------------------------------------------
1kcxA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxEPLGFLRDTLQRSGRQPRDVTLMVDADLCFLPRDHLVAALA
3gfyA           -----------------------------DAVGWLMDSLLAAGLRPDQVLI----------EDQFRKVLK
3gg0A           -----------------------------DAVGWLMDSLLAAGLRPDQVLIEVTETEVITCFDQFRKVLK
3gfzA           -----------------------------DAVGWLMDSLLAAGLRPDQVLIEVTETEVITCFDQFRKVLK
3gfxB           -----------------------------DAVGWLMDSLLAAGLRPDQVLIEVTETEVITCFDQFRKVLK
3gfxA           -----------------------------DAVGWLMDSLLAAGLRPDQVLIEVTETEVITCFDQFRKVLK
3gfyB           -----------------------------DAVGWLMDSLLAAGLRPDQVLI----EVCF---DQFRKVLK
1kcxA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           RVREMGFRYAFDTARVSPDLLVETAPFLFRIEGSLTSGLPDQEQCAAIVDGMTRIARGAGTFPLASGVTS
3gfyA           ALRVAGMKLAIDLTRFQPDKI--------KVDAELVRDIHISGTKQAIVASVVRCCEDLGITVVAEGVET
3gg0A           ALRVAGMKLAIDAGYSGLSLLTRFQPDKIKVDAELVRDIHISGTKQAIVASVVRCCEDLGITVVAEGVET
3gfzA           ALRVAGMKLAIDAGYSGLSLLTRFQPDKIKVDAELVRDIHISGTKQAIVASVVRCCEDLGITVVAEGVET
3gfxB           ALRVAGMKLAIDAGYSGLSLLTRFQPDKIKVDAELVRDIHISGTKQAIVASVVRCCEDLGITVVAEGVET
3gfxA           ALRVAGMKLAIDAGYSGLSLLTRFQPDKIKVDAELVRDIHISGTKQAIVASVVRCCEDLGITVVAEGVET
3gfyB           ALRVAGMKLAL--TRFQPDKI--------KVDAELVRDIHISGTKQAIVASVVRCCEDLGITVVAEGVET
1kcxA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           IAQLTALRTVGVRMAQGPLFAxxxxxxxxxxxxxxxxxLEPLAPDSGAGLRVSEFMVPAVTMTVEATSEE
3gfyA           LEEWCWLQSVGIRLFQGFLFS-------------------------------------------------
3gg0A           LEEWCWLQSVGIRLFQGFLFS-------------------------------------------------
3gfzA           LEEWCWLQSVGIRLFQGFLFS-------------------------------------------------
3gfxB           LEEWCWLQSVGIRLFQGFLFS-------------------------------------------------
3gfxA           LEEWCWLQSVGIRLFQGFLFS-------------------------------------------------
3gfyB           LEEWCWLQSVGIRLFQGFLFS-------------------------------------------------
1kcxA           --------------------------------------LEVLVQDKG----VNSFQVMAYKDLYQMSDSQ


                         .         *         .         .         .         .         +:350
query           VLEAFSADSALNSVILLDHRERPVAALDRARFLLSITGPYGHALYAKRPAQKLADxxxxxxxxxxxxxxx
3gfyA           ----------------------------------------------------------------------
3gg0A           ----------------------------------------------------------------------
3gfzA           ----------------------------------------------------------------------
3gfxB           ----------------------------------------------------------------------
3gfxA           ----------------------------------------------------------------------
3gfyB           ----------------------------------------------------------------------
1kcxA           LYEAFTFLKGLGAVILVHAENGDLIAQEQKRILMGITGPEGHAL--SRPEELEAE---------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
3gfyA           ---------------------------------------
3gg0A           ---------------------------------------
3gfzA           ---------------------------------------
3gfxB           ---------------------------------------
3gfxA           ---------------------------------------
3gfyB           ---------------------------------------
1kcxA           ---------------------------------------