[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56054.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2nrvA.bssp"
#ERROR : Can't open dsspfile "2nrtA.bssp"
#ERROR : Can't open dsspfile "2nrvB.bssp"
#ERROR : Can't open dsspfile "2nrzB.bssp"
#ERROR : Can't open dsspfile "2nrxB.bssp"
#ERROR : Can't open dsspfile "2nrwA.bssp"
#ERROR : Can't open dsspfile "1yd6D.bssp"
#ERROR : Can't open dsspfile "2nrrA.bssp"
#ERROR : Can't open dsspfile "1yd6A.bssp"
#ERROR : Can't open dsspfile "1yd6B.bssp"
#ERROR : Can't open dsspfile "1yd6C.bssp"
#ERROR : Can't open dsspfile "3c65A.bssp"
#ERROR : Can't open dsspfile "1yd3A.bssp"
#ERROR : Can't open dsspfile "1yd2A.bssp"
#ERROR : Can't open dsspfile "1yczA.bssp"
#ERROR : Can't open dsspfile "1yd5A.bssp"
#ERROR : Can't open dsspfile "1yd4A.bssp"
#ERROR : Can't open dsspfile "1kftA.bssp"
#ERROR : Can't open dsspfile "1x2iA.bssp"
#ERROR : Can't open dsspfile "2bhnC.bssp"
#ERROR : Can't open dsspfile "2bhnB.bssp"
#ERROR : Can't open dsspfile "2bhnA.bssp"
#ERROR : Can't open dsspfile "2bgwB.bssp"
#ERROR : Can't open dsspfile "2bgwA.bssp"

## Summary of PDB Search
:656
    3e-38  49%  2nrvA  [x.x.x] UVRABC SYSTEM PROTEIN C
    3e-38  49%  2nrtA  [x.x.x] UVRABC SYSTEM PROTEIN C
    1e-36  49%  2nrvB  [x.x.x] UVRABC SYSTEM PROTEIN C
    3e-35  49%  2nrzB  [x.x.x] UVRABC SYSTEM PROTEIN C
    1e-33  50%  2nrxB  [x.x.x] UVRABC SYSTEM PROTEIN C
    2e-32  50%  2nrwA  [x.x.x] UVRABC SYSTEM PROTEIN C
    6e-18  45%  1yd6D  [x.x.x] UVRC
    8e-17  50%  2nrrA  [x.x.x] UVRABC SYSTEM PROTEIN C
    1e-16  43%  1yd6A  [x.x.x] UVRC
    4e-16  45%  1yd6B  [x.x.x] UVRC
    5e-16  44%  1yd6C  [x.x.x] UVRC
    2e-14  37%  3c65A  [x.x.x] UVRABC SYSTEM PROTEIN C
    2e-10  43%  1yd3A  [x.x.x] UVRABC SYSTEM PROTEIN C
    2e-10  43%  1yd2A  [x.x.x] UVRABC SYSTEM PROTEIN C
    3e-10  43%  1yczA  [x.x.x] UVRABC SYSTEM PROTEIN C
    6e-10  43%  1yd5A  [x.x.x] UVRABC SYSTEM PROTEIN C
    8e-10  42%  1yd4A  [x.x.x] UVRABC SYSTEM PROTEIN C
    2e-07  46%  1kftA  [a.60.2] EXCINUCLEASE ABC SUBUNIT C
    1e-06  39%  1x2iA  [x.x.x] HEF HELICASE/NUCLEASE
    4e-06  42%  2bhnC  [x.x.x] XPF ENDONUCLEASE
    4e-06  42%  2bhnB  [x.x.x] XPF ENDONUCLEASE
    4e-06  42%  2bhnA  [x.x.x] XPF ENDONUCLEASE
    4e-06  42%  2bgwB  [x.x.x] XPF ENDONUCLEASE
    4e-06  42%  2bgwA  [x.x.x] XPF ENDONUCLEASE
:656

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxVRPTLRPKPGSIPTDPGVYRFRDEHGRVIYVGKAKNLRARLSSYFQDFSALHPRTQTMISTAADVDWT
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
1yd6D           ------LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSY---FTGTHDKTQRLVEEIADFEYI
2nrrA           ----------------------------------------------------------------------
1yd6A           ------LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSY---FTGTHDKTQRLVEEIADFEYI
1yd6B           -------------LPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSY---FTGTHDKTQRLVEEIADFEYI
1yd6C           ------LKEKLAVLPEQPGCYLMKDKHGTVIYVGKAKSLKERVRSY---FTGTHDKTQRLVEEIADFEYI
3c65A           ----------------------------------------------------------------------
1yd3A           --MKEKIRKKILLAPEEPGVYIFKNK-GVPIYIGKAKRLSNRLRSF------LNPQTEKVFEEADELETI
1yd2A           --MKEKIRKKILLAPEEPGVFIFKNK-GVPIYIGKAKRLSNRLRSY------LNPQTEKVFEEADELETI
1yczA           --MKEKIRKKILLAPEEPGVYIFKNK-GVPIYIGKAKRLSNRLRSY------LNPQTEKVFEEADELETI
1yd5A           --MKEKIRKKILLAPEEPGVYIFKNK-GVPIYIGKAKRLSNRLRSY------LNPQTEKVFEEADELETI
1yd4A           --MKEKIRKKILLAPEEPGVYIFKNK-GVPIFIGKAKRLSNRLRSY------LNPQTEKVFEEADELETI
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VVNTEVEALQLEYSWIKEYSPRFNVRYRDDKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
1yd6D           VTSSNAEALILEMNLIKKHDPKYNVMLKDDK---------------------------------------
2nrrA           ----------------------------------------------------------------------
1yd6A           VTSSNAEALILEMNLIKKHDPKYNVMLKD-----------------------------------------
1yd6B           VTSSNAEALILEMNLIKKHDPKYNVMLKD-----------------------------------------
1yd6C           VTSSNAEALILEMNLIKKHDPKYNV---------------------------------------------
3c65A           ----------------------------------------------------------------------
1yd3A           VVMNEREAFILEANLIKKYRPKYNVR--------------------------------------------
1yd2A           VVMNEREAFILEANLIKKYRPKYNVR--------------------------------------------
1yczA           VVMNEREAFILEANLIKKYRPKYNV---------------------------------------------
1yd5A           VVMNEREAFILEANLIKKYRPKYAVR--------------------------------------------
1yd4A           VVMNEREAFILEANLIKKYRPKYNV---------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
1yd6D           ----------------------------------------------------------------------
2nrrA           ----------------------------------------------------------------------
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
1yd6D           ----------------------------------------------------------------------
2nrrA           ----------------------------------------------------------------------
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
2nrvA           ----------------------------------------------------------------------
2nrtA           ----------------------------------------------------------------------
2nrvB           ----------------------------------------------------------------------
2nrzB           ----------------------------------------------------------------------
2nrxB           ----------------------------------------------------------------------
2nrwA           ----------------------------------------------------------------------
1yd6D           ----------------------------------------------------------------------
2nrrA           ----------------------------------------------------------------------
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
3c65A           ----------------------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxPLRIECFDISTLQGEH
2nrvA           ------------------------------------------------------PYRIEGIDISHLQGKY
2nrtA           ------------------------------------------------------PYRIEGIDISHLQGKY
2nrvB           ------------------------------------------------------PYRIEGIDISHLQGKY
2nrzB           ------------------------------------------------------PYRIEGIDISHLQGKY
2nrxB           ------------------------------------------------------PYRIEGIDISHLQGKY
2nrwA           ------------------------------------------------------PYRIEGIDIS-----H
1yd6D           ----------------------------------------------------------------------
2nrrA           ------------------------------------------------------PYRIEGIDISHL---Y
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
3c65A           ------------------------------------------------------PRRIEAFDNSNIYGAD
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           TVASMVVFEDGLARKSEYRRFSIRGAEGADSDVAAMYEVISRRFTRYLEESQRVGELDTLGESGAPQGAE
2nrvA           TVASLVVFEDGFPKKGDYRRYKIE--QDHPDDYESIRTVVKRRYSKHPL---------------------
2nrtA           TVASLVVFEDGFPKKGDYRRYKIE--QDHPDDYESIRTVVKRRYSKHPL---------------------
2nrvB           TVASLVVFEDGFPKKGDYRRYKIE--QDHPDDYESIRTVVKRRYSKHPL---------------------
2nrzB           TVASLVVFEDGFPKKGDYRRYKIE--QDHPDDYESIRTVVKRRYSKHPL---------------------
2nrxB           TVASLVVFEDGFPKKGDYRRYKIE--QDHPDDYESIRTVVKRRYSKHPL---------------------
2nrwA           TVASLVVFEDGFPKKGDYRRYKIE-----QDDYESIRTVVKRRYSKHPL---------------------
1yd6D           ----------------------------------------------------------------------
2nrrA           TVASLVVFEDGFPKKGDYRRYKI-------DDYESIRTVVKRRYSKHPL---------------------
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
3c65A           PVSALVVFLDGKPAKKEYRKYKVKTVAGPNDXXXXXXXXXXXXXXL---------------KEGLPL---
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RKAPRFAYPPNLVVVDGGRPQVAAAQRALDDLGIEDVAVCGLAKRLEEVWLPGEEDPIILPRTSEGLYLL
2nrvA           ---------PNLLFVDGGIGQVNAAIEALKEIG-KDCPVVGLAKKEETVVFENRE--IHLPHDHPVLRLL
2nrtA           ---------PNLLFVDGGIGQVNAAIEALKEIG-KDCPVVGLAKKEETVVFENRE--IHLPHDHPVLRLL
2nrvB           ---------PNLLFVDGGIGQVNAAIEALKEIG-KDCPVVGLAKKEETVVFENRE--IHLPHDHPVLRLL
2nrzB           ---------PNLLFVDGGIGQVNAAIEALKEIG-KDCPVVGLAKKEETVVFENRE--IHLPHDHPVLRLL
2nrxB           ---------PNLLFVDGGIGQVNAAIEALKEIG-KDCPVVGLAE--ETVVFENRE--IHLPHDHPVLRLL
2nrwA           ---------PNLLFVDGGIGQVNAAIEALKEIG-KDCPVVGLAKKEETVVFENRE--IHLPHDHPVLRLL
1yd6D           ----------------------------------------------------------------------
2nrrA           ---------PNLLFVDGGIGQVNAAIEALKEIG-KDCPVVGLAT------VVFENREIHLPHDHPVLRLL
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
3c65A           ---------PDLIIIDGGKGHLSAVRDVLEELGL-DVPLAGLS----ELLAGDPPDVVPLDRQSQEFYLL
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1kftA           ----------------------------------------------------------------------
1x2iA           ----------------------------------------------------------------------
2bhnC           ----------------------------------------------------------------------
2bhnB           ----------------------------------------------------------------------
2bhnA           ----------------------------------------------------------------------
2bgwB           ----------------------------------------------------------------------
2bgwA           ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           QRVRDEAHRFAISYHRRKRAKALTASVLDDIPGLGPVRRAALLKHFGSVRRLAQATAAEIAEVPGIGERT
2nrvA           VQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE--
2nrtA           VQIRDETHRFAVSYHRKRREKESLRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE--
2nrvB           VQIRDETHRFAVSYHRKRREKESLRSVL-DVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE--
2nrzB           VQIRDETHRFAVSYHRES-----LRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE--
2nrxB           VQIRDETHRFAVSYHRSLR------SVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE--
2nrwA           VQIRDETHRFAVSYHRES-----LRSVLDNVPGIGPIRKKKLIEHFGSLENIRSASLEEIARVIGSTE--
1yd6D           ----------------------------------------------------------------------
2nrrA           VQIRDETHRFAVSY--------------------------------------------------------
1yd6A           ----------------------------------------------------------------------
1yd6B           ----------------------------------------------------------------------
1yd6C           ----------------------------------------------------------------------
3c65A           QRIQDEVHRFAV----------------------------------------------------------
1yd3A           ----------------------------------------------------------------------
1yd2A           ----------------------------------------------------------------------
1yczA           ----------------------------------------------------------------------
1yd5A           ----------------------------------------------------------------------
1yd4A           ----------------------------------------------------------------------
1kftA           -------------------------SSLETIEGVGPKRRQMLLKYMGGLQGLRNASVEEIAKVPGISQGL
1x2iA           --------------------------IVEGLPHVSATLARRLLKHFGSVERVFTASVAELMKVEGIGEKI
2bhnC           --------------------------ILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR
2bhnB           --------------------------ILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR
2bhnA           --------------------------ILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR
2bgwB           --------------------------ILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR
2bgwA           --------------------------ILQSFPGIGRRTAERILERFGSLERFFTASKAEISKVEGIGEKR


                         .         +         .         .         .         .         *:700
query           AQTIYERLTSxxxxxxxxxxxxxxxx
2nrvA           --------------------------
2nrtA           --------------------------
2nrvB           --------------------------
2nrzB           --------------------------
2nrxB           --------------------------
2nrwA           --------------------------
1yd6D           --------------------------
2nrrA           --------------------------
1yd6A           --------------------------
1yd6B           --------------------------
1yd6C           --------------------------
3c65A           --------------------------
1yd3A           --------------------------
1yd2A           --------------------------
1yczA           --------------------------
1yd5A           --------------------------
1yd4A           --------------------------
1kftA           AEKIF---------------------
1x2iA           AKEIRRVITA----------------
2bhnC           AEEI----------------------
2bhnB           AEEI----------------------
2bhnA           AEEI----------------------
2bgwB           AEEI----------------------
2bgwA           AEEI----------------------