[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56165.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1ylkA.bssp"
#ERROR : Can't open dsspfile "1g5cA.bssp"
#ERROR : Can't open dsspfile "1g5cF.bssp"
#ERROR : Can't open dsspfile "1g5cB.bssp"
#ERROR : Can't open dsspfile "3eyxA.bssp"
#ERROR : Can't open dsspfile "3e3iL.bssp"
#ERROR : Can't open dsspfile "3e3iJ.bssp"
#ERROR : Can't open dsspfile "3e3iI.bssp"
#ERROR : Can't open dsspfile "3e3iH.bssp"
#ERROR : Can't open dsspfile "3e3iG.bssp"
#ERROR : Can't open dsspfile "3e3iF.bssp"
#ERROR : Can't open dsspfile "3e3iD.bssp"
#ERROR : Can't open dsspfile "3e3iB.bssp"
#ERROR : Can't open dsspfile "3e3iA.bssp"
#ERROR : Can't open dsspfile "3e3gF.bssp"
#ERROR : Can't open dsspfile "3e3gE.bssp"
#ERROR : Can't open dsspfile "3e3gD.bssp"
#ERROR : Can't open dsspfile "3e3gC.bssp"
#ERROR : Can't open dsspfile "3e3gA.bssp"
#ERROR : Can't open dsspfile "3e2wF.bssp"
#ERROR : Can't open dsspfile "3e2wE.bssp"
#ERROR : Can't open dsspfile "3e2wD.bssp"
#ERROR : Can't open dsspfile "3e2wC.bssp"
#ERROR : Can't open dsspfile "3e2wB.bssp"
#ERROR : Can't open dsspfile "3e2wA.bssp"
#ERROR : Can't open dsspfile "3e2aE.bssp"
#ERROR : Can't open dsspfile "3e2aD.bssp"
#ERROR : Can't open dsspfile "3e2aC.bssp"
#ERROR : Can't open dsspfile "3e2aB.bssp"
#ERROR : Can't open dsspfile "3e2aA.bssp"
#ERROR : Can't open dsspfile "3e28F.bssp"
#ERROR : Can't open dsspfile "3e28E.bssp"
#ERROR : Can't open dsspfile "3e28D.bssp"
#ERROR : Can't open dsspfile "3e28C.bssp"
#ERROR : Can't open dsspfile "3e28B.bssp"
#ERROR : Can't open dsspfile "3e28A.bssp"
#ERROR : Can't open dsspfile "3e24B.bssp"
#ERROR : Can't open dsspfile "3e24A.bssp"
#ERROR : Can't open dsspfile "2a8cE.bssp"
#ERROR : Can't open dsspfile "2a8cD.bssp"
#ERROR : Can't open dsspfile "2a8cC.bssp"
#ERROR : Can't open dsspfile "2a8cA.bssp"
#ERROR : Can't open dsspfile "2w8dB.bssp"
#ERROR : Can't open dsspfile "2w8dA.bssp"
#ERROR : Can't open dsspfile "1ekjG.bssp"
#ERROR : Can't open dsspfile "1ekjF.bssp"
#ERROR : Can't open dsspfile "1ekjE.bssp"
#ERROR : Can't open dsspfile "1ekjD.bssp"
#ERROR : Can't open dsspfile "1ekjC.bssp"
#ERROR : Can't open dsspfile "1ekjB.bssp"
#ERROR : Can't open dsspfile "1ekjA.bssp"
#ERROR : Can't open dsspfile "2a5vD.bssp"
#ERROR : Can't open dsspfile "2a5vC.bssp"
#ERROR : Can't open dsspfile "2a5vB.bssp"
#ERROR : Can't open dsspfile "2a5vA.bssp"
#ERROR : Can't open dsspfile "3e3fB.bssp"
#ERROR : Can't open dsspfile "3e31B.bssp"
#ERROR : Can't open dsspfile "3e31A.bssp"
#ERROR : Can't open dsspfile "3e2xB.bssp"
#ERROR : Can't open dsspfile "3e2xA.bssp"
#ERROR : Can't open dsspfile "3e1vA.bssp"
#ERROR : Can't open dsspfile "1ym3A.bssp"

## Summary of PDB Search
:167
    2e-22  36%  1ylkA  [x.x.x] HYPOTHETICAL PROTEIN RV1284/MT1322
    1e-21  38%  1g5cA  [c.53.2] BETA-CARBONIC ANHYDRASE
    1e-20  39%  1g5cF  [c.53.2] BETA-CARBONIC ANHYDRASE
    1e-20  39%  1g5cB  [c.53.2] BETA-CARBONIC ANHYDRASE
    4e-05  37%  3eyxA  [x.x.x] CARBONIC ANHYDRASE
    5e-05  34%  3e3iL  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3iJ  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3iI  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3iH  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3iG  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3iF  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3iD  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3iB  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3iA  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3gF  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3gE  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3gD  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3gC  [x.x.x] CARBONIC ANHYDRASE 2
    5e-05  34%  3e3gA  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2wF  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2wE  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2wD  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2wC  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2wB  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2wA  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2aE  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2aD  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2aC  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2aB  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e2aA  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e28F  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e28E  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e28D  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e28C  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e28B  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e28A  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e24B  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  3e24A  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  2a8cE  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  2a8cD  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  2a8cC  [x.x.x] CARBONIC ANHYDRASE 2
    9e-05  34%  2a8cA  [x.x.x] CARBONIC ANHYDRASE 2
    1e-04  34%  2w8dB  [x.x.x] PROCESSED GLYCEROL PHOSPHATE LIPOTEICHOIC ACID
    1e-04  34%  2w8dA  [x.x.x] PROCESSED GLYCEROL PHOSPHATE LIPOTEICHOIC ACID
    1e-04  35%  1ekjG  [c.53.2] BETA-CARBONIC ANHYDRASE
    1e-04  35%  1ekjF  [c.53.2] BETA-CARBONIC ANHYDRASE
    1e-04  35%  1ekjE  [c.53.2] BETA-CARBONIC ANHYDRASE
    1e-04  35%  1ekjD  [c.53.2] BETA-CARBONIC ANHYDRASE
    1e-04  35%  1ekjC  [c.53.2] BETA-CARBONIC ANHYDRASE
    1e-04  35%  1ekjB  [c.53.2] BETA-CARBONIC ANHYDRASE
    1e-04  35%  1ekjA  [c.53.2] BETA-CARBONIC ANHYDRASE
    2e-04  32%  2a5vD  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-04  32%  2a5vC  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-04  32%  2a5vB  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    2e-04  32%  2a5vA  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
    3e-04  34%  3e3fB  [x.x.x] CARBONIC ANHYDRASE 2
    3e-04  34%  3e31B  [x.x.x] CARBONIC ANHYDRASE 2
    3e-04  34%  3e31A  [x.x.x] CARBONIC ANHYDRASE 2
    3e-04  34%  3e2xB  [x.x.x] CARBONIC ANHYDRASE 2
    3e-04  34%  3e2xA  [x.x.x] CARBONIC ANHYDRASE 2
    4e-04  32%  3e1vA  [x.x.x] CARBONIC ANHYDRASE 2
    6e-04  32%  1ym3A  [x.x.x] CARBONIC ANHYDRASE (CARBONATE DEHYDRATASE)
:167

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxVFDDVLAANEDYVRTFTLAGLQPVAARGLALVTCMDSRIEPLEMLGLKPGDAKILRNAGARVTDDTL
1ylkA           ---VTDDYLANNVDYASGFK-GPLPMPPSKHIAIVACMDARLDVYRMLGIKEGEAHVIRNAGCVVTDDVI
1g5cA           ---IIKDILRENQDF-RFRDLSDLKH--SPKLCIITCMDSRLIDLRALGIGRGDAKVIKNAGNIVDDGVI
1g5cF           -------------------------------LCIITCMDSRLIDLRALGIGRGDAKVIKNAGNIVDDGVI
1g5cB           -------------------------------LCIITCMDSRLIDLRALGIGRGDAKVIKNAGNIVDDGVI
3eyxA           ------DILAANAKWASQMN--NIQPTLFSPHTLIGCSDSRYNE-NCLGVLPGEVFTWKNVACHSEDLTL
3e3iL           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3iJ           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3iI           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3iH           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3iG           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3iF           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3iD           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3iB           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3iA           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3gF           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3gE           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3gD           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3gC           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e3gA           ----------------------------------IACSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2wF           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2wE           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2wD           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2wC           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2wB           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2wA           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2aE           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2aD           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2aC           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2aB           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2aA           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e28F           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e28E           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e28D           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e28C           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e28B           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e28A           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e24B           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
3e24A           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
2a8cE           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
2a8cD           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
2a8cC           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
2a8cA           ----------------------------------IGCSDSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
2w8dB           ----------------------------------------------------------------------
2w8dA           ----------------------------------------------------------------------
1ekjG           ------------------------------------CSDSRVCPSHVLDFQPGEAFVVRNVANLVPPGTG
1ekjF           ------------------------------------CSDSRVCPSHVLDFQPGEAFVVRNVANLVPPGTG
1ekjE           ------------------------------------CSDSRVCPSHVLDFQPGEAFVVRNVANLVPPGTG
1ekjD           ------------------------------------CSDSRVCPSHVLDFQPGEAFVVRNVANLVPPGTG
1ekjC           ------------------------------------CSDSRVCPSHVLDFQPGEAFVVRNVANLVPPGTG
1ekjB           ------------------------------------CSDSRVCPSHVLDFQPGEAFVVRNVANLVPPGTG
1ekjA           ------------------------------------CSDSRVCPSHVLDFQPGEAFVVRNVANLVPPGTG
2a5vD           ---------------------AGQKPTAV----IFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVL
2a5vC           ---------------------AGQKPTAV----IFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVL
2a5vB           ---------------------AGQKPTAV----IFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVL
2a5vA           ---------------------AGQKPTAV----IFGCADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVL
3e3fB           ----------------------------------IGCSDSRAPAEKLTNLEPGELFVHRNVANQVTDNCL
3e31B           ----------------------------------IGCSDSRAPAEKLTNLEPGELFVHRNVANQVTDNCL
3e31A           ----------------------------------IGCSDSRAPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2xB           ----------------------------------IGCSDSRAPAEKLTNLEPGELFVHRNVANQVTDNCL
3e2xA           ----------------------------------IGCSDSRAPAEKLTNLEPGELFVHRNVANQVTDNCL
3e1vA           ----------------------------------IGCSNSRVPAEKLTNLEPGELFVHRNVANQVTDNCL
1ym3A           ------------------------------------CADSRVAAEIIFDQGLGDMFVVRTAGHVIDSAVL


                         .         .         *         .         .         .         .:140
query           RTLVLAVYLLGVNRVIVLPHTGCKMASVSGDEEVHDTIAARYGVDTRSLEFHTDSDQIGALHRDVERIRH
1ylkA           RSLAISQRLLGTREIILLHHTDCGMLTFT-DDDFKRAIQDETGIPTWSPESYPDA--VEDVRQSLRRIEV
1g5cA           RSAAVAIYALGDNEIIIVGHTDCGMARL--DEDLIVSRMRELGVEEEVIEFSIDGDEEENVIEGVKRLKS
1g5cF           RSAAVAIYALGDNEIIIVGHTDCGMARL--DEDLIVSRMRELGVEEEVIEFSIDGDEEENVIEGVKRLKS
1g5cB           RSAAVAIYALGDNEIIIVGHTDCGMARL--DEDLIVSRMRELGVEEEVIEFSIDGDEEENVIEGVKRLKS
3eyxA           KTLEFAIICLKVNKVIICGHTDC-----------------------------------------------
3e3iL           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3iJ           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3iI           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3iH           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3iG           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3iF           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3iD           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3iB           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3iA           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3gF           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3gE           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3gD           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3gC           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e3gA           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2wF           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2wE           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2wD           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2wC           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2wB           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2wA           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2aE           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2aD           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2aC           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2aB           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2aA           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e28F           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e28E           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e28D           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e28C           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e28B           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e28A           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e24B           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e24A           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
2a8cE           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
2a8cD           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
2a8cC           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
2a8cA           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
2w8dB           ---------------------GEKVHKYAGDVDVAPTILHLLGVDTK--DYLSGSDILSKEHREVIPFRN
2w8dA           ---------------------GEKVHKYAGDVDVAPTILHLLGVDTK--DYLSGSDILSKEHREVIPFRN
1ekjG           AAIEYAVLHLKVSNIVVIGHSAC-----------------------------------------------
1ekjF           AAIEYAVLHLKVSNIVVIGHSAC-----------------------------------------------
1ekjE           AAIEYAVLHLKVSNIVVIGHSAC-----------------------------------------------
1ekjD           AAIEYAVLHLKVSNIVVIGHSAC-----------------------------------------------
1ekjC           AAIEYAVLHLKVSNIVVIGHSAC-----------------------------------------------
1ekjB           AAIEYAVLHLKVSNIVVIGHSAC-----------------------------------------------
1ekjA           AAIEYAVLHLKVSNIVVIGHSAC-----------------------------------------------
2a5vD           GSIEYAVTVLNVPLIVVLGHDSC-----------------------------------------------
2a5vC           GSIEYAVTVLNVPLIVVLGHDSC-----------------------------------------------
2a5vB           GSIEYAVTVLNVPLIVVLGHDSC-----------------------------------------------
2a5vA           GSIEYAVTVLNVPLIVVLGHDSC-----------------------------------------------
3e3fB           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e31B           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e31A           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2xB           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e2xA           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
3e1vA           SVVQYAVDVLKIEHIIICGHTNC-----------------------------------------------
1ym3A           GSIEYAVTVLNVPLIVVLGHDSC-----------------------------------------------


                         +         .         .         .         .         *         .:210
query           HPLLPPDLPVMGAIYDVDTGRVTPVxx
1ylkA           NPFVTKHTSLRGFVFDVATGKLNEV--
1g5cA           SPLIPESIGVHGLIIDINTGRLKPL--
1g5cF           SPLIPESIGVHGLIIDINTGRLKPL--
1g5cB           SPLIPESIGVHGLIIDINTGRLKPL--
3eyxA           ---------------------------
3e3iL           ---------------------------
3e3iJ           ---------------------------
3e3iI           ---------------------------
3e3iH           ---------------------------
3e3iG           ---------------------------
3e3iF           ---------------------------
3e3iD           ---------------------------
3e3iB           ---------------------------
3e3iA           ---------------------------
3e3gF           ---------------------------
3e3gE           ---------------------------
3e3gD           ---------------------------
3e3gC           ---------------------------
3e3gA           ---------------------------
3e2wF           ---------------------------
3e2wE           ---------------------------
3e2wD           ---------------------------
3e2wC           ---------------------------
3e2wB           ---------------------------
3e2wA           ---------------------------
3e2aE           ---------------------------
3e2aD           ---------------------------
3e2aC           ---------------------------
3e2aB           ---------------------------
3e2aA           ---------------------------
3e28F           ---------------------------
3e28E           ---------------------------
3e28D           ---------------------------
3e28C           ---------------------------
3e28B           ---------------------------
3e28A           ---------------------------
3e24B           ---------------------------
3e24A           ---------------------------
2a8cE           ---------------------------
2a8cD           ---------------------------
2a8cC           ---------------------------
2a8cA           ---------------------------
2w8dB           GDFISPKTKISGKYYDTKTGK------
2w8dA           GDFISPKTKISGKYYDTKTGK------
1ekjG           ---------------------------
1ekjF           ---------------------------
1ekjE           ---------------------------
1ekjD           ---------------------------
1ekjC           ---------------------------
1ekjB           ---------------------------
1ekjA           ---------------------------
2a5vD           ---------------------------
2a5vC           ---------------------------
2a5vB           ---------------------------
2a5vA           ---------------------------
3e3fB           ---------------------------
3e31B           ---------------------------
3e31A           ---------------------------
3e2xB           ---------------------------
3e2xA           ---------------------------
3e1vA           ---------------------------
1ym3A           ---------------------------