[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56191.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2d1rA.bssp"
#ERROR : Can't open dsspfile "3etcB.bssp"
#ERROR : Can't open dsspfile "2d1sA.bssp"
#ERROR : Can't open dsspfile "2d1tA.bssp"
#ERROR : Can't open dsspfile "1ba3A.bssp"
#ERROR : Can't open dsspfile "3etcA.bssp"
#ERROR : Can't open dsspfile "2vzeA.bssp"
#ERROR : Can't open dsspfile "3c5eA.bssp"
#ERROR : Can't open dsspfile "3b7wA.bssp"
#ERROR : Can't open dsspfile "2v7bA.bssp"
#ERROR : Can't open dsspfile "2d1qA.bssp"
#ERROR : Can't open dsspfile "1mdbA.bssp"
#ERROR : Can't open dsspfile "1ultA.bssp"
#ERROR : Can't open dsspfile "3dayA.bssp"
#ERROR : Can't open dsspfile "3eynA.bssp"
#ERROR : Can't open dsspfile "3eynB.bssp"
#ERROR : Can't open dsspfile "1md9A.bssp"
#ERROR : Can't open dsspfile "3iplA.bssp"
#ERROR : Can't open dsspfile "3iplB.bssp"
#ERROR : Can't open dsspfile "1ultB.bssp"
#ERROR : Can't open dsspfile "1lciA.bssp"
#ERROR : Can't open dsspfile "3dlpX.bssp"
#ERROR : Can't open dsspfile "3cw9A.bssp"
#ERROR : Can't open dsspfile "3cw8X.bssp"
#ERROR : Can't open dsspfile "2qvxX.bssp"
#ERROR : Can't open dsspfile "2p2bB.bssp"
#ERROR : Can't open dsspfile "2p2bA.bssp"
#ERROR : Can't open dsspfile "2p2mB.bssp"
#ERROR : Can't open dsspfile "2p2mA.bssp"
#ERROR : Can't open dsspfile "1v25B.bssp"
#ERROR : Can't open dsspfile "2p2fB.bssp"
#ERROR : Can't open dsspfile "2p2fA.bssp"
#ERROR : Can't open dsspfile "2p2qB.bssp"
#ERROR : Can't open dsspfile "2p2qA.bssp"
#ERROR : Can't open dsspfile "2qvyX.bssp"
#ERROR : Can't open dsspfile "1pg4B.bssp"
#ERROR : Can't open dsspfile "1pg4A.bssp"
#ERROR : Can't open dsspfile "1pg3A.bssp"
#ERROR : Can't open dsspfile "2p20B.bssp"
#ERROR : Can't open dsspfile "2p20A.bssp"
#ERROR : Can't open dsspfile "2p2jB.bssp"
#ERROR : Can't open dsspfile "2p2jA.bssp"
#ERROR : Can't open dsspfile "1t5dX.bssp"
#ERROR : Can't open dsspfile "1v26B.bssp"
#ERROR : Can't open dsspfile "2qvzX.bssp"
#ERROR : Can't open dsspfile "1v26A.bssp"
#ERROR : Can't open dsspfile "1v25A.bssp"
#ERROR : Can't open dsspfile "1nnnB.bssp"
#ERROR : Can't open dsspfile "1nnnA.bssp"
#ERROR : Can't open dsspfile "1t5hX.bssp"
#ERROR : Can't open dsspfile "3ivrA.bssp"
#ERROR : Can't open dsspfile "3ivrB.bssp"
#ERROR : Can't open dsspfile "2vsqA.bssp"
#ERROR : Can't open dsspfile "3iplC.bssp"
#ERROR : Can't open dsspfile "1ry2A.bssp"
#ERROR : Can't open dsspfile "3fceA.bssp"
#ERROR : Can't open dsspfile "1amuB.bssp"
#ERROR : Can't open dsspfile "1amuA.bssp"
#ERROR : Can't open dsspfile "3dhvA.bssp"
#ERROR : Can't open dsspfile "3e7wA.bssp"
#ERROR : Can't open dsspfile "3g7sB.bssp"
#ERROR : Can't open dsspfile "3g7sA.bssp"
#ERROR : Can't open dsspfile "3gqwB.bssp"
#ERROR : Can't open dsspfile "3gqwA.bssp"

## Summary of PDB Search
:515
    9e-49  32%  2d1rA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    4e-48  34%  3etcB  [x.x.x] AMP-BINDING PROTEIN
    4e-48  36%  2d1sA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    6e-48  36%  2d1tA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    9e-48  31%  1ba3A  [x.x.x] LUCIFERASE
    3e-46  34%  3etcA  [x.x.x] AMP-BINDING PROTEIN
    5e-46  31%  2vzeA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL
    5e-46  31%  3c5eA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL
    5e-46  31%  3b7wA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL
    1e-45  34%  2v7bA  [x.x.x] BENZOATE-COENZYME A LIGASE
    3e-45  31%  2d1qA  [x.x.x] LUCIFERIN 4-MONOOXYGENASE
    3e-45  32%  1mdbA  [e.23.1] 2,3-DIHYDROXYBENZOATE-AMP LIGASE
    6e-45  35%  1ultA  [e.23.1] LONG CHAIN FATTY ACID-COA LIGASE
    1e-44  31%  3dayA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A, MITOCHONDRIAL
    8e-44  31%  3eynA  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A
    4e-43  31%  3eynB  [x.x.x] ACYL-COENZYME A SYNTHETASE ACSM2A
    2e-42  31%  1md9A  [e.23.1] 2,3-DIHYDROXYBENZOATE-AMP LIGASE
    2e-42  35%  3iplA  [x.x.x] 2-SUCCINYLBENZOATE--COA LIGASE
    5e-42  35%  3iplB  [x.x.x] 2-SUCCINYLBENZOATE--COA LIGASE
    5e-38  34%  1ultB  [e.23.1] LONG CHAIN FATTY ACID-COA LIGASE
    1e-37  30%  1lciA  [x.x.x] LUCIFERASE
    4e-37  29%  3dlpX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE/SYNTHETASE
    4e-37  29%  3cw9A  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    7e-37  29%  3cw8X  [x.x.x] 4-CHLOROBENZOYL COA LIGASE
    2e-35  29%  2qvxX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE
    2e-35  28%  2p2bB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    2e-35  28%  2p2bA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    3e-35  28%  2p2mB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    3e-35  28%  2p2mA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    4e-35  34%  1v25B  [e.23.1] LONG-CHAIN-FATTY-ACID-COA SYNTHETASE
    4e-35  28%  2p2fB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    4e-35  28%  2p2fA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    5e-35  28%  2p2qB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    5e-35  28%  2p2qA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    7e-35  30%  2qvyX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE
    9e-35  28%  1pg4B  [e.23.1] ACETYL-COA SYNTHETASE
    9e-35  28%  1pg4A  [e.23.1] ACETYL-COA SYNTHETASE
    9e-35  28%  1pg3A  [e.23.1] ACETYL-COA SYNTHETASE
    9e-35  28%  2p20B  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    9e-35  28%  2p20A  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    2e-34  27%  2p2jB  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    2e-34  27%  2p2jA  [x.x.x] ACETYL-COENZYME A SYNTHETASE
    3e-34  29%  1t5dX  [e.23.1] 4-CHLOROBENZOYL COA LIGASE
    5e-34  34%  1v26B  [e.23.1] LONG-CHAIN-FATTY-ACID-COA SYNTHETASE
    1e-33  30%  2qvzX  [x.x.x] 4-CHLOROBENZOATE COA LIGASE/SYNTHETASE
    7e-33  34%  1v26A  [e.23.1] LONG-CHAIN-FATTY-ACID-COA SYNTHETASE
    7e-33  34%  1v25A  [e.23.1] LONG-CHAIN-FATTY-ACID-COA SYNTHETASE
    9e-33  28%  1nnnB  [x.x.x] ACETYL-COA SYNTHETASE
    9e-33  28%  1nnnA  [x.x.x] ACETYL-COA SYNTHETASE
    5e-28  32%  1t5hX  [e.23.1] 4-CHLOROBENZOYL COA LIGASE
    8e-28  30%  3ivrA  [x.x.x] PUTATIVE LONG-CHAIN-FATTY-ACID COA LIGASE
    1e-27  30%  3ivrB  [x.x.x] PUTATIVE LONG-CHAIN-FATTY-ACID COA LIGASE
    1e-27  30%  2vsqA  [x.x.x] SURFACTIN SYNTHETASE SUBUNIT 3
    1e-25  33%  3iplC  [x.x.x] 2-SUCCINYLBENZOATE--COA LIGASE
    9e-25  28%  1ry2A  [e.23.1] ACETYL-COENZYME A SYNTHETASE 1
    3e-23  28%  3fceA  [x.x.x] D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 1
    4e-23  28%  1amuB  [e.23.1] GRAMICIDIN SYNTHETASE 1
    4e-23  28%  1amuA  [e.23.1] GRAMICIDIN SYNTHETASE 1
    2e-22  28%  3dhvA  [x.x.x] D-ALANINE-POLY(PHOSPHORIBITOL) LIGASE
    2e-19  29%  3e7wA  [x.x.x] D-ALANINE--POLY(PHOSPHORIBITOL) LIGASE SUBUNIT 1
    3e-13  41%  3g7sB  [x.x.x] LONG-CHAIN-FATTY-ACID--COA LIGASE (FADD-1)
    4e-13  34%  3g7sA  [x.x.x] LONG-CHAIN-FATTY-ACID--COA LIGASE (FADD-1)
    5e-09  26%  3gqwB  [x.x.x] FATTY ACID AMP LIGASE
    3e-08  26%  3gqwA  [x.x.x] FATTY ACID AMP LIGASE
:515

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xLNLSVLLEDGARNRPERDAIVFGDMRLNYALVNMIANQVANLLVSRGIRPGDKVALACPNVPYFPFVYF
2d1rA           ---------------------------VDYSYAEYLEKSLGKALQNYGLVVDGRIALCSENCEEFFIPVI
3etcB           -----------ARDSPEKLAMIWCDDYGNEKILKYYSDKAANFFVKHGIGKGDYVMLTLKSRYDFWYCML
2d1sA           ----------------------------------------------------------------------
2d1tA           ----------------------------------------------------------------------
1ba3A           ------------------------EVNITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVL
3etcA           -----------ARDSPEKLAMIWCDDYGNEKILKYYSDKAANFFVKHGIGKGDYVMLTLKSRYDFWYCML
2vzeA           ------------------------ELMWNFRELSENSQQAANVLSGAGLQRGDRVAVVLPRVPEWWLVIL
3c5eA           ------------------------ELMWNFRELSENSQQAANVLSGAGLQRGDRVAVVLPRVPEWWLVIL
3b7wA           ------------------------ELMWNFRELSENSQQAANVLSGAGLQRGDRVAVVLPRVPEWWLVIL
2v7bA           ------------------------------------ARRFASALRTLGVHPEERILLVMLDTVALPVAFL
2d1qA           ---------------------------VDYSYAEYLEKSLGKALQNYGLVVDGRIALCSENCEEFFIPVI
1mdbA           ------LLRDRAAKYGDRIAITCGNTHWSYRELDTRADRLAAGFQKLGIQQKDRVVVQLPNIKEFFEVIF
1ultA           --------------------------------------------------------------------YF
3dayA           ------------------------ELMWNFRELSENSQQAANVLSGAGLQRGDRVAVVLPRVPEWWLVIL
3eynA           ------------------------ELMWNFRELSENSQQAANVLSGAGLQRGDRVAVVLPRVPEWWLVIL
3eynB           ------------------------ELMWNFRELSENSQQAANVLSGAGLQRGDRVAVVLPRVPEWWLVIL
1md9A           ------LLRDRAAKYGDRIAITCGNTHWSYRELDTRADRLAAGFQKLGIQQKDRVVVQLPNIKEFFEVIF
3iplA           ----------------------------------------------------------------------
3iplB           ----------------------------------------------------------------------
1ultB           --------------------------------------------------------------------YF
1lciA           ------------------------EVNITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVL
3dlpX           -----------------------------------------------GLRPQQRVAVVAPNSADVVIAIL
3cw9A           -----------------------------------------------GLRPQQRVAVVAPNSADVVIAIL
3cw8X           -----------------------------------------------GLRPQQRVAVVAPNSADVVIAIL
2qvxX           -----------------------------------------------GLRPQQRVAVVAPNSADVVIAIL
2p2bB           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p2bA           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p2mB           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p2mA           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
1v25B           --------------------------------------------------------------------YF
2p2fB           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p2fA           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p2qB           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p2qA           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2qvyX           ----------------------------------------------------------------------
1pg4B           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
1pg4A           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
1pg3A           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p20B           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p20A           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p2jB           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
2p2jA           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
1t5dX           -----------------------------------------------GLRPQQRVAVVAPNSADVVIAIL
1v26B           --------------------------------------------------------------------YF
2qvzX           ----------------------------------------------------------------------
1v26A           --------------------------------------------------------------------YF
1v25A           --------------------------------------------------------------------YF
1nnnB           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
1nnnA           -LNLAACLDRHLQENGDRTAIIWGDKHISYRELHRDVCRFANTLLDLGIKKGDVVAIYMPMVPEAAVAML
1t5hX           ----------------------------------------------------------------------
3ivrA           ---------------PDRTAFMVDGVRLTHRDYLARAERLASGLLRDGVHTGDRVAILSQNCSEMIELIG
3ivrB           ---------------PDRTAFMVDGVRLTHRDYLARAERLASGLLRDGVHTGDRVAILSQNCSEMIELIG
2vsqA           ---LTYWFKEAVNANPDAPALTYSGQTLSYRELDEEANRIARRLQKHGAGKGSVVALYTKRSLELVIGIL
3iplC           ----------------------------------------------------------------------
1ry2A           -----------ALKTPNKKAIIFGDYSITYKELLEEVCQVAQVLTSMGVRKGDTVAVYMPMVPEAIITLL
3fceA           -------IEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
1amuB           ------LFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSIDLFIGIL
1amuA           ------LFEEQVSKRPNNVAIVCENEQLTYHELNVKANQLARIFIEKGIGKDTLVGIMMEKSIDLFIGIL
3dhvA           -------IEKWAAETPDQTAFVWRDAKITYKQLKEDSDALAHWISSEYPDDRSPIMVYGHMQPEMIINFL
3e7wA           --------------------------------------------------------------PHMIVSFL
3g7sB           ----------------------------------------------------------------------
3g7sA           -ISLADRIDAAAEKFGEKTAIISAEPKFNFLEICEVTKKLASGISRKGVRKGEHVGVCIPNSIDYVTIY-
3gqwB           --------------------------QLEYQTLKARAEAGAKRLLSLNLKKGDRVALIAETSSEFVEAFF
3gqwA           --------------------------QLEYQTLKARAEAGAKRLLSLNLKKGDRVALIAETSSEFVEAFF


                         .         .         *         .         .         .         .:140
query           GALKAGAVVVPLNVLLTPREIEYHLRDSGAKALFAFTGTPELPLGERAWQAFQEVAECELYIDLPAAAGA
2d1rA           AGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFSSKGLDXXXXXXXXXXXXXXXXXLDSKVDYRGYQCL
3etcB           GLHKLGAIAVPATHMLKTRDIVYRIEKAGLKMIIAEDDVPE--------QVDEAHAECG---DIPLKAKV
2d1sA           ----------------------------------------------------------------------
2d1tA           ----------------------------------------------------------------------
1ba3A           GALFIGVAVAPANDIYNERELLNSMNISQPTVVF---------VSKKGLQKILNVXXXXXXXXXXXXMDS
3etcA           GLHKLGAIAVPATHMLKTRDIVYRIEKAGLKMIIAEDDVPE--------QVDEAHAECG---DIPLKAKV
2vzeA           GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVAECP---SLRIKLLV
3c5eA           GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVAECP---SLRIKLLV
3b7wA           GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVAECP---SLRIKLLV
2v7bA           GALYAGVVPVVANTLLTPADYVYMLTHSHARAVIASGA-----LVQNVTQAL-ESAGCQLIVSQPL----
2d1qA           AGLFIGVGVAPTNEIYTLRELVHSLGISKPTIVFSSKGLDXXXXXXXXXXXXXXXXXLDSKVDYRGYQCL
1mdbA           ALFRLGALPVFALPSHRSSEITYFCEFAEAAAYIAYSGFDYRSLARQVQSKLPTLKNI-------IVAGE
1ultA           AVPGMGAVLHTANPRLSPKEIAYILNHAEDKVLLFDPNL--LPLVEAIRGELKTVQH---FVVMDEKA--
3dayA           GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVAECP---SLRIKLLV
3eynA           GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVAECP---SLRIKLLV
3eynB           GCIRAGLIFMPGTIQMKSTDILYRLQMSKAKAIVA---------GDEVIQEVDTVAECP---SLRIKLLV
1md9A           ALFRLGALPVFALPSHRSSEITYFCEFAEAAAYIAYSGFDYRSLARQVQSKLPTLKNI-------IVAGE
3iplA           ----------------------------------------------------------------------
3iplB           ----------------------------------------------------------------------
1ultB           AVPGMGAVLHTANPRLSPKEIAYILNHAEDKVLLFDPNL--LPLVEAIRGELKTVQH---FVVMDEKA--
1lciA           GALFIGVAVAPANDIYNERELLNSMNISQPTVVF---------VSKKGLQKILNVXXXXXXXXXXXXMDS
3dlpX           ALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVG--------------RQVADAIFQSGSGARIIF
3cw9A           ALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVG--------------RQVADAIFQSGSGARIIF
3cw8X           ALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVG--------------RQVADAIFQSGSGARIIF
2qvxX           ALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVG--------------RQVADAIFQSGSGARIIF
2p2bB           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p2bA           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p2mB           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGASIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p2mA           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGASIPLKKNVDDALKNVTSVEHVIVLKRT-GS
1v25B           AVPGMGAVLHTANPRLSPKEIAYILNHAEDKVLLFDPNL--LPLVEAIRGELKTVQH---FVVMDEKA--
2p2fB           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p2fA           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p2qB           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p2qA           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2qvyX           ----------------------------------------------------------------------
1pg4B           ACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
1pg4A           ACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
1pg3A           ACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p20B           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p20A           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p2jB           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
2p2jA           ACARIGAVHSVIFGGFSPEAVAGRIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
1t5dX           ALHRLGAVPALLNPRLKSAELAELIKRGEMTAAVIAVG--------------RQVADAIFQSGSGARIIF
1v26B           AVPGMGAVLHTANPRLSPKEIAYILNHAEDKVLLFDPNL--LPLVEAIRGELKTVQH---FVVMDEKA--
2qvzX           ----------------------------------------------------------------------
1v26A           AVPGMGAVLHTANPRLSPKEIAYILNHAEDKVLLFDPNL--LPLVEAIRGELKTVQH---FVVMDEKA--
1v25A           AVPGMGAVLHTANPRLSPKEIAYILNHAEDKVLLFDPNL--LPLVEAIRGELKTVQH---FVVMDEKA--
1nnnB           ACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
1nnnA           ACARIGAVHSVIFGGFSPEAVAGCIIDSSSRLVITVRAGRSIPLKKNVDDALKNVTSVEHVIVLKRT-GS
1t5hX           ----------------------------------------------------------------------
3ivrA           AVALIGAILLPVNYRLNADEIAFVLGDGAPSVVVAGTDYRDIVAGV-----------------LPSLGGV
3ivrB           AVALIGAILLPVNYRLNADEIAFVLGDGAPSVVVAGTDYRDIVAGV-----------------LPSLGGV
2vsqA           GVLKAGAAYLPVDPKLPEDRISYMLADSAAACLLTH-------------QEMKEQAA-----ELPYTG--
3iplC           ----------------------------------------------------------------------
1ry2A           AISRIGAIHSVVFAGFSSNSLRDRINDGDSKVVIT---TDESNRGGKVIEALRETPGVRHVLVYRKTNNP
3fceA           GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRI------VSEDNL----------
1amuB           AVLKAGGAYVPIDIEYPKERIQYILDDSQARMLL--TQKHLVHLIHNQFNGQVEIFE----EDTIKIREG
1amuA           AVLKAGGAYVPIDIEYPKERIQYILDDSQARMLLTQKHLVHLI------HNIQFNGQVEIFEE-------
3dhvA           GCVKAGHAYIPVDLSIPADRVQRIAENSGAKLLLSATAVTVTDLPVRI------VSEDNL----------
3e7wA           GSVKAGHPYIPVDLSIPSERIAKIIESSGAELLIHAAGLSIDAVG----QQIQTVSAEEL-LENEGGSVS
3g7sB           ----------------------------------------------------------------------
3g7sA           ALWRVAATPVPINPYKS-FELEHILNDSEATTLVVHS----------LYENFKPVLEKTXXXXXXXXXXX
3gqwB           ACQYAGLVAVPLAIPSWSAKLQGLLASCQPAAI--ITGDEWLPLVNAATHDNPE---------LHVLSHA
3gqwA           ACQYAGLVAVPLAIPGVGQRDSWSAKLQGLLAAAIITGDEWLPLVNAATHDNPE---------LHVLSHA


                         +         .         .         .         .         *         .:210
query           TTSAIPGAETFWAALNGQPGEFESVRTEGDDVAVIIYTSGTTGQPKGAQLTHTNLLFNAVASSALFDQAP
2d1rA           DT---------FIKRNTPPGSFKTVEVDREQVALIMNSSGSTGLPKGVQLTHENIVTRSHARDPIYGNQV
3etcB           GGDVLEGWIDFRKELEESSPIFEEVSTKNEDICLVYFSSGTAGFPKMVEHDNTYPLGHIL--TAKYWQNV
2d1sA           -----------------QASSFKTVEVDREQVALIMNSSGSTGLPKGVQLTHENIVTRSHARDPIYGNQV
2d1tA           -----------------QASSFKTVEVDREQVALIMNSSGSTGLPKGVQLTHENIVTRSHARDPIYGNQV
1ba3A           KTD-YQGFQSMYTFVTSHPGEYDFVPESFDDKTIALIMNSSTGLPKGVALPHTACVRFSHARDPIFGNQI
3etcA           GGDVLEGWIDFRKELEESSPIFEEVSTKNEDICLVYFSSGTAGFPKMVEHDNTYPLGHIL--TAKYWQNV
2vzeA           SEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGW--TGL
3c5eA           SEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGW--TGL
3b7wA           SEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGW--TGL
2v7bA           -------APLFEELIDXXXXXXXXXXTGCDDIAFWLYS-----KPKGTVHTHANLYWTALYAKPILGIA-
2d1qA           DT---------FIKRNTPPGSFKTVEVDRKEQVALIMNSSL---PKGVQLTHENIVTRSHARDPIYGNQV
1mdbA           AEEFLPLED-----LHTEPVKLPEVKSS--DVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVCWL--
1ultA           -------PXXXXXXXXXXXXXXDPVRVPERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXDGTAL
3dayA           SEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGTSGLPKMAEHSYSSLGLKAKMDAGW--TGL
3eynA           SEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSG--GLPKMAEHSYSSLGLKAKMDAGW--TGL
3eynB           SEKSCDGWLNFKKLLNEASTTHHCVETGSQEASAIYFTSGL---PKMAEHSYSSLGLKAKMDAGW--TGL
1md9A           AEEFLPLED-----LHTEPVKLPEVKSS--DVAFLQLSGGSTGLSKLIPRTHDDYIYSLKRSVEVCWL--
3iplA           -----------------------------DDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
3iplB           -----------------------------DDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
1ultB           -------PXXXXXXXXXXXXXXDPVRVPERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXDGTAL
1lciA           KTD-YQGFQSMYTFVTSHPGDFVPESFDRDKTIALIMNS----LPKGVALPHTACVRFSHARDPIFGNQI
3dlpX           LGDLVRDGEPY---SYGPP--IEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQVGLRH
3cw9A           LGDLVRDGEPY---SYGPP--IEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQVGLRH
3cw8X           LGDLVRDGEPY---SYGPP--IEDPQREPAQPAFIFYTSGTTGLPKAAIIPQRAAESRVLFMSTQVGLRH
2qvxX           LGDLVRDGEPY---SYGPP--IEDPQREPAQPAFIFYTS--TGLPKAAIIPQRAAESRVLFMSTQVGLRH
2p2bB           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p2bA           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p2mB           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p2mA           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
1v25B           -------PXXXXXXXXXXXXXXDPVRVPERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXDGTAL
2p2fB           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p2fA           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p2qB           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p2qA           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2qvyX           ---------------DGEPYSYEDPQREPAQPAFIFYTS--TGLPKAAIIPQRAAESRVLFMSTQVGLRH
1pg4B           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
1pg4A           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
1pg3A           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p20B           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p20A           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p2jB           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
2p2jA           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
1t5dX           LGDLVRDGEPY---SYGPP--IEDPQREPAQPAFIFYTS--TGLPKAAIIPQRAAESRVLFMSTQVGLRH
1v26B           -------PXXXXXXXXXXXXXXDPVRVPERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXDGTAL
2qvzX           ---------------DGEPYSYEDPQREPAQPAFIFYTSGL---PKAAIIPQRAAESRVLFMSTQVGLRH
1v26A           -------PXXXXXXXXXXXXXXDPVRVPERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXDGTAL
1v25A           -------PXXXXXXXXXXXXXXDPVRVPERAACGMAYTTGTTGLPKGVVYXXXXXXXXXXXXXXXDGTAL
1nnnB           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
1nnnA           DIDWQEGRDLWWRDLIEKASEHQPEAMNAEDPLFILYTSGSTGKPKGVHTTGGYLVYAATTFKYVFDYHP
1t5hX           ---------------DGEPYSYEDPQREPAQPAFIFYTSGL---PKAAIIPQ-----RAAESRVLFSTQV
3ivrA           KKAAIGDGSGPFAPFKDLASDFSAPEFGAADGFVIIHTAA--GRPRGALISQGNLL---IAQSSLVDARL
3ivrB           KKAAIGDGSGPFAPFKDLASDFSAPEFGAADGFVIIHTAA--GRPRGALISQGNLL---IAQSSLVDARL
2vsqA           TTLFIDDQTRF-----EEQASDPATAIDPNDPAYIMYTSGTTGKPKGNITTHANILVKHVDYMAFSDQ--
3iplC           -----------------------------DDIASIMFTSGTTGPQKAVPQTFRNHYASAIGCKESLGFDR
1ry2A           SVAFHAPRDLDWATXXXXXXXXPCTPVDSEDPLFLLYTSGSTGAPKGVQHSTAGYLLGALLTMRTFD--T
3fceA           -------KDIFFTHKGNTPNPEHAVK--GDENFYIIYTSG----PKGVQITYNCLVFNLQTGQVFLNQAP
1amuB           TNLHVPSKST--------------------DLAYVIYTN-----PKGTMLEHKGISLNVTEKDRIGQFAS
1amuA           ------------DTIKIREGTNLHVPSKSTDLAYVIYTS-----PKGTMLEHKGISLNVTEKDRIGQFAS
3dhvA           -------KDIFFTHKGNTPNPEHAVK--GDENFYIIYTS-----PKGVQITYNCLVFNLQTGQVFLNQAP
3e7wA           QDQWVKEHETFY----------------------IIYTSGSTGNPKGVQISAANLQFPVSGGKIFLNQAP
3g7sB           ----------------------------------------------------------------------
3g7sA           XNSL--------SEVDSGSEDFENVKVNEEDVALIPYTGGTTG-PKGV-LTH------------------
3gqwB           WFKALPEAD---VALQ---------RPVPNDIAYLQYTSGSTRFPRGVIITHREVANLRAISHDGIKLRP
3gqwA           WFKALPEAD---VALQ---------RPVPNDIAYLQYTSGSTRFPRGVIITHREVANLRAISHDGIKLRP


                         .         .         .         +         .         .         .:280
query           DSHDVFLTVLPLFHIFGQTTMMNAALYRHGTMVLMPRFDGDEALSLMEKEKVTIFAGVPTMYWGLLNAQG
2d1rA           SPGTAVLTVVPFHHGFGMFTTLGYLICGF-RVVMLTKFDEETFLKTLQDYKCTSVILVPTLF-AILNKSE
3etcB           EDDGLHYTVADS----GWGKCVWGKLYGQGCAVFVYDYDRFEAKNMLEKASVTTFCAPPTIYRFLIKEDL
2d1sA           SPGTAVLTVVPFHHGFGMFTTLGYLICGF-RVVMLTKFDEETFLKTLQDYKCTSVILVPTLF-AILNKSE
2d1tA           SPGTAVLTVVPFHHGFGMFTTLGYLICGF-RVVMLTKFDEETFLKTLQDYKCTNVILVPTLF-AILNKSE
1ba3A           IPDTAILSVVPFHHGFGMFTTLGYLICGF-RVVLMYRFEEELFLRSLQDYKIQSALLVPTLF--SFFAKS
3etcA           EDDGLHYTVADS----GWGKCVWGKLYGQGCAVFVYDYDRFEAKNMLEKASVTTFCAPPTIYRFLIKEDL
2vzeA           QASDIMWTILNILCSLMEPWALGACTFVH----LLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQ---
3c5eA           QASDIMWTILNILCSLMEPWALGACTFVH----LLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQ---
3b7wA           QASDIMWTILNILCSLMEPWALGACTFVH----LLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQ---
2v7bA           -ENDVVFSAAKLFFAYGLGNGLTFPLSVGATAILMERPTADAIFARLVEHRPTVFYGVPTLYANMLNLPA
2d1qA           SPGTAVLTVVPFHHGFGMFTTLGYLICGF-RVVMLTKFDEETFLKTLQDYKCTSVILVPTLF-AILNKSE
1mdbA           DHSTVYLAALPMAHNYPLSSPVLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPAMVW-MXXXXX
1ultA           SEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALLESTG
3dayA           QASDIMWTILNILCSLMEPWALGACTFVH----LLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQ---
3eynA           QASDIMWTILNILCSLMEPWALGACTFVH----LLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQ---
3eynB           QASDIMWTILNILCSLMEPWALGACTFVH----LLPKFDPLVILKTLSSYPIKSMMGAPIVYRMLLQ---
1md9A           DHSTVYLAALPAHNYPLSSPGVLGVLYAGGRVVLSPSPSPDDAFPLIEREKVTITALVPPLWXXXXXXXX
3iplA           DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
3iplB           DTN--WLSVLPIYHISGLSVLLRAVIEGF-TVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
1ultB           SEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALLESTG
1lciA           IPDTAILSVVPFHHGFGMFTTLGYLICGF-RVVLMYRFEEELFLRSLQDYKIQSALLVPTLF--SFFAKS
3dlpX           GRHNVVLGLMPLYHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXXX
3cw9A           GRHNVVLGLMPLYHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXXX
3cw8X           GRHNVVLGLMPLYHXXXXXXXXXXXXXXDGTYVVIEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXXX
2qvxX           GRHNVVLGLMPLYHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXXX
2p2bB           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p2bA           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p2mB           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p2mA           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
1v25B           SEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALLESTG
2p2fB           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p2fA           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p2qB           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p2qA           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2qvyX           GRHNVVLGLMPLYHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXXX
1pg4B           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
1pg4A           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
1pg3A           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p20B           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p20A           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p2jB           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
2p2jA           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
1t5dX           GRHNVVLGLMPLYHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXXX
1v26B           SEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALLESTG
2qvzX           GRHNVVLGLMPLYHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTSLFXXXXXXXXXXXXXX
1v26A           SEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALLESTG
1v25A           SEKDVVLPVVPMFHVNAWCLPYAATLVGAKQVLPGPRLDPASLVELFDGEGVTFTAGVPTVWLALLESTG
1nnnB           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
1nnnA           G--DIYWCTADVGWVTGHSYLLYGPLACGATTLMVPNWPTPARMQVVDKHQVNILYTAPTAIRALM-AEG
1t5hX           GRHNVVLG-LPLYHXXXXXXXXXXXXXXDGTYVVVEEFRPVDALQLVQQEQVTLFXXXXXXXXXXXXXXX
3ivrA           TEADVNLGMLPLFHVTGLGLMLTLQ-QAGGASVIAAKFDPAQAARDIEAHKVTVMAEFAPMLGNILDQAA
3ivrB           TEADVNLGMLPLFHVTGLGLMLTLQ-QAGGASVIAAKFDPAQAARDIEAHKVTVMAEFAPMLGNILDQAA
2vsqA           ---DTFLSVXXXXXXXXXXSMLNAA-----RLIIADELDTERLTDLILQENVNVMFAT-TALFNLLTDAG
3iplC           DTN--WLSVLPIYHISGLSVLLRAVI-EGFTVRIVDKFNAEQILTMIKNERITHISLVPTLNW--LMQQG
1ry2A           HQEDVFFTAGDIGWITGHTVVYGPLLYGCATLV----FEGTPAYDIIDEHKVTQFYVAPTAL-RLLKRAG
3fceA           FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFAEMCLMEAS
1amuB           ISFDA--SVWEMF----MALLTGASLY----IILKDTIDFVKFEQYINQKEITVITLPPTYVVHL-----
1amuA           ISFDA--SVWEMF----MALLTGASLY----IILKDTIDFVKFEQYINQKEITVITLPPTYVVHL-----
3dhvA           FSFD-----LSVMDIYPSLVTGGTLWAIDKDMIARPK----DLFASLEQSDIQVWTSTPSFAEMCLMEAS
3e7wA           FSFD--LSVMDLY----------PCLQSGGTLHCVTKDAVNKPKVLFEKSGLNVWTSTPSFVQMCLMDPG
3g7sB           ----------------------------------------------------------------------
3g7sA           ----------------------------------------------------------------------
3gqwB           G--DRCVSWLPFYHLTPVATQLSVDYLRTQDFARPLQW-----LKLISKNRGTVSVAPPFGYELCQRRVN
3gqwA           G--DRCVSWLPFYHLTPVATQLSVDYLRTQDFARPLQW-----LKLISKNRGTVSVAPPFGYELCQRRVN


                         .         *         .         .         .         .         +:350
query           DHDIKQISQTLHTAVSGGASLPAEVARKVKEKFGIEILEGYGLSETSPVVSFNNPKRKAKPGSIGLPIWG
2d1rA           LLNKYDLSNLVEIA-SGGAPLSKEVGEAVARRFNLPVRQGYGLTETTSAIIIT-PEGDDKPGASGKVVPL
3etcB           SH---YNFSTLKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQTETVVTIA-TFPWMEPKPGSIGKPTPG
2d1sA           LLNKYDLSNLVEIA-SGGAPLSKEVGEAVARRFNLPVRQGYGLTETTSAIIIT-PEGDDKPGASGKVVPL
2d1tA           LLNKYDLSNLVEIA-SGGAPLSKEVGEAVARRFNLPVRQGYGLTETTSAIIIT-PEGDDKPGASGKVVPL
1ba3A           TLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPIRQGYGLTETTSAILIT-PEGDDKPGAVGKVVPF
3etcA           NFS------TLKYAVVAGEPLNPEVFNRFLEFTGIKLMEGFGQTETVVTIA-TFPWMEPKPGSIGKPTPG
2vzeA           -QDLSSYKPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETG-LTCMVSKTMKIKPGYMGTAASC
3c5eA           -QDLSSYKPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETG-LTCMVSKTMKIKPGYMGTAASC
3b7wA           -QDLSSYKPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETG-LTCMVSKTMKIKPGYMGTAASC
2v7bA           RADV-----AIRICTSAGEALPREIGERFTAHFGCEILDGIGSTEMLHIF-LSNRAGAVEYGTTGRPVPG
2d1qA           LLNKYDLSNLVEIA-SGGAPLSKEVGEAVARRFNLPVRQGYGLTETTSAIIIT-PEGDDKPGASGKVVPL
1mdbA           XXXXXXXXQVLQV---GGAKFSAEAARRVKAVFGCTLQQVFGMAEGLVNYTRLDDPEEIIVNTQGKPMSP
1ultA           -HRLK----TLRRLVVGGSAAPRSLIARF-ERMGVEVRQGYGLTETSPVVVQNXXXXXXXXXXTGLPIPL
3dayA           -QDLSSYKPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETG-LTCMVSKTMKIKPGYMGTAASC
3eynA           -QDLSSYKPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETG-LTCMVSKTMKIKPGYMGTAASC
3eynB           -QDLSSYKPHLQNCVTVGESLLPETLENWRAQTGLDIRESYGQTETG-LTCMVSKTMKIKPGYMGTAASC
1md9A           XXXXXQVLQV------GGAKFSAEAARRVKAVFGCTLQQVFGAEGLVNYTRLDDPE-EIIVNTQGKPSPY
3iplA           LHEPYNLQKIL----LGGAKLSATMIETALQ-YNLPIYNSFGMTETCSQFLTATPEMHARPDTVGMPSAN
3iplB           LHEPYNLQKIL----LGGAKLSATMIETALQ-YNLPIYNSFGMTETCSQFLTATPEMHARPDTVGMPSAN
1ultB           -HRLK----TLRRLVVGGSAAPRSLIARF-ERMGVEVRQGYGLTETSPVVVQNXXXXXXXXXXTGLPIPL
1lciA           TLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPIRQGYGLTETTSAILIT----PEGPGAVGKVVPF
3dlpX           XXGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQPKT----GTEMAPGFF
3cw9A           XXGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQPKT----GTEMAPGFF
3cw8X           XXGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQPKT----GTEMAPGFF
2qvxX           XXGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNGYGTTEAMNSLYMRQPKT----GTEMAPGFF
2p2bB           DKAIEGTDRSLRILGSAGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p2bA           DKAIEGTDRSLRILGSAGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p2mB           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p2mA           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
1v25B           -HRLK----TLRRLVVGGSAAPRSLIARF-ERMGVEVRQGYGLTETSPVVVQNXXXXXXXXXXTGLPIPL
2p2fB           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p2fA           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p2qB           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p2qA           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2qvyX           XXGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNGYGTTEAMNSLYMRQPKT----GTEMAPGFF
1pg4B           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
1pg4A           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
1pg3A           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p20B           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p20A           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p2jB           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
2p2jA           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
1t5dX           XXGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNIYGTTEAMNSLYMRQPKT----GTEMAPGFF
1v26B           -HRLK----TLRRLVVGGSAAPRSLIARF-ERMGVEVRQGYGLTETSPVVVQNXXXXXXXXXXTGLPIPL
2qvzX           XXGSSLKLDSLRHVTFAGATMPDAVLETVHQHLPGEKVNAYGTTEAMNSLYMRQPKT----GTEMAPGFF
1v26A           -HRLK----TLRRLVVGGSAAPRSLIARF-ERMGVEVRQGYGLTETSPVVVQNXXXXXXXXXXTGLPIPL
1v25A           -HRLK----TLRRLVVGGSAAPRSLIARF-ERMGVEVRQGYGLTETSPVVVQNXXXXXXXXXXTGLPIPL
1nnnB           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
1nnnA           DKAIEGTDRSLRILGSVGEPINPEAWEWYWKKIGKEVVDTWWQTETGGFMITPLPGAELKAGSATRPFFG
1t5hX           XGSSLKLDSLRHVTFAGAT--PDAVLETVHQHLPGEKVNIYGTTEA------NSLYRQPKTGTEA-PGFF
3ivrA           PAQLASLRAVT------GLDTPETIERFEATCPNATFWATFGQSETSGLSTFA-PYRD-RPKSAGRPLFW
3ivrB           PAQLASLRAVT------GLDTPETIERFEATCPNATFWATFGQSETSGLSTFA-PYRD-RPKSAGRPLFW
2vsqA           EDWMK----GLRCILFGGERASVPHVRKALRIMGPKLINCYGPTETAHVVHDLPDSISSLP--IGKPISN
3iplC           LHE----PYNLQKILLGGAKLSATMIETALQ-YNLPIYNSFGMTETSQFLTATPEMLHARPDTVGMPSAN
1ry2A           DSYIENHSKSLRCLGSVGEPIAAEVWEWYSEKIGIPIVDTYWQTESGSVTPLAGGVTPMKPGSASFPFFG
3fceA           FSE--SMLPNMKTFLFCGEVLPNEVARKLIERFPATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGY
1amuB           --DPERIL-SIQTLITAGSATSPSLVNKWKEK--VTYINAYGPTETTICATTWVATKETIGHSIGAPIQN
1amuA           --DPERIL-SIQTLITAGSATSPSLVNKWKEK--VTYINAYGPTETTICATTWVATKETIGHSIGAPIQN
3dhvA           FSE--SMLPNMKTFLFCGEVLPNEVARKLIERFPATIMNTYGPTEATVAVTGIHVTEEVLDQYKSLPVGY
3e7wA           FS--QDLLPHADTFMFCGEVLPVSVAKALLERFKAKIFNTYGPTEATVAVTTNDVISRSESLPVGFAKPD
3g7sB           -------------------------------------------TEACPVTT-NPPLRLDKSTTQGVPS-D
3g7sA           -------------------------------------------TEACPVTT-NPPLRLDKSTTQGVPS-D
3gqwB           EKDLAELDLSCRVAGIGAEPISAEQLHQFAENFDNKTFPCYGLAENALAVSFSDEASGVVVNEVDRDILG
3gqwA           EKDLAELDLSCRVAGIGAEPISAEQLHQFAENFDNKTFPCYGLAENALAVSFSDEASGVVVNEVDRDILG


                         .         .         .         .         *         .         .:420
query           VEMKLVDENFNTIEGEGPGEIAVRGHCVMKGYHNRPEANAQVMRDGWFRTGDIARRDEEGFYFIIDRSKD
2d1rA           FKAKVID--LDTKKSLGPGEVCVKGPMLMKGYVNNPEATKELIEEGWLHTGDIGYYDEEKHFFIVDRLKS
3etcB           YKIELMDRDGRLCEVGEEGEIVIN---TMEGYGKDPERTEETWHDGYYHTGDMAWMDEDGYLWFVGRADD
2d1sA           FKAKVID--LDTKKSLGPGEVCVKGPMLMKGYVNNPEATKELIEEGWLHTGDIGYYDEEKHFFIVDRLKS
2d1tA           FKAKVID--LDTKKSLGPGEVCVKGPMLMKGYVNNPEATKELIEEGWLHTGDIGYYDEEKHFFIVDRLKS
1ba3A           FEAKVVDDTGKTLGVNQRGELCVRGPMIMSGYVNNPEANALIDKDGWLHSGDIAYWDEDEHFFIVDRLKS
3etcA           YKIELMDRDGRLCEVGEEGEIVIN---TMEGYGKDPERTEETWHDGYYHTGDMAWMDEDGYLWFVGRADD
2vzeA           YDVQIIDDKGNVLPPGTEGDIGIRVKPIFSGYVDNPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADD
3c5eA           YDVQIIDDKGNVLPPGTEGDIGIRVKPIFSGYVDNPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADD
3b7wA           YDVQIIDDKGNVLPPGTEGDIGIRVKPIFSGYVDNPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADD
2v7bA           YEIELRDEAGHAVPDGEVGDLYIKGPSAAVMYWNNREKSRATFLGEWIRSGDKYCRLPNGCYVYAGRSDD
2d1qA           FKAKVID--LDTKKSLGPGEVCVKGPMLMKGYVNNPEATKELIEEGWLHTGDIGYYDEEKHFFIVDRLKS
1mdbA           YESRVWDDHDRDVKPGETGHLLTRGPYTIRGYYKAEEHNASFTEDGFYRTGDIVRLTRDGYIVVEGRAKD
1ultA           VRLRVADEEGRPVDGKALGEVQLKGPWITGGYYGNEEATRSALTDGFFRTGDIAVWDEEGYVEIKDRLKD
3dayA           YDVQIIDDKGNVLPPGTEGDIGIRVKPIFSGYVDNPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADD
3eynA           YDVQIIDDKGNVLPPGTEGDIGIRVKPIFSGYVDNPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADD
3eynB           YDVQIIDDKGNVLPPGTEGDIGIRVKPIFSGYVDNPDKTAANIRGDFWLLGDRGIKDEDGYFQFMGRADD
1md9A           DESRVWDDHDRDVKPGETGHLLTRGPYTIRGYYKAEEHNASFTEDGFYRTGDIVRLTRDGYIVVEGRAKD
3iplA           VDVKIKNPN-----KEGHGELMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKD
3iplB           VDVKIKNPN-----KEGHGELMIKGANVMNGYLY-PTDLTGTFENGYFNTGDIAEIDHEGYVMIYDRRKD
1ultB           VRLRVADEEGRPVDGKALGEVQLKGPWITGGYYGNEEATRSALTDGFFRTGDIAVWDEEGYVEIKDRLKD
1lciA           FEAKVVDDTGKTLGVNQRGELCVRGPMIMSGYVNNPEANALIDKDGWLHSGDIAYWDEDEHFFIV-----
3dlpX           SEVRIVRIGGGVDEIVANGEIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVPD
3cw9A           SEVRIVRIGGGVDEIVANGEIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
3cw8X           SEVRIVRIGGGVDEIVANGEIVAASDSAFVGYLNQPEATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
2qvxX           SEVRIVRIGGGVDEIVANGEIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
2p2bB           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p2bA           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p2mB           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p2mA           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
1v25B           VRLRVADEEGRPVDGKALGEVQLKGPWITGGYYGNEEATRSALTDGFFRTGDIAVWDEEGYVEIKDRLKD
2p2fB           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p2fA           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p2qB           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p2qA           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2qvyX           SEVRIVRIGGGVDEIVANGEIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
1pg4B           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
1pg4A           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
1pg3A           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p20B           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p20A           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p2jB           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
2p2jA           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
1t5dX           SEVRIVRIGGGVDEIVANGEIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
1v26B           VRLRVADEEGRPVDGKALGEVQLKGPWITGGYYGNEEATRSALTDGFFRTGDIAVWDEEGYVEIKDRLKD
2qvzX           SEVRIVRIGGGVDEIVANGEIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
1v26A           VRLRVADEEGRPVDGKALGEVQLKGPWITGGYYGNEEATRSALTDGFFRTGDIAVWDEEGYVEIKDRLKD
1v25A           VRLRVADEEGRPVDGKALGEVQLKGPWITGGYYGNEEATRSALTDGFFRTGDIAVWDEEGYVEIKDRLKD
1nnnB           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
1nnnA           VQPALVDNEGHPQEGATEGNLVITDSWTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDD
1t5hX           SEVRIVRIGGGVDEIVANGEIVAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDD
3ivrA           RTVAVVDAEDRPLPPGEVGEIVLRGPTVFKGYWNNAAATQHAFRNGWHHTGDMGRFDADGYLFYAGRA--
3ivrB           RTVAVVDAEDRPLPPGEVGEIVLRGPTVFKGYWNNAAATQHAFRNGWHHTGDMGRFDADGYLFYAGR---
2vsqA           ASVYILNEQSQLQPFGAVGELCISGMGVSKGYVNRADLTKEKFIENPFRTGDLARWLPDGTIEYAGRIDD
3iplC           VDVKIKNPN-----KEGHGELMIKGANVMNGY-LYPTDLTGTFENGYFNTGDIAEIDHEGYVMIYD----
1ry2A           IDAVVLDEELNTSHAE--GVLAVKARTIWKN-HDRYLDTYLNPYPGYYFTGDGAAKDKDGYIWILGRVDD
3fceA           CKSDLIMKEDGTIAPDGEGEIVIVGPSVSVGYLGSPELTAFTMIDGEYKTGD-AGYVENGLLFYNGRLDF
1amuB           TQIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKFVDNPFKTGDQARWLSDGNIEYLGRIDN
1amuA           TQIYIVDENLQLKSVGEAGELCIGGEGLARGYWKRPELTSQKFVDNPFKTGDQARWLSDGNIEYLGRIDN
3dhvA           CKSDLIMKEDGTIAPDGEGEIVIVGPSVSVGYLGSPELTAFTMIDGEYKTGD-AGYVENGLLFYNGRLDF
3e7wA           MNIFIMDEEGQPLPEGEKGEIVIAGPSVSRGYLGEPELTEKAFEGQWYRTGD-AGFIQDGQIFCQGRLDF
3g7sB           IELKVISLEDGRELGVGEGEIVIRGPNIFKGYWKREKENQECWGRKFFRTGDVGFIDEEGFLHFQDRVK-
3g7sA           IELKVISLEDGRELGVGEGEIVIRGPNIFKGYWKREKENQECWGRKFFRTGDVGFIDEEGFLHFQDR---
3gqwB           AETRAVSTFVNEIRNEGPVAERVVGHICISGPSLSGYFGDQVSQDXXXXXXXXXXXXXXXXXXXXXRIKD
3gqwA           AETRAVSTFVNEIRNEGPVAERVVGHICISGPSLSGYFGDQVSQDXXXXXXXXXXXXXXXXXXXXXRIKD


                         .         .         +         .         .         .         .:490
query           MIIRGGYNVYPREIEEVLMTHPQVSLAAVVGVPHDTHGEEIKAFVIPAEGATLTEDELIAWAKERLAAYK
2d1rA           LIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNMTEKEVMDYVASQVSNAK
3etcB           IIKTSGYKVGPFEVESALIQHPAVLECAITGVPDPVRGQVIKATIVLTKDYTPSDNELQDHVKNVTAPYK
2d1sA           LIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNMTEKEVMDYVASQVSNAK
2d1tA           LIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNMTEKEVMDYVASQVSNAK
1ba3A           LIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYASQVTTAKK
3etcA           IIKTSGYKVGPFEVESALIQHPAVLECAITGVPDPVRGQVIKATIVLTKDYTPSDNELQDHVKNVTAPYK
2vzeA           IINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLADPEQLTK-ELQQHVKSVTAPYK
3c5eA           IINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLADPEQLTK-ELQQHVKSVTAPYK
3b7wA           IINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLADPEQLTK-ELQQHVKSVTAPYK
2v7bA           ML----KYVSPVEVEMVLVQHDAVLEAAVVGVDHGGL-VKTRAFVVPSE---ILAEELKAFVKDRLAPHK
2d1qA           LIKYKGYQVPPAELESVLLQHPSIFDAGVAGVPDPVAGELPGAVVVLESGKNMTEKEVMDYVASQVSNAK
1mdbA           QINRGGEKVAAEEVENHLLAHPAVHDAAMVSMPDQFLGERSCVFIIPRDEAPKAA-ELKAFLRERLAAYK
1ultA           LIKSGGEWISSVDLENALMGHPKVKEAAVVAIPHPKWQERPLAVVVP-RGEKPTPEELNELLKAGFAKWQ
3dayA           IINSSGYRIGPSEVENALMEHPAVVETAVISSP--DRGEVVKAFVVLADPEQLTK-ELQQHVKSVTAPYK
3eynA           IINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLADPEQLTK-ELQQHVKSVTAPYK
3eynB           IINSSGYRIGPSEVENALMEHPAVVETAVISSPDPVRGEVVKAFVVLADPEQLTK-ELQQHVKSVTAPYK
1md9A           QINRGGEKVAAEEVENHLLAHPAVHDAAV--SPDQFLGERSCVFIIPRDEAPKAA-ELKAFLRERLAAYK
3iplA           LIISGGENIYPYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSKHLAKYK
3iplB           LIISGGENIYPYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFV--SESDISKAQLIAYLSKHLAKYK
1ultB           LIKSGGEWISSVDLENALMGHPKVKEAAVVAIPH------------------------------------
1lciA           LIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYASQVTTAKK
3dlpX           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDTFCRSELADFK
3cw9A           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDTFCRSELADFK
3cw8X           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLA-DQWGQSVTACVVPRLGETLSADALDTFCRSELADFK
2qvxX           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDTFCRSELADFK
2p2bB           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
2p2bA           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
2p2mB           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
2p2mA           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
1v25B           LIKSGGEWISSVDLENALMGH-----AAVVAIPH------------------------------------
2p2fB           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
2p2fA           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
2p2qB           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVEKEIGPLA
2p2qA           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVEKEIGPLA
2qvyX           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDTFCRSELADFK
1pg4B           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
1pg4A           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
1pg3A           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
2p20B           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVAKEIGPLA
2p20A           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVAKEIGPLA
2p2jB           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
2p2jA           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
1t5dX           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDTFCRSELADFK
1v26B           LIKSGGEWISSVDLE---------NAAAVVAIPHPKWQERPLA-VTPEE---LNEHLL----KAGFAKWQ
2qvzX           MIISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDTFCRSELADFK
1v26A           LIKSGGEWISSVDLEN----------AAVVAIPHPKWQERPLAVV-------------------------
1v25A           LIKSGGEWISSVDLEN----------AAVVAIPHPKWQERPLAVV-------------------------
1nnnB           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
1nnnA           VLNVSGHRLGTAEIESALVAHPKIAEAAVVGIPHAIKGQAIYAYVTLNHGEEPSPEEVRNWVRKEIGPLA
1t5hX           -IISGGENIHPSEIERVLGTAPGVTEVVVIGLADQRWGQSVTACVVPRLGETLSADALDTFCRSELADFK
3ivrA           ----------------------------------------------------------------------
3ivrB           ----------------------------------------------------------------------
2vsqA           QVKIRGHRXXXXXXXXXXXXYPGVKDAVVVADRHESGDASINAYLV--NRTQLSAEDVKAHLKKQLPAYM
3iplC           ----------------------------------------------------------------------
1ry2A           VVNVSGHRLSTXXXXXXXXXXXXXXXCAVVGFNDDLTGQAVAAFVVLK--LQDIKKHLVFTVRKDIGPFA
3fceA           QIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKERLPNYM
1amuB           QVKIRGHRVELEEVESILLKHMYISETAV--SVHKDHQEQLCAYFVSEKHIPL--EQLRQFSSEELPTYM
1amuA           QVKIRGHRVELEEVESILLKHMYISETAV--SVHKDHQEQLCAYFVSEKHIPL--EQLRQFSSEELPTYM
3dhvA           QIKLHGYRMELEEIEHHLRACSYVEGAVIVPIKKGEKYDYLLAVVVPGEHSFEKEFKLTSAIKERLPNYM
3e7wA           QIKLHGYRMELEEIEFHVRQSQYVRSAVV--IPYQPNGEYLIAAIVPEEHEFEKEFQLTSAIKKELAAYM
3g7sB           ----------PFEL-EALLKHEAVDV-AVIGKPVP------KAFIVPEYRGKVDEEDIIEWVRERIS---
3g7sA           ---------VPFEL-EALLKHEAVDV-AVIGKP------DPKAFIVPEYRGKVDEEDIIEWVRERIS---
3gqwB           LIIIRGRNIWPQDIEYIAEQEPEI----------------------------------------------
3gqwA           LIIIRGRNIWPQDIEYIAEQEPEI----------------------------------------------


                         *         .         .         .         .         +         .:560
query           YPRIVEFRTELPMTATGKILKRELR
2d1rA           RLRGVRFVDEVPKGLTGKIDGRAIR
3etcB           YPRIIEFVPELP-------------
2d1sA           RLRGVRFVDEVPKGLTGKIDGRAIR
2d1tA           RLRGVRFVDEVPKGLTGKIDGRAIR
1ba3A           LRGGVVFVDEVPKGLTGKLDARKIR
3etcA           YPRIIEFVPE---------------
2vzeA           YPRKIEFVLNLPKTVTGKIQRAKLR
3c5eA           YPRKIEFVLNLPKTVTGKIQRAKLR
3b7wA           YPRKIEFVLNLPKTVTGKIQRAKLR
2v7bA           YPRDIVFVDDLPKTATGKIQRFKLR
2d1qA           RLRGVRFVDEVPKGLTGKIDGRAIR
1mdbA           IPDRVEFVESFPQTGVGKVSKKALR
1ultA           LPDAYVFAEEIPRTSAGKFLKRALR
3dayA           YPRKIEFVLNLPKTVTGKIQRAKLR
3eynA           YPRKIEFVLNLPKTVTGKIQRAKLR
3eynB           YPRKIEFVLNLPKTVTGKIQRAKLR
1md9A           IPDRVEFVESFPQTGVGKVSKKALR
3iplA           VPKHFEKVDTLP-------------
3iplB           VPKHFE-------------------
1ultB           -------------------------
1lciA           LRGGVVFVDEVPKLDARKI------
3dlpX           RPKRYFILDQLPKNALNKVLRRQL-
3cw9A           RPKRYFILDQLPKNALNKVLRRQL-
3cw8X           RPKRYFILDQLPKNALNKVLRRQL-
2qvxX           RPKRYFILDQLPKNALNKVLRRQL-
2p2bB           TPDVLHWTDSLPKTRSGKIMRRILR
2p2bA           TPDVLHWTDSLPKTRSGKIMRRILR
2p2mB           TPDVLHWTDSLPKTRSGKIMRRILR
2p2mA           TPDVLHWTDSLPKTRSGKIMRRILR
1v25B           -------------------------
2p2fB           TPDVLHWTDSLPKTRSGKIMRRILR
2p2fA           TPDVLHWTDSLPKTRSGKIMRRILR
2p2qB           TPDVLHWTDSLPKTRSGKIMRRILR
2p2qA           TPDVLHWTDSLPKTRSGKIMRRILR
2qvyX           RPKRYFILDQLPKNALNKVLRRQL-
1pg4B           TPDVLHWTDSLPKTRSGKIMRRILR
1pg4A           TPDVLHWTDSLPKTRSGKIMRRILR
1pg3A           TPDVLHWTDSLPKTRSGKIMRRILR
2p20B           TPDVLHWTDSLPKTRSGKIMRRILR
2p20A           TPDVLHWTDSLPKTRSGKIMRRILR
2p2jB           TPDVLHWTDSLPKTRSGAIMRRILR
2p2jA           TPDVLHWTDSLPKTRSGAIMRRILR
1t5dX           RPKRYFILDQLPKNALNKVLRRQL-
1v26B           LPDAYVFAEEIPRT-----------
2qvzX           RPKRYFILDQLPKNALNKVLRRQL-
1v26A           -------------------------
1v25A           -------------------------
1nnnB           TPDVLHWTDSLPKTRSG-IMRRILR
1nnnA           TPDVLHWTDSLPKTRSG-IMRRILR
1t5hX           RPKRYFILDQLPKNALNKVLRRQL-
3ivrA           -------------------------
3ivrB           -------------------------
2vsqA           VPQTFTFLDELPLTTNGKVNKRLL-
3iplC           -------------------------
1ry2A           APKLIILVDDLPKTRSGKIMRRILR
3fceA           IPRKFMYQSSIPMTPNGKVDRKKL-
1amuB           IPSYFIQLDKMPLTSNGKIDRKQL-
1amuA           IPSYFIQLDKMPLTSNGKIDRKQL-
3dhvA           IPRKFMYQSSIPMTPNGKVDRKKL-
3e7wA           IPRKFIYQDHIQMTANGKIDRKRI-
3g7sB           --REVEFVEELP-------------
3g7sA           --REVEFVEELP-------------
3gqwB           -------------------------
3gqwA           -------------------------