[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56286.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1bkgA.bssp"
#ERROR : Can't open dsspfile "1b5oA.bssp"
#ERROR : Can't open dsspfile "1b5pA.bssp"
#ERROR : Can't open dsspfile "1bjwA.bssp"
#ERROR : Can't open dsspfile "1gc3A.bssp"
#ERROR : Can't open dsspfile "5bj3A.bssp"
#ERROR : Can't open dsspfile "5bj4A.bssp"
#ERROR : Can't open dsspfile "1j32A.bssp"
#ERROR : Can't open dsspfile "1djuB.bssp"
#ERROR : Can't open dsspfile "1djuA.bssp"
#ERROR : Can't open dsspfile "1gd9A.bssp"
#ERROR : Can't open dsspfile "1o4sB.bssp"
#ERROR : Can't open dsspfile "1o4sA.bssp"
#ERROR : Can't open dsspfile "1xi9C.bssp"
#ERROR : Can't open dsspfile "1xi9A.bssp"
#ERROR : Can't open dsspfile "1xi9B.bssp"
#ERROR : Can't open dsspfile "1v2eB.bssp"
#ERROR : Can't open dsspfile "1v2eA.bssp"
#ERROR : Can't open dsspfile "1v2dA.bssp"
#ERROR : Can't open dsspfile "1bw0B.bssp"
#ERROR : Can't open dsspfile "1bw0A.bssp"
#ERROR : Can't open dsspfile "1w7nA.bssp"
#ERROR : Can't open dsspfile "1w7lA.bssp"
#ERROR : Can't open dsspfile "1u08B.bssp"
#ERROR : Can't open dsspfile "1u08A.bssp"
#ERROR : Can't open dsspfile "2z1zA.bssp"
#ERROR : Can't open dsspfile "3ei7B.bssp"
#ERROR : Can't open dsspfile "3ei7A.bssp"
#ERROR : Can't open dsspfile "3ei6B.bssp"
#ERROR : Can't open dsspfile "3ei6A.bssp"
#ERROR : Can't open dsspfile "3dydB.bssp"
#ERROR : Can't open dsspfile "3dydA.bssp"
#ERROR : Can't open dsspfile "3b46B.bssp"
#ERROR : Can't open dsspfile "3b46A.bssp"
#ERROR : Can't open dsspfile "3eiaB.bssp"
#ERROR : Can't open dsspfile "3eiaA.bssp"
#ERROR : Can't open dsspfile "3fvsA.bssp"
#ERROR : Can't open dsspfile "3ei9B.bssp"
#ERROR : Can't open dsspfile "3ei9A.bssp"
#ERROR : Can't open dsspfile "3ei8A.bssp"
#ERROR : Can't open dsspfile "3jtxB.bssp"
#ERROR : Can't open dsspfile "2gb3F.bssp"
#ERROR : Can't open dsspfile "2gb3E.bssp"
#ERROR : Can't open dsspfile "2gb3D.bssp"
#ERROR : Can't open dsspfile "2gb3C.bssp"
#ERROR : Can't open dsspfile "2gb3B.bssp"
#ERROR : Can't open dsspfile "2gb3A.bssp"
#ERROR : Can't open dsspfile "2o0rB.bssp"
#ERROR : Can't open dsspfile "2o0rA.bssp"
#ERROR : Can't open dsspfile "3jtxA.bssp"
#ERROR : Can't open dsspfile "2z61A.bssp"
#ERROR : Can't open dsspfile "1yiyA.bssp"
#ERROR : Can't open dsspfile "2r5cB.bssp"
#ERROR : Can't open dsspfile "3e2yA.bssp"
#ERROR : Can't open dsspfile "2z20B.bssp"
#ERROR : Can't open dsspfile "2z20A.bssp"
#ERROR : Can't open dsspfile "1yizA.bssp"
#ERROR : Can't open dsspfile "2r5cA.bssp"
#ERROR : Can't open dsspfile "3e2fA.bssp"
#ERROR : Can't open dsspfile "3cq5B.bssp"
#ERROR : Can't open dsspfile "3cq5A.bssp"
#ERROR : Can't open dsspfile "3cq4B.bssp"
#ERROR : Can't open dsspfile "3cq4A.bssp"
#ERROR : Can't open dsspfile "3h14A.bssp"
#ERROR : Can't open dsspfile "2zc0A.bssp"
#ERROR : Can't open dsspfile "3ihjA.bssp"
#ERROR : Can't open dsspfile "1iayA.bssp"
#ERROR : Can't open dsspfile "1iaxA.bssp"
#ERROR : Can't open dsspfile "3eleC.bssp"
#ERROR : Can't open dsspfile "3eleA.bssp"
#ERROR : Can't open dsspfile "2douB.bssp"
#ERROR : Can't open dsspfile "2douA.bssp"
#ERROR : Can't open dsspfile "3cq6A.bssp"
#ERROR : Can't open dsspfile "1ynuA.bssp"
#ERROR : Can't open dsspfile "1m7yA.bssp"
#ERROR : Can't open dsspfile "1m4nA.bssp"
#ERROR : Can't open dsspfile "1b8gB.bssp"
#ERROR : Can't open dsspfile "1b8gA.bssp"
#ERROR : Can't open dsspfile "2zyjA.bssp"
#ERROR : Can't open dsspfile "2zg5A.bssp"
#ERROR : Can't open dsspfile "2z1yB.bssp"
#ERROR : Can't open dsspfile "2z1yA.bssp"
#ERROR : Can't open dsspfile "2egyD.bssp"
#ERROR : Can't open dsspfile "2egyC.bssp"
#ERROR : Can't open dsspfile "2egyB.bssp"
#ERROR : Can't open dsspfile "3cbfA.bssp"
#ERROR : Can't open dsspfile "1vp4B.bssp"
#ERROR : Can't open dsspfile "1vp4A.bssp"
#ERROR : Can't open dsspfile "2zy2A.bssp"
#ERROR : Can't open dsspfile "1c7nA.bssp"
#ERROR : Can't open dsspfile "2zy5F.bssp"
#ERROR : Can't open dsspfile "2zy5E.bssp"
#ERROR : Can't open dsspfile "2zy5D.bssp"
#ERROR : Can't open dsspfile "2zy5B.bssp"
#ERROR : Can't open dsspfile "2zy5A.bssp"
#ERROR : Can't open dsspfile "2zy4F.bssp"
#ERROR : Can't open dsspfile "2zy4E.bssp"
#ERROR : Can't open dsspfile "2zy4D.bssp"
#ERROR : Can't open dsspfile "2zy4C.bssp"
#ERROR : Can't open dsspfile "2zy4B.bssp"
#ERROR : Can't open dsspfile "2zy4A.bssp"
#ERROR : Can't open dsspfile "2zy3F.bssp"
#ERROR : Can't open dsspfile "2zy3E.bssp"
#ERROR : Can't open dsspfile "2zy3D.bssp"
#ERROR : Can't open dsspfile "2zy3C.bssp"
#ERROR : Can't open dsspfile "2zy3B.bssp"
#ERROR : Can't open dsspfile "2zy3A.bssp"
#ERROR : Can't open dsspfile "1lkcA.bssp"
#ERROR : Can't open dsspfile "1lc8A.bssp"
#ERROR : Can't open dsspfile "1lc7A.bssp"
#ERROR : Can't open dsspfile "1lc5A.bssp"
#ERROR : Can't open dsspfile "3dzzB.bssp"
#ERROR : Can't open dsspfile "3dzzA.bssp"
#ERROR : Can't open dsspfile "3fddA.bssp"
#ERROR : Can't open dsspfile "1d2fB.bssp"
#ERROR : Can't open dsspfile "1d2fA.bssp"

## Summary of PDB Search
:430
    5e-36  37%  1bkgA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-35  36%  1b5oA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    8e-35  36%  1b5pA  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    4e-34  36%  1bjwA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    8e-34  36%  1gc3A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    5e-32  36%  5bj3A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    3e-31  36%  5bj4A  [c.67.1] PROTEIN (ASPARTATE AMINOTRANSFERASE)
    1e-28  30%  1j32A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-27  31%  1djuB  [c.67.1] AROMATIC AMINOTRANSFERASE
    4e-27  31%  1djuA  [c.67.1] AROMATIC AMINOTRANSFERASE
    6e-27  31%  1gd9A  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-20  33%  1o4sB  [c.67.1] ASPARTATE AMINOTRANSFERASE
    2e-20  33%  1o4sA  [c.67.1] ASPARTATE AMINOTRANSFERASE
    3e-17  25%  1xi9C  [c.67.1] PUTATIVE TRANSAMINASE
    4e-17  25%  1xi9A  [c.67.1] PUTATIVE TRANSAMINASE
    5e-17  26%  1xi9B  [c.67.1] PUTATIVE TRANSAMINASE
    2e-16  33%  1v2eB  [c.67.1] GLUTAMINE AMINOTRANSFERASE
    2e-16  33%  1v2eA  [c.67.1] GLUTAMINE AMINOTRANSFERASE
    5e-16  33%  1v2dA  [c.67.1] GLUTAMINE AMINOTRANSFERASE
    6e-14  32%  1bw0B  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    6e-14  32%  1bw0A  [c.67.1] PROTEIN (TYROSINE AMINOTRANSFERASE)
    7e-14  31%  1w7nA  [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
    2e-13  32%  1w7lA  [c.67.1] KYNURENINE--OXOGLUTARATE TRANSAMINASE I
    4e-13  31%  1u08B  [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    4e-13  31%  1u08A  [c.67.1] HYPOTHETICAL AMINOTRANSFERASE YBDL
    5e-13  33%  2z1zA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    5e-13  33%  3ei7B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    5e-13  33%  3ei7A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    5e-13  33%  3ei6B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    5e-13  33%  3ei6A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-13  30%  3dydB  [x.x.x] TYROSINE AMINOTRANSFERASE
    8e-13  30%  3dydA  [x.x.x] TYROSINE AMINOTRANSFERASE
    1e-12  29%  3b46B  [x.x.x] AMINOTRANSFERASE BNA3
    1e-12  29%  3b46A  [x.x.x] AMINOTRANSFERASE BNA3
    1e-12  33%  3eiaB  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    1e-12  33%  3eiaA  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-12  27%  3fvsA  [x.x.x] KYNURENINE--OXOGLUTARATE TRANSAMINASE 1
    2e-12  33%  3ei9B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-12  33%  3ei9A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    2e-12  33%  3ei8A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    3e-12  30%  3jtxB  [x.x.x] AMINOTRANSFERASE
    3e-12  29%  2gb3F  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-12  29%  2gb3E  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-12  29%  2gb3D  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-12  29%  2gb3C  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-12  29%  2gb3B  [x.x.x] ASPARTATE AMINOTRANSFERASE
    3e-12  29%  2gb3A  [x.x.x] ASPARTATE AMINOTRANSFERASE
    4e-12  31%  2o0rB  [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE
    4e-12  31%  2o0rA  [x.x.x] RV0858C (N-SUCCINYLDIAMINOPIMELATE
    4e-12  30%  3jtxA  [x.x.x] AMINOTRANSFERASE
    5e-12  30%  2z61A  [x.x.x] PROBABLE ASPARTATE AMINOTRANSFERASE 2
    3e-11  27%  1yiyA  [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
    3e-11  27%  2r5cB  [x.x.x] KYNURENINE AMINOTRANSFERASE
    4e-11  27%  3e2yA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    6e-11  33%  2z20B  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    6e-11  33%  2z20A  [x.x.x] LL-DIAMINOPIMELATE AMINOTRANSFERASE
    8e-11  25%  1yizA  [x.x.x] KYNURENINE AMINOTRANSFERASE GLUTAMINE
    8e-11  25%  2r5cA  [x.x.x] KYNURENINE AMINOTRANSFERASE
    1e-10  26%  3e2fA  [x.x.x] KYNURENINE-OXOGLUTARATE TRANSAMINASE 3
    2e-10  33%  3cq5B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-10  33%  3cq5A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-10  33%  3cq4B  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    2e-10  33%  3cq4A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    4e-10  35%  3h14A  [x.x.x] AMINOTRANSFERASE, CLASSES I AND II
    6e-10  25%  2zc0A  [x.x.x] ALANINE GLYOXYLATE TRANSAMINASE
    1e-09  35%  3ihjA  [x.x.x] ALANINE AMINOTRANSFERASE 2
    4e-09  30%  1iayA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2
    4e-09  30%  1iaxA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE 2
    9e-09  29%  3eleC  [x.x.x] AMINO TRANSFERASE
    9e-09  29%  3eleA  [x.x.x] AMINO TRANSFERASE
    2e-08  26%  2douB  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    2e-08  26%  2douA  [x.x.x] PROBABLE N-SUCCINYLDIAMINOPIMELATE
    2e-08  33%  3cq6A  [x.x.x] HISTIDINOL-PHOSPHATE AMINOTRANSFERASE
    1e-07  32%  1ynuA  [x.x.x] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
    3e-07  32%  1m7yA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
    3e-07  32%  1m4nA  [c.67.1] 1-AMINOCYCLOPROPANE-1-CARBOXYLATE SYNTHASE
    3e-07  32%  1b8gB  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    3e-07  32%  1b8gA  [c.67.1] PROTEIN (1-AMINOCYCLOPROPANE-1-CARBOXYLATE
    7e-07  31%  2zyjA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-07  31%  2zg5A  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-07  31%  2z1yB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-07  31%  2z1yA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-07  31%  2egyD  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-07  31%  2egyC  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-07  31%  2egyB  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    7e-07  31%  3cbfA  [x.x.x] ALPHA-AMINODIPATE AMINOTRANSFERASE
    3e-06  40%  1vp4B  [c.67.1] AMINOTRANSFERASE, PUTATIVE
    3e-06  40%  1vp4A  [c.67.1] AMINOTRANSFERASE, PUTATIVE
    7e-06  27%  2zy2A  [x.x.x] L-ASPARTATE 4-CARBOXYLYASE
    1e-05  28%  1c7nA  [c.67.1] CYSTALYSIN
    3e-05  31%  2zy5F  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy5E  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy5D  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy5B  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy5A  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy4F  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy4E  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy4D  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy4C  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy4B  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy4A  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy3F  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy3E  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy3D  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy3C  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy3B  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    3e-05  31%  2zy3A  [x.x.x] L-ASPARTATE BETA-DECARBOXYLASE
    1e-04  28%  1lkcA  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-04  28%  1lc8A  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-04  28%  1lc7A  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    1e-04  28%  1lc5A  [c.67.1] L-THREONINE-O-3-PHOSPHATE DECARBOXYLASE
    7e-04  42%  3dzzB  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    7e-04  42%  3dzzA  [x.x.x] PUTATIVE PYRIDOXAL 5'-PHOSPHATE-DEPENDENT C-S
    0.001  28%  3fddA  [x.x.x] L-ASPARTATE-BETA-DECARBOXYLASE
    0.001  28%  1d2fB  [c.67.1] MALY PROTEIN
    0.001  28%  1d2fA  [c.67.1] MALY PROTEIN
:430

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSVAVSATLAVNEALARRRSQGLPVLPLGFGEAGLPVHPVMRDALSTGGDQNGYGPVAGIRELREAAAGY
1bkgA           -----SATVAVNAKALELRRQGVDLVALTAGEPDFDVKEAARRALAQG--KTKYAPPAGIPELREALAEK
1b5oA           -----SATVAVNAKALELRRQGVDLVALTAGEPDFDVKEAARRALAQG--KTKYAPPAGIPELREALAEK
1b5pA           -----SATVAVNAKALELRRQGVDLVALTAGEPDFDVKEAARRALAQG--KTKYAPPAGIPELREALAEK
1bjwA           -----SATVAVNAKALELRRQGVDLVALTAGEPDFDVKEAARRALAQG--KTKYAPPAGIPELREALAEK
1gc3A           ------AVVAVNAKALELRRQGVDLVALTAGEPDFDVKEAARRALAQG--KTKYAPPAGIPELREALAEK
5bj3A           --------------LSRRVQAMKPLVALTAGEPDFDVKEAARRALAQG--KTKYAPPAGIPELREALAEK
5bj4A           ------------------------------------VKEAARRALAQG--KTKYAPPAGIPELREALAEK
1j32A           -SVSPSMTLIIDAKAKAMKAEGIDVCSFSAGEPDFPKHIVEAAKAALEQGKTRYGPAAGEPRLREAIAQK
1djuB           -------------ALSDRLELVSDVISLGIGEPDFPQHEYAKEALDKG--LTHYGPNIGLLELREAIAEK
1djuA           ------------------------VISLGIGEPDFPQHEYAKEALDKG--LTHYGPNIGLLELREAIAEK
1gd9A           ------------------------VISLGIGEPDFPQHEYAKEALDKG--LTHYGPNIGLLELREAIAEK
1o4sB           --IPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTEPVVEEAVRLQKGEVKYTDPRGIYELREGIAKI
1o4sA           --IPISKTMELDAKAKALIKKGEDVINLTAGEPDFPTEPVVEEAVRLQKGEVKYTDPRGIYELREGIAKI
1xi9C           ---ALSVEYAIRDVVLPAREKGIKVIRLNIGDPVKPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVER
1xi9A           ---ASKRALSVEYPARELEKKGIKVIRLNIGDPVKPEHMKEAYCKAIKEGHNYYGDSEGLPELRKAIVER
1xi9B           ---------------------------------------------------NYYGDSEGLPELRKAIVER
1v2eB           -------TEAAKESIFPRMSQRLGAVNLGQGFPSNPPPPFLLEAVRRAGRQDQYAPPAGLPALREALA--
1v2eA           -------TEAAKESIFPRMSQRLGAVNLGQGFPSNPPPPFLLEAVRRAGRQDQYAPPAGLPALREALA--
1v2dA           -------------------AQRLGAVNLGQGFPSNPPPPFLLEAVRRAGRQDQYAPPAGLPALREALA--
1bw0B           ---------------------------------------------------NGYFPTVGSPEAREAVATW
1bw0A           ---------------------------------------------------NGYFPTVGSPEAREAVATW
1w7nA           ----------------------------------------------------GYPPLTKI-----LASFF
1w7lA           ----------------------------------------------------GYPPLTKI-----LASFF
1u08B           -------------------------LSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQK
1u08A           -------------------------LSQGFPDFDGPRYLQERLAHHVAQGANQYAPMTGVQALREAIAQK
2z1zA           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3ei7B           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3ei7A           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3ei6B           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3ei6A           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3dydB           --------------------------PTVFGN--LPTDPAMKDALDSG-KYNGYAPSIGFLSSREEIASY
3dydA           --------------------------PTVFGN--LPTDPAMKDALDSG-KYNGYAPSIGFLSSREEIASY
3b46B           ----------------------------------------------------------------------
3b46A           ----------------------------------------------------------------------
3eiaB           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3eiaA           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3fvsA           ----------------------------------------------------GYPPLTKI-----LASFF
3ei9B           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3ei9A           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3ei8A           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
3jtxB           -------------------------VPLHIGEPKHPTPKVITDALTASHELEKYPLTAGLPELRQACANW
2gb3F           ---------------AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYSHSAGIWELREAFASY
2gb3E           ---------------AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYSHSAGIWELREAFASY
2gb3D           ---------------AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYSHSAGIWELREAFASY
2gb3C           ---------------AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYSHSAGIWELREAFASY
2gb3B           ---------------AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYSHSAGIWELREAFASY
2gb3A           ---------------AEAKKRGVRIHHLNIGQPDLKTPEVFFERIYENKPEVVYSHSAGIWELREAFASY
2o0rB           ------ATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQ
2o0rA           ------ATTVFAEMSALATRIGAVNLGQGFPDEDGPPKMLQAAQDAIAGGVNQYPPGPGSAPLRRAIAAQ
3jtxA           -------------------------VPLHIGEPKHPTPKVITDALTASHELEKYPLTAGLPELRQACANW
2z61A           -------------ALAQKESEGKKVIHLEIGEPDFNTKPIVDEGISLKEGKTHYTDSRGILELREKISEY
1yiyA           ----------------------------------------------------------------------
2r5cB           ----------------------------------------------------------------------
3e2yA           ----------------------------------------------------GFGHPALVKALSCLYGKI
2z20B           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
2z20A           --------------IARRRSAHLQVISLGIGDTTEPIPEVITSALSTIEGYSGYGAEQGAKPLRAAIAKT
1yizA           ----------------------------------------------------------------------
2r5cA           ----------------------------------------------------------------------
3e2fA           ----------------------------------------------------GFGHPALVKALSCLYGKI
3cq5B           -------------------------------------------------------------ELRDELAAY
3cq5A           -------------------------------------------------------------ELRDELAAY
3cq4B           -------------------------------------------------------------ELRDELAAY
3cq4A           -------------------------------------------------------------ELRDELAAY
3h14A           ----------------------------------------------------------GLPALRQRIARY
2zc0A           -----SALADVMKKASELQKKGVKLISLAAGDPDPELIPIAKEVLEKEPKSVMYTPANGIPELREELAAF
3ihjA           ----------------------------------------------------------GVNCIREDVAAY
1iayA           ----------------------------------------------------------GLPEFRKAIAKF
1iaxA           ----------------------------------------------------------GLPEFRKAIAKF
3eleC           ------------------------VYDFSIGNPSIPAPQIVNDTIKTDYDSHGYTSAQGDVETRAAIAEF
3eleA           ------------------------VYDFSIGNPSIPAPQIVNDTIKTDYDSHGYTSAQGDVETRAAIAEF
2douB           -----SVFLVVDEAKRKARERGVGLIDLSIGSTDXXXXXXXXXXXXXXNDPTTYGKSCTLPFLEEAARWY
2douA           -----SVFLVVDEAKRKARERGVGLIDLSIGSTDXXXXXXXXXXXXXXNDPTTYGKSCTLPFLEEAARWY
3cq6A           -------------------------------------------------------------ELRDELAAY
1ynuA           ----------------------------------------------------------------------
1m7yA           ----------------------------------------------------------------------
1m4nA           ----------------------------------------------------------------------
1b8gB           ----------------------------------------------------------------------
1b8gA           ----------------------------------------------------------------------
2zyjA           -----------------------------------------------------YSPTEGYAPLRAFVAEW
2zg5A           -----------------------------------------------------YSPTEGYAPLRAFVAEW
2z1yB           -----------------------------------------------------YSPTEGYAPLRAFVAEW
2z1yA           -----------------------------------------------------YSPTEGYAPLRAFVAEW
2egyD           -----------------------------------------------------YSPTEGYAPLRAFVAEW
2egyC           -----------------------------------------------------YSPTEGYAPLRAFVAEW
2egyB           -----------------------------------------------------YSPTEGYAPLRAFVAEW
3cbfA           -----------------------------------------------------YSPTEGYAPLRAFVAEW
1vp4B           ----------------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------
2zy2A           ----------------------------------------------------------------------
1c7nA           ----------------------------------------------------------------------
2zy5F           ----------------------------------------------------------------------
2zy5E           ----------------------------------------------------------------------
2zy5D           ----------------------------------------------------------------------
2zy5B           ----------------------------------------------------------------------
2zy5A           ----------------------------------------------------------------------
2zy4F           ----------------------------------------------------------------------
2zy4E           ----------------------------------------------------------------------
2zy4D           ----------------------------------------------------------------------
2zy4C           ----------------------------------------------------------------------
2zy4B           ----------------------------------------------------------------------
2zy4A           ----------------------------------------------------------------------
2zy3F           ----------------------------------------------------------------------
2zy3E           ----------------------------------------------------------------------
2zy3D           ----------------------------------------------------------------------
2zy3C           ----------------------------------------------------------------------
2zy3B           ----------------------------------------------------------------------
2zy3A           ----------------------------------------------------------------------
1lkcA           ----------------------------------------------------------------------
1lc8A           ----------------------------------------------------------------------
1lc7A           ----------------------------------------------------------------------
1lc5A           ----------------------------------------------------------------------
3dzzB           ----------------------------------------------------------------------
3dzzA           ----------------------------------------------------------------------
3fddA           ----------------------------------------------------------------------
1d2fB           -----------------------------------------------------------------AAIAH
1d2fA           -----------------------------------------------------------------AAIAH


                         .         .         *         .         .         .         .:140
query           WERRGLPTDPDLVVAGPGSKPLLYALLLAIGGDVAIAAPSWVSYAAQSHLSGGQPLFVPTAPAQGGVPEP
1bkgA           FRREGLSVTPEETIVTVGGKQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
1b5oA           FRREGLSVTPEETIVTVGGSQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
1b5pA           FRREGLSVTPEETIVTVGGSQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
1bjwA           FRREGLSVTPEETIVTVGGKQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
1gc3A           FRREGLSVTPEETIVTVGGSQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
5bj3A           FRREGLSVTPEETIVTVGGSQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
5bj4A           FRREGLSVTPEETIVTVGGSQALFNLFQAIGDEVIVLSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDP
1j32A           LQRNGLCYGADNILVTNGGKQSIFNLMLAMGDEVIIPAPFWVSYPEMVKLAEGTPVILPTTVETQFKVSP
1djuB           LKKQGIEADPKMVLLGANQAFLMLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNV
1djuA           LKKQGIEADPKMVLLGANQAFLMLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNV
1gd9A           LKKQGIEADPKMVLLGANQAFLMLSAFLKDGEEVLIPTPAFVSYAPAVILAGGKPVEVPTYEEDEFRLNV
1o4sB           GERYKKDISPDQVVVTNGAKQALFNAFMALGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSL
1o4sA           GERYKKDISPDQVVVTNGAKQALFNAFMALGDEVIVFSPVWVSYIPQIILAGGTVNVVETFMSKNFQPSL
1xi9C           EKRKNTPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRT------IEEE
1xi9A           EKRKNTPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRT------IEEE
1xi9B           EKRKNTPDDVRVTAAVTEALQLIFGALLDPGDEILVPGPSYPPYTGLVKFYGGKPVEYRT------IEEE
1v2eB           ---EEFAVEPESVVVTSGATEALYVLLQSLGDEVVVLEPFFDVYLPDAFLAGAKARLVRLLTPEGFRLDL
1v2eA           ---EEFAVEPESVVVTSGATEALYVLLQSLGDEVVVLEPFFDVYLPDAFLAGAKARLVRLLTPEGFRLDL
1v2dA           ---EEFAVEPESVVVTSGATEALYVLLQSLGDEVVVLEPFFDVYLPDAFLAGAKARLVRLLTPEGFRLDL
1bw0B           WELKSTIVKDNVVLCSGGSHGILMAITICDAGDYALVPPGFPHYETVCKAYGIGMHFYNCRPENDWEADL
1bw0A           WELKSTIVKDNVVLCSGGSHGILMAITICDAGDYALVPPGFPHYETVCKAYGIGMHFYNCRPENDWEADL
1w7nA           GELLGQEIDPLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPGELGDP
1w7lA           GELLGQEIDPLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGPGELGDP
1u08B           TERLGYQPDADSITVTAGATEALYAAITALGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQ
1u08A           TERLGYQPDADSITVTAGATEALYAAITALGDEVICFDPSYDSYAPAIALSGGIVKRMALQPPHFRVDWQ
2z1zA           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3ei7B           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3ei7A           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3ei6B           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3ei6A           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3dydB           YHCPEAPLEAKDVILTSGCSQLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDL
3dydA           YHCPEAPLEAKDVILTSGCSQLCLAVLANPGQNILVPRPGFSLYKTLAESMGIEVKLYNLLPEKSWEIDL
3b46B           --------------------------LLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-------P
3b46A           --------------------------LLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINP-------P
3eiaB           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3eiaA           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3fvsA           GELLGQEIDPLVTVGGYGALFTAFQALVDEGDEVIIIEPFFDCYEPMTMMAGGRPVFVSLKPGQNGELGS
3ei9B           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3ei9A           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3ei8A           FYG-GLGIGDDDVFVSDGAKCDISRLQVMFGSNVTIAVPSYPAYVDSSVIMGQTGQFNTDVQKYGNIPEN
3jtxB           LKRRGLTVDADNILPVLGSREALFSVLNPVGIKPAIVSPNYQIYEGATLLGGGEIHFA-NCPAPSFNPDW
2gb3F           YKRRRVDVKPEVLVTNGGSEAILFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPVTRREEGFAIP
2gb3E           YKRRRVDVKPEVLVTNGGSEAILFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPVTRREEGFAIP
2gb3D           YKRRRVDVKPEVLVTNGGSEAILFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPVTRREEGFAIP
2gb3C           YKRRRVDVKPEVLVTNGGSEAILFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPVTRREEGFAIP
2gb3B           YKRRRVDVKPEVLVTNGGSEAILFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPVTRREEGFAIP
2gb3A           YKRRRVDVKPEVLVTNGGSEAILFAVIANPGDEILVLEPFYANYNAFAKIAGVK--LIPVTRREEGFAIP
2o0rB           RRRHGVDYDPETVLVTVGATEAIAAAVLGLGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPGRGFALDA
2o0rA           RRRHGVDYDPETVLVTVGATEAIAAAVLGLGSEVLLIEPFYDSYSPVVAMAGAHRVTVPLVPGRGFALDA
3jtxA           LKRRGLTVDADNILPVLGSREALFSFVQTVGIKPAIVSPNYQIYEGATLLGGGEIHFA-NCPAPSFNPDW
2z61A           KDKYKADIIPDNIIITXXXXXXXXXXXXXIGDEVLIQNPCYPCYKNFIRFLGAKPVFC------------
1yiyA           ------------VLVTVGAYEALYATIVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGISSA
2r5cB           ------------VLVTVGAYEALYATIVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGISSA
3e2yA           YQRQIDPNEEILVAVGAGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPSKPTDGWTSSD
2z20B           FYG-GLGIGDDDVFVSDGAKCDI-SRLQVFGSNVTIAVPSYPAYV-DSSVIGQTGQFNTDVQKYGNIPEN
2z20A           FYG-GLGIGDDDVFVSDGAKCDI-SRLQVFGSNVTIAVPSYPAYV-DSSVIGQTGQFNTDVQKYGNIPEN
1yizA           ------------VLVTVGAYEALYATIVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGISSA
2r5cA           ------------VLVTVGAYEALYATIVDEGDEVIIIEPFFDCYEPMVKAAGGIPRFIPLKPNKTGISSA
3e2fA           YQRQIDPNEEILVAVGAGSLFNSIQGLVDPGDEVIIMVPFYDCYEPMVRMAGAVPVFIPSKPTDGWTSSD
3cq5B           ITKQGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTFIAVSRGADFRIDM
3cq5A           ITKQGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTFIAVSRGADFRIDM
3cq4B           ITKQGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTFIAVSRGADFRIDM
3cq4A           ITKQGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTFIAVSRGADFRIDM
3h14A           GEWYGVDLDPGRVVITPGSSGLAFTALFDSGDRVGIGAPGYPSYRQILRALGLVPVDLPTAPENRLQPVP
2zc0A           LKKYDLEVSPEITIGGTGALDLLGRVLIDPGDVVITENPSYINTLLAFEQLGAK---IEGVPVDNDGMRV
3ihjA           ITRRGVPADPDNIYLTTGASDGISTILLVSGGGVMIPIPQYPLYSAVSELDAIQVNYY--------LDEE
1iayA           MEKRGVRFDPERVVMAGGATGANETIILADPGD-AFLVPSPYYPAFNRDLTGVQLIPIHCESSNNFKITS
1iaxA           MEKRGVRFDPERVVMAGGATGANETIILADPGD-AFLVPSPYYPAFNRDLTGVQLIPIHCESSNNFKITS
3eleC           LNNHGTHFNADNLYTGAASLSICFRALTSDAYDEFITAPYFPEYKVFVNAAGARLVEVP-ADTEHFQIDF
3eleA           LNNHGTHFNADNLYTGAASLSICFRALTSDAYDEFITAPYFPEYKVFVNAAGARLVEVP-ADTEHFQIDF
2douB           EGRYGVGLDPRRALALIGSQEGLAHXXXXXXXXXXXXXXXXVSYFGAARVASLRTFLIPL--------RE
2douA           EGRYGVGLDPRRALALIGSQEGLAHXXXXXXXXXXXXXXXXVSYFGAARVASLRTFLIPL--------RE
3cq6A           ITKQGVAVTRDNLWAANGSNEILQQLLQAFGGPGRTALGFQPSYSMHPILAKGTHTFIAVSRGADFRIDM
1ynuA           ----------------------------------------------------------------------
1m7yA           ----------------------------------------------------------------------
1m4nA           ----------------------------------------------------------------------
1b8gB           ----------------------------------------------------------------------
1b8gA           ----------------------------------------------------------------------
2zyjA           -----IGVRPEEVLITTGSQQLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQG--PRFL-TVPAGEEGPDL
2zg5A           -----IGVRPEEVLITTGSQQLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQG--PRFL-TVPAGEEGPDL
2z1yB           -----IGVRPEEVLITTGSQQLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQG--PRFL-TVPAGEEGPDL
2z1yA           -----IGVRPEEVLITTGSQQLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQG--PRFL-TVPAGEEGPDL
2egyD           -----IGVRPEEVLITTGSQQLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQG--PRFL-TVPAGEEGPDL
2egyC           -----IGVRPEEVLITTGSQQLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQG--PRFL-TVPAGEEGPDL
2egyB           -----IGVRPEEVLITTGSQQLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQG--PRFL-TVPAGEEGPDL
3cbfA           -----IGVRPEEVLITTGSQQLVGKVFLDEGSPVLLEAPSYMGAIQAFRLQG--PRFL-TVPAGEEGPDL
1vp4B           ----------------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------
2zy2A           ------PESVDLFAVEGGTAAMAYIFLLKAGDKVAIGMPVFTPYIEIPELAQYDLKEVPIADPDNGWQYS
1c7nA           ----------------------------------------------------------------------
2zy5F           ----------------------------------------------------------------------
2zy5E           ----------------------------------------------------------------------
2zy5D           ----------------------------------------------------------------------
2zy5B           ----------------------------------------------------------------------
2zy5A           ----------------------------------------------------------------------
2zy4F           ----------------------------------------------------------------------
2zy4E           ----------------------------------------------------------------------
2zy4D           ----------------------------------------------------------------------
2zy4C           ----------------------------------------------------------------------
2zy4B           ----------------------------------------------------------------------
2zy4A           ----------------------------------------------------------------------
2zy3F           ----------------------------------------------------------------------
2zy3E           ----------------------------------------------------------------------
2zy3D           ----------------------------------------------------------------------
2zy3C           ----------------------------------------------------------------------
2zy3B           ----------------------------------------------------------------------
2zy3A           ----------------------------------------------------------------------
1lkcA           ----------------------------------------------------------------------
1lc8A           ----------------------------------------------------------------------
1lc7A           ----------------------------------------------------------------------
1lc5A           ----------------------------------------------------------------------
3dzzB           ----------------------------------------------------------------------
3dzzA           ----------------------------------------------------------------------
3fddA           ----------------------------------------------------------------------
1d2fB           WTQHYTAIDSQTVVYGPSVIYMVSELIRQTGEGVVIHTPAYDAF--YKAIEGNQRTVMPVAQADGWFCDM
1d2fA           WTQHYTAIDSQTVVYGPSVIYMVSELIRQTGEGVVIHTPAYDAF--YKAIEGNQRTVMPVAQADGWFCDM


                         +         .         .         .         .         *         .:210
query           DALAQAVTEARAAGRDIRAVITTCPDNPTGTVASRGTVRRLTEVAQELDLVIISDEIYRDLVHDPTTVVH
1bkgA           ERVRRAITPR------TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
1b5oA           ERVRRAITPR------TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
1b5pA           ERVRRAITPR------TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
1bjwA           ERVRRAITPR------TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
1gc3A           ERVRRAITPR------TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
5bj3A           ERVRRAITPR------TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
5bj4A           ERVRRAITPR------TKALVVNSPNNPTGAVYPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEH--F
1j32A           EQIRQAITPKT------KLLVFNTPSNPTGMVYTPDEVRAIAQVAVEAGLWVLSDEIYEKILYDDALSIG
1djuB           DELKKYVTDKT------RALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDASIAS
1djuA           DELKKYVTDKT------RALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDASIAS
1gd9A           DELKKYVTDKT------RALIINSPCNPTGAVLTKKDLEEIADFVVEHDLIVISDEVYEHFIYDDASIAS
1o4sB           EEV-----EGLLVGKT-KAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYDEFTSIL
1o4sA           EEV-----EGLLVGKT-KAVLINSPNNPTGVVYRREFLEGLVRLAKKRNFYIISDEVYDSLVYDEFTSIL
1xi9C           DWQPXXXXXXXXXXXXXXAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHI--
1xi9A           DWQPXXXXXXXXXXXXXXAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHI--
1xi9B           DWQPXXXXXXXXXXXXXXAIAVINPNNPTGALYDKKTLEEILNIAGEYEIPVISDEIYDLMTYEGEHI--
1v2eB           SALEKALTPRT------RALLLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLISDEVYDELYYGERP--R
1v2eA           SALEKALTPRT------RALLLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLISDEVYDELYYGERP--R
1v2dA           SALEKALTPRT------RALLLNTPMNPTGLVFGXXXXXXXXXXXXXHDLFLISDEVYDELYYGERP--R
1bw0B           DEIR------RLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVKDPNATFT
1bw0A           DEIR------RLKDDKTKLLIVTNPSNPCGSNFSRKHVEDIVRLAEELRLPLFSDEIYAGMVKDPNATFT
1w7nA           MELAGKFTSRT------KALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVHQHISIAS
1w7lA           MELAGKFTSRT------KALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVHQHISIAS
1u08B           EFAA-------LLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHIQQGHASVLA
1u08A           EFAA-------LLSERTRLVILNTPHNPSATVWQQADFAALWQAIAGHEIFVISDEVYEHIQQGHASVLA
2z1zA           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3ei7B           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3ei7A           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3ei6B           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3ei6A           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3dydB           KQLEYLIDEKTAC------LIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDM-------VF
3dydA           KQLEYLIDEKTAC------LIVNNPSNPCGSVFSKRHLQKILAVAARQCVPILADEIYGDM-------VF
3b46B           KELDQRNTRGKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYF--TDSFT
3b46A           KELDQRNTRGKAITSKTKAVIINTPHNPIGKVFTREELTTLGNICVKHNVVIISDEVYEHLYF--TDSFT
3eiaB           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3eiaA           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3fvsA           SSNWQ-LDPMELAGKRTKALVLNTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVHQHISIAS
3ei9B           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3ei9A           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3ei8A           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAMYMSDPRSIFE
3jtxB           RSISEEVWKRT------KLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDPLGCLQ
2gb3F           QNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGLFLIVDEVYSEIV--------
2gb3E           QNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGLFLIVDEVYSEIV--------
2gb3D           QNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGLFLIVDEVYSEIV--------
2gb3C           QNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGLFLIVDEVYSEIV--------
2gb3B           QNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGLFLIVDEVYSEIV--------
2gb3A           QNLESFINER------TKGIVLSNPCNPTGVVYGKDE-RYLVEIAERHGLFLIVDEVYSEIV--------
2o0rB           DALRRAVTPRT------RALIINSPHNPTGAVLSXXXXXXXXXXXXXXXXXXXTDEVYEHLVFDHAR--H
2o0rA           DALRRAVTPRT------RALIINSPHNPTGAVLSXXXXXXXXXXXXXXXXXXXTDEVYEHLVFDHAR--H
3jtxA           RSISEEVWKRT------KLVFVCSPNNPSGSVLDLDGWKEVFDLQDKYGFIIASDECYSEIYFDPLGCLQ
2z61A           DFTVESLEEALSD--KTKAIIINSPSNPLGEVIDR----EIYEFAYENIPYIISDEIYNGLVYEGK--CY
1yiyA           DWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPIRICT
2r5cB           DWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPIRICT
3e2yA           WTFDPRELESKFSSKT-KAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVHTHVKIAT
2z20B           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAYSDDNPRSIFE
2z20A           GFFPDLSTVGRT---DI--IFFCSPNNPTGAAATREQLTQLVEFAKKNGSIIVYDSAYAYSDDNPRSIFE
1yizA           DWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIR
2r5cA           DWVLDNNELEALFNEKTKMIIINTPHNPLGKVMDRAELEVVANLCKKWNVLCVSDEVYEHMVFEPFEHIR
3e2fA           WTFDPRELESKFSSKT-KAIILNTPHNPLGKVYTRQELQVIADLCVKHDTLCISDEVYEWLVYTGHTHVK
3cq5B           DV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSAT--
3cq5A           DV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSAT--
3cq4B           DV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSAT--
3cq4A           DV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSAT--
3h14A           ---------ADFAGLDLAGLVAS-PANPTGTLDHXXXXXXXXXXXXXXS--FISDEIYHGIEYEAKAV--
2zc0A           DXXXXXXXXXXAKGQKVKLIYTITGQNPMGVTMSMERRKALLEIASKYDLLIIEDTAYNFMRYEGGDIVP
3ihjA           NCWALNVNELRRAVQDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEVYQDNVYSPDCRFH
1iayA           KAVKEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFV-
1iaxA           KAVKEAYENAQKSNIKVKGLILTNPSNPLGTTLDKDTLKSVLSFTNQHNIHLVCDEIYAATVFDTPQFV-
3eleC           DALEERINA------HTRGVIINSPNNPSGTVYSEETIXXXXXXXXXXPIFIIADEPYREIVYDGIKVPF
3eleA           DALEERINA------HTRGVIINSPNNPSGTVYSEETIXXXXXXXXXXPIFIIADEPYREIVYDGIKVPF
2douB           DGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSP
2douA           DGLADLKAVPEGVWREAKVLLLNYPNNPTGAVADWGYFEEALGLARKHGLWLIHDNPYVDQVYEGEAPSP
3cq6A           DV---ALEEIRAKQPDI--VFVTTPNNPTGDVTSLDDVERIINVAPG---IVIVDEAYAEFSPSPSAT--
1ynuA           -ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFI-
1m7yA           -ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFI-
1m4nA           -ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFI-
1b8gB           -ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFI-
1b8gA           -ALEEAYQEAEKRNLRVKGVLVTNPSNPLGTTMTRNELYLLLSFVEDKGIHLISDEIYSGTAFSSPSFI-
2zyjA           DALEEVLKRERPRF----LYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYREL---------
2zg5A           DALEEVLKRERPRF----LYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYREL---------
2z1yB           DALEEVLKRERPRF----LYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYREL---------
2z1yA           DALEEVLKRERPRF----LYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYREL---------
2egyD           DALEEVLKRERPRF----LYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYREL---------
2egyC           DALEEVLKRERPRF----LYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYREL---------
2egyB           DALEEVLKRERPRF----LYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYREL---------
3cbfA           DALEEVLKRERPRF----LYLIPSFQNPTGGLTPLPARKRLLQMVMERGLVVVEDDAYREL---------
1vp4B           --------------------------NPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDP
1vp4A           --------------------------NPAGVTTSLEKRKALVEIAEKYDLFIVEDDPYGALRYEGETVDP
2zy2A           DAELDKLKDP-----DVKIFFCVNPSNPPSVKMDQRSLDRVRAIVAEQDLLILTDDVYGTFADE----FQ
1c7nA           --------EKLSKDKNNKALLFCSPHNPVGRVWKKDELQKIKDIVLKSDLMLWSDEIHFDLIMPEHTVFQ
2zy5F           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy5E           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy5D           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy5B           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy5A           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy4F           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy4E           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy4D           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy4C           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy4B           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy4A           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy3F           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy3E           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy3D           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy3C           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy3B           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
2zy3A           ------------------------PSNPPSVKMDQRSLERVRNIVAEHDLMILTDDVYGTFADD----FQ
1lkcA           DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI-
1lc8A           DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI-
1lc7A           DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI-
1lc5A           DAILEALTP------DLDCLFLCTPNNPTGLLPERPLLQAIADRCKSLNINLILDEAFIDFIPHETGFI-
3dzzB           ------------------------PHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLV--------
3dzzA           ------------------------PHNPIGYAWSEEEVKRIAELCAKHQVLLISDEIHGDLV--------
3fddA           ------------------------PSNPPSVKMDERSLERVRKIVAEHDLMILTDDVYGTFADG----FQ
1d2fB           GKL-----EAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMV--------
1d2fA           GKL-----EAVLAKPECKIMLLCSPQNPTGKVWTCDELEIMADLCERHGVRVISDEIHMDMV--------


                         .         .         .         +         .         .         .:280
query           SPAEFAPERTVITTGLSKNLALGGWRIGVARLPDSDTGRHIHAALLGIASEIWSSPSGPVQRAAAYAFQE
1bkgA           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGP-----KEVIKAMASVSSQSTTSPDTIAQWATLEALTN
1b5oA           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGP-----KEVIKAMASVSSQSTTSPDTIAQWATLEALTN
1b5pA           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGP-----KEVIKAMASVSRQSTTSPDTIAQWATLEALTN
1bjwA           SPGRVAPEHTLTVNGAAA-FAMTGWRIGYACGP-----KEVIKAMASVSSQSTTSPDTIAQWATLEALTN
1gc3A           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGP-----KEVIKAMASVSRQSTTSPDTIAQWATLEALTN
5bj3A           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGP-----KEVIKAMASVSRQSTTSPDTIAQWATLEALTN
5bj4A           SPGRVAPEHTLTVNGAAKAFAMTGWRIGYACGP-----KEVIKAMASVSRQSTTSPDTIAQWATLEALTN
1j32A           AASPEAYERSVVCSGFAKTYAMTGWRVGFLAGP---------VPLVKAATKIQGHSTSNVQYGAIAAYEN
1djuB           LDGMF--ERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNA-----TCPVTFIQYAAAKALKD
1djuA           LDGMF--ERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNA-----TCPVTFIQYAAAKALKD
1gd9A           LDGMF--ERTITVNGFSKTFAMTGWRLGFVAAPSWIIERMVKFQMYNA-----TCPVTFIQYAAAKALKD
1o4sB           DVSE-GFDRIVYINGFSKSHSMTGWRVG------------------------------------------
1o4sA           DVSE-GFDRIVYINGFSKSHSMTGWRVG------------------------------------------
1xi9C           SPGSLTKDVPVIVNGLSKVYFATGWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTG
1xi9A           SPGSLTKDVPVIVNGLSKVYFATGWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTG
1xi9B           SPGSLTKDVPVIVNGLSKVYFATGWRLGYMYFVDPENKLSEVREAIDRLARIRLCPNTPAQFAAIAGLTG
1v2eB           RLREFAPERTFTVGSAGKRLEATGYRVG------------------------------------------
1v2eA           RLREFAPERTFTVGSAGKRLEATGYRVG------------------------------------------
1v2dA           RLREFAPERTFTVGSAGKRLEATGYRVG------------------------------------------
1bw0B           SVADFETTVPRVILGGTANLVVPGWRLG------------------------------------------
1bw0A           SVADFETTVPRVILGGTANLVVPGWRLG------------------------------------------
1w7nA           LPGMW--ERTLTIGSAGKTFSATGWKVGWVLGPD------------------------------------
1w7lA           LPGMW--ERT-LTIGSAGTFSATGWKVGWVLGPD------------------------------------
1u08B           HPQ--LRERAVAVSSFGKTYHMTGWKVGVAPAPISAEIRKVHQYL-------------------------
1u08A           HPQ--LRERAVAVSSFGKTYHMTGWKVGVAPAPISAEIRKVHQYL-------------------------
2z1zA           IPG--AEEVAMETASFSKYAGFTGVRLGWTVIP-------------------------------------
3ei7B           IPG--AEEVAMETASFSKYAGFTGVRLGWTVIP-------------------------------------
3ei7A           IPG--AEEVAMETASFSKYAGFTGVRLGWTVIP-------------------------------------
3ei6B           IPG--AEEVAMETASFSKYAGFTGVRLGWTVIP-------------------------------------
3ei6A           IPG--AEEVAMETASFSKYAGFTGVRLGWTVIP-------------------------------------
3dydB           SDCKYEPLATLSTDGLAKRWLVPGWRLGWILIHDRRDGNEIRDGLVKLSQRI------------------
3dydA           SDCKYEPLATLSTDGLAKRWLVPGWRLGWILIHDRRDGNEIRDGLVKLSQRI------------------
3b46B           RIATLSPEQLTLTVGSAGSFAATGWRIGWV--------LSLNAELLSYAAKCFASPS-PLQEACANSIND
3b46A           RIATLSPEQLTLTVGSAGSFAATGWRIGWV--------LSLNAELLSYAAKCFASPS-PLQEACANSIND
3eiaB           IPG--AEEVAMETASFSQYAGFTGVRLGWTVIP-------------------------------------
3eiaA           IPG--AEEVAMETASFSQYAGFTGVRLGWTVIP-------------------------------------
3fvsA           LPGMW--ERT-LTIGSAGTFSATGWKVGWVLGPD-----HIMKHLRTVHQN--SVFHCPTQSQAAVAFRQ
3ei9B           IPG--AEEVAMETASFSNYAGFTGVRLGWTVIP-------------------------------------
3ei9A           IPG--AEEVAMETASFSNYAGFTGVRLGWTVIP-------------------------------------
3ei8A           IPG--AEEVAMETASFSNYAGFTGVRLGWTVIP-------------------------------------
3jtxB           AAAQLGRSRKLLFTSLSRSNVPGGFVAGDAELLKN----------FLLYRTYHGSASIPVQRASIAAWDD
2gb3F           ----------------------------------------------------------------------
2gb3E           ----------------------------------------------------------------------
2gb3D           ----------------------------------------------------------------------
2gb3C           ----------------------------------------------------------------------
2gb3B           ----------------------------------------------------------------------
2gb3A           ----------------------------------------------------------------------
2o0rB           LPLDGMAERT-ITISSAAMFNCTGWKIGWA----------------------------------------
2o0rA           LPLDGMAERT-ITISSAAMFNCTGWKIGWA----------------------------------------
3jtxA           AAAQLGRSRKLLFTSLSRSNVPGGFVAGDAELLKN----------FLLYRTYHGSASIPVQRASIAAWDD
2z61A           SAIEFDEEKTILINGFSL-YAMTGWRIGYVISND-----EIIEAILKLQQNLFISAPTISQYAALKAFEK
1yiyA           LPGMW--ERTITIGSAGKTFSLTGWKIGWAYGPEA-----------------------------------
2r5cB           LPGMW--ERTITIGSAGKTFSLTGWKIGWAYGPEA-----------------------------------
3e2yA           LPGMW--ERTITIGSAGKTFSVTGWKLGWSIGP-----AHLIKHLQTVQQNSFYTCATPLQAALAEAF--
2z20B           IP---GAEEVAETASFSKYAGFTGVRLGWTVIP-------------------------------------
2z20A           IP---GAEEVAETASFSKYAGFTGVRLGWTVIP-------------------------------------
1yizA           ICTLPGMWERTITIGSAGTFSLTGWKIGWAYGPEA-----------------------------------
2r5cA           ICTLPGMWERTITIGSAGTFSLTGWKIGWAYGPEA-----------------------------------
3e2fA           IATLPGMWERTITIGSAGTFSVTGWKLGWSIGP-----AHLIKHLQTVQQNSFYTCATPLQAALAEAF--
3cq5B           TLLEKYPTKLVVSRTMSKAFDFAGGRLG------------------------------------------
3cq5A           TLLEKYPTKLVVSRTMSKAFDFAGGRLG------------------------------------------
3cq4B           TLLEKYPTKLVVSRTMSKAFDFAGGRLG------------------------------------------
3cq4A           TLLEKYPTKLVVSRTMSKAFDFAGGRLG------------------------------------------
3h14A           TALELTDECYVINS-FSKYFST-GWRVG------------------------------------------
2zc0A           LKALDNEGRVIVAGTLSKVLGTGGWII-------------------------------------------
3ihjA           S---------------------------------------------------------------------
1iayA           SIAEILDEQEMIVYSLSKDMGLPGFRVGI-----------------------------------------
1iaxA           SIAEILDEQEMIVYSLSKDMGLPGFRVGI-----------------------------------------
3eleC           VTKYY--DNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKELYAAVCG-----------------------
3eleA           VTKYY--DNTLVCYSYSKSLSLPGERIGYVLVPDEVYDKELYAAVCG-----------------------
2douB           LALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALAR-----LERVKGVIDFNQYAGVLRMGVEALKT
2douA           LALPGAKERVVELFSLSKSYNLAGFRLGFALGSEEALAR-----LERVKGVIDFNQYAGVLRMGVEALKT
3cq6A           TLLEKYPTKLVVSRTMSA-FDFAGGRLG------------------------------------------
1ynuA           SVMEVLKQRVHVVYSLSKDLGLPGFRVG------------------------------------------
1m7yA           SVMEVLKDRNCVVYSLSKDLGLPGFRVG------------------------------------------
1m4nA           SVMEVLKDRNCVVYSLSKDLGLPGFRVG------------------------------------------
1b8gB           SVMEVLKDRNCVVYSLSKDLGLPGFRVG------------------------------------------
1b8gA           SVMEVLKDRNCVVYSLSKDLGLPGFRVG------------------------------------------
2zyjA           ----------------------------------------------------------------------
2zg5A           ----------------------------------------------------------------------
2z1yB           ----------------------------------------------------------------------
2z1yA           ----------------------------------------------------------------------
2egyD           ----------------------------------------------------------------------
2egyC           ----------------------------------------------------------------------
2egyB           ----------------------------------------------------------------------
3cbfA           ----------------------------------------------------------------------
1vp4B           IFKIGGPERVVLLNTFSKVLA-PGLRIGVA----------------------------------------
1vp4A           IFKIGGPERVVLLNTFSKVLA-PGLRIGVA----------------------------------------
2zy2A           SLFSVCPRNTLLVYSFSKYFGATGWRLGV-----------------------------------------
1c7nA           SIDEQLADKTITFTAPSKTFNIAG----------------------------------------------
2zy5F           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy5E           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy5D           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy5B           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy5A           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy4F           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy4E           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy4D           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy4C           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy4B           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy4A           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy3F           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy3E           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy3D           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy3C           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy3B           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
2zy3A           SLFAICPENTLLVYSFSKYFGATGWRLGV-----------------------------------------
1lkcA           -PALKDNPHIWVLRSLTKFYAIPGLRLG------------------------------------------
1lc8A           -PALKDNPHIWVLRSLTKFYAIPGLRLG------------------------------------------
1lc7A           -PALKDNPHIWVLRSLTKFYAIPGLRLG------------------------------------------
1lc5A           -PALKDNPHIWVLRSLTKFYAIPGLRLG------------------------------------------
3dzzB           ----------------------------------------------------------------------
3dzzA           ----------------------------------------------------------------------
3fddA           SLFAICPANTLLVYSFSKYFGATGWRLGV-----------------------------------------
1d2fB           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           PAEIVDLVARSRRLHGLXXXXXXXXXXXXXXPVIAPQAAFYLYPDFGVWREWLGEAHGVTTGPELTRMLL
1bkgA           QEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAL
1b5oA           QEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAL
1b5pA           QEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAL
1bjwA           QEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAL
1gc3A           QEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAL
5bj3A           QEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAL
5bj4A           QEASRAFVEMAREAYRRRRDXXXXXXXXXXXKAVRPSGAFYVLMDTS------------PIAPDEVRAAL
1j32A           SQDCVQLAAFAERRRYMLDALNAMPGLECP----KPDGAFYMFPSI---------AKTGRSSLDFCSELL
1djuB           ERS-WKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPDTGL------------TSKKFSELML
1djuA           ERS-WKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPDTGL------------TSKKFSELML
1gd9A           ERS-WKAVEEMRKEYDRRRKLVWKRLNEMGLPTVKPKGAFYIFPDTGL------------TSKKFSELML
1o4sB           ----------------------------------------------------------------------
1o4sA           ----------------------------------------------------------------------
1xi9C           PMDY--LKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPEVGPWK--------------------
1xi9A           PMDY--LKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPEVGPWK--------------------
1xi9B           PMDY--LKEYMKKLKERRDYIYKRLNEIPGISTTKPQGAFYIFPEVGPWK--------------------
1v2eB           ----------------------------------------------------------------------
1v2eA           ----------------------------------------------------------------------
1v2dA           ----------------------------------------------------------------------
1bw0B           ----------------------------------------------------------------------
1bw0A           ----------------------------------------------------------------------
1w7nA           ----------------------------------------------------------------------
1w7lA           ----------------------------------------------------------------------
1u08B           ----------------------------------------------------------------------
1u08A           ----------------------------------------------------------------------
2z1zA           ----------------------------------------------------------------------
3ei7B           ----------------------------------------------------------------------
3ei7A           ----------------------------------------------------------------------
3ei6B           ----------------------------------------------------------------------
3ei6A           ----------------------------------------------------------------------
3dydB           ----------------------------------------------------------------------
3dydA           ----------------------------------------------------------------------
3b46B           ALKI-GYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSIPEDYPYPEEILNKGKDISHWLI
3b46A           ALKI-GYFEKMRQEYINKFKIFTSIFDELGLPYTAPEGTYFVLVDFSIPEDYPYPEEILNKGKDISHWLI
3eiaB           ----------------------------------------------------------------------
3eiaA           ----------------------------------------------------------------------
3fvsA           PSSY--FVQFPQAMQRCRDHMIRSLQSVGLKPII-PQGSYFLITDISDFKRKMPDLPGAVDEPRFVKWMI
3ei9B           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
3ei8A           ----------------------------------------------------------------------
3jtxB           EQHVID----NRRLY-------------------------------------------------------
2gb3F           ----------------------------------------------------------------------
2gb3E           ----------------------------------------------------------------------
2gb3D           ----------------------------------------------------------------------
2gb3C           ----------------------------------------------------------------------
2gb3B           ----------------------------------------------------------------------
2gb3A           ----------------------------------------------------------------------
2o0rB           ----------------------------------------------------------------------
2o0rA           ----------------------------------------------------------------------
3jtxA           EQHVID----NRRLY-------------------------------------------------------
2z61A           ETEINSMIKEFDRRRRLVLKYVKDFGWEVNNPI----GAYYVFPNIG------------EDGREFAYKLL
1yiyA           ----------------------------------------------------------------------
2r5cB           ----------------------------------------------------------------------
3e2yA           ----------------------------------------------------------------------
2z20B           ----------------------------------------------------------------------
2z20A           ----------------------------------------------------------------------
1yizA           ----------------------------------------------------------------------
2r5cA           ----------------------------------------------------------------------
3e2fA           ----------------------------------------------------------------------
3cq5B           ----------------------------------------------------------------------
3cq5A           ----------------------------------------------------------------------
3cq4B           ----------------------------------------------------------------------
3cq4A           ----------------------------------------------------------------------
3h14A           ----------------------------------------------------------------------
2zc0A           ----------------------------------------------------------------------
3ihjA           ----------------------------------------------------------------------
1iayA           ----------------------------------------------------------------------
1iaxA           ----------------------------------------------------------------------
3eleC           ----------------------------------------------------------------------
3eleA           ----------------------------------------------------------------------
2douB           PKEVVRGYARVYRERAL----GMAEALKGVLSLLPPRATMYLW---------------------------
2douA           PKEVVRGYARVYRERAL----GMAEALKGVLSLLPPRATMYLW---------------------------
3cq6A           ----------------------------------------------------------------------
1ynuA           ----------------------------------------------------------------------
1m7yA           ----------------------------------------------------------------------
1m4nA           ----------------------------------------------------------------------
1b8gB           ----------------------------------------------------------------------
1b8gA           ----------------------------------------------------------------------
2zyjA           ----------------------------------------------------------------------
2zg5A           ----------------------------------------------------------------------
2z1yB           ----------------------------------------------------------------------
2z1yA           ----------------------------------------------------------------------
2egyD           ----------------------------------------------------------------------
2egyC           ----------------------------------------------------------------------
2egyB           ----------------------------------------------------------------------
3cbfA           ----------------------------------------------------------------------
1vp4B           ----------------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------
2zy2A           ----------------------------------------------------------------------
1c7nA           ----------------------------------------------------------------------
2zy5F           ----------------------------------------------------------------------
2zy5E           ----------------------------------------------------------------------
2zy5D           ----------------------------------------------------------------------
2zy5B           ----------------------------------------------------------------------
2zy5A           ----------------------------------------------------------------------
2zy4F           ----------------------------------------------------------------------
2zy4E           ----------------------------------------------------------------------
2zy4D           ----------------------------------------------------------------------
2zy4C           ----------------------------------------------------------------------
2zy4B           ----------------------------------------------------------------------
2zy4A           ----------------------------------------------------------------------
2zy3F           ----------------------------------------------------------------------
2zy3E           ----------------------------------------------------------------------
2zy3D           ----------------------------------------------------------------------
2zy3C           ----------------------------------------------------------------------
2zy3B           ----------------------------------------------------------------------
2zy3A           ----------------------------------------------------------------------
1lkcA           ----------------------------------------------------------------------
1lc8A           ----------------------------------------------------------------------
1lc7A           ----------------------------------------------------------------------
1lc5A           ----------------------------------------------------------------------
3dzzB           ----------------------------------------------------------------------
3dzzA           ----------------------------------------------------------------------
3fddA           ----------------------------------------------------------------------
1d2fB           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           DRYGMGVLPAVEFGESTHALRVRVATSLLYGESEAQRYSALAAExxxxxxxxxxxxxxxxxxxxxxxxxx
1bkgA           LEAGVAVVPGTDFAAFGH-VRLSYATS-------------------------------------------
1b5oA           LEAGVAVVPGTDFAAFGH-VRLSYATS-------------------------------------------
1b5pA           LEAGVAVVPGTDFAAFGH-VRLSYATS-------------------------------------------
1bjwA           LEAGVAVVPGTDFAAFGH-VRLSYATS-------------------------------------------
1gc3A           LEAGVAVVPGTDFAAFGH-VRLSYATS-------------------------------------------
5bj3A           LEAGVAVVPGTDFAAFGH-VRLSYATS-------------------------------------------
5bj4A           LEAGVAVVPGTDFAAFGH-VRLSYATS-------------------------------------------
1j32A           DQHQVATVPGAAFG-ADDCIRLSYATDL------------------------------------------
1djuB           KEARVAVVPGSAFGKAGEGVRISYATAYEKLEEAMERMERVLKE--------------------------
1djuA           KEARVAVVPGSAFGKAGEGVRISYATAYEKLEEAMERMERVLKE--------------------------
1gd9A           KEARVAVVPGSAFGKAGEGY-VRISYATAYEKLE------------------------------------
1o4sB           ----------------------------------------------------------------------
1o4sA           ----------------------------------------------------------------------
1xi9C           ----------------------------------------------------------------------
1xi9A           ----------------------------------------------------------------------
1xi9B           ----------------------------------------------------------------------
1v2eB           ----------------------------------------------------------------------
1v2eA           ----------------------------------------------------------------------
1v2dA           ----------------------------------------------------------------------
1bw0B           ----------------------------------------------------------------------
1bw0A           ----------------------------------------------------------------------
1w7nA           ----------------------------------------------------------------------
1w7lA           ----------------------------------------------------------------------
1u08B           ----------------------------------------------------------------------
1u08A           ----------------------------------------------------------------------
2z1zA           ----------------------------------------------------------------------
3ei7B           ----------------------------------------------------------------------
3ei7A           ----------------------------------------------------------------------
3ei6B           ----------------------------------------------------------------------
3ei6A           ----------------------------------------------------------------------
3dydB           ----------------------------------------------------------------------
3dydA           ----------------------------------------------------------------------
3b46B           NELGVVAIPPTEFYIKEHLLRFAVCKDDAYLENAVERLKLL-----------------------------
3b46A           NELGVVAIPPTEFYIKEHLLRFAVCKDDAYLENAVERLKLL-----------------------------
3eiaB           ----------------------------------------------------------------------
3eiaA           ----------------------------------------------------------------------
3fvsA           KNKGLVAIPVSIFYSVPH----------------------------------------------------
3ei9B           ----------------------------------------------------------------------
3ei9A           ----------------------------------------------------------------------
3ei8A           ----------------------------------------------------------------------
3jtxB           ----------------------------------------------------------------------
2gb3F           ----------------------------------------------------------------------
2gb3E           ----------------------------------------------------------------------
2gb3D           ----------------------------------------------------------------------
2gb3C           ----------------------------------------------------------------------
2gb3B           ----------------------------------------------------------------------
2gb3A           ----------------------------------------------------------------------
2o0rB           ----------------------------------------------------------------------
2o0rA           ----------------------------------------------------------------------
3jtxA           ----------------------------------------------------------------------
2z61A           KEKFVALTPGIGFGKGKNYIRISYANS-------------------------------------------
1yiyA           ----------------------------------------------------------------------
2r5cB           ----------------------------------------------------------------------
3e2yA           ----------------------------------------------------------------------
2z20B           ----------------------------------------------------------------------
2z20A           ----------------------------------------------------------------------
1yizA           ----------------------------------------------------------------------
2r5cA           ----------------------------------------------------------------------
3e2fA           ----------------------------------------------------------------------
3cq5B           ----------------------------------------------------------------------
3cq5A           ----------------------------------------------------------------------
3cq4B           ----------------------------------------------------------------------
3cq4A           ----------------------------------------------------------------------
3h14A           ----------------------------------------------------------------------
2zc0A           ----------------------------------------------------------------------
3ihjA           ----------------------------------------------------------------------
1iayA           ----------------------------------------------------------------------
1iaxA           ----------------------------------------------------------------------
3eleC           ----------------------------------------------------------------------
3eleA           ----------------------------------------------------------------------
2douB           ----------------------------------------------------------------------
2douA           ----------------------------------------------------------------------
3cq6A           ----------------------------------------------------------------------
1ynuA           ----------------------------------------------------------------------
1m7yA           ----------------------------------------------------------------------
1m4nA           ----------------------------------------------------------------------
1b8gB           ----------------------------------------------------------------------
1b8gA           ----------------------------------------------------------------------
2zyjA           ----------------------------------------------------------------------
2zg5A           ----------------------------------------------------------------------
2z1yB           ----------------------------------------------------------------------
2z1yA           ----------------------------------------------------------------------
2egyD           ----------------------------------------------------------------------
2egyC           ----------------------------------------------------------------------
2egyB           ----------------------------------------------------------------------
3cbfA           ----------------------------------------------------------------------
1vp4B           ----------------------------------------------------------------------
1vp4A           ----------------------------------------------------------------------
2zy2A           ----------------------------------------------------------------------
1c7nA           ----------------------------------------------------------------------
2zy5F           ----------------------------------------------------------------------
2zy5E           ----------------------------------------------------------------------
2zy5D           ----------------------------------------------------------------------
2zy5B           ----------------------------------------------------------------------
2zy5A           ----------------------------------------------------------------------
2zy4F           ----------------------------------------------------------------------
2zy4E           ----------------------------------------------------------------------
2zy4D           ----------------------------------------------------------------------
2zy4C           ----------------------------------------------------------------------
2zy4B           ----------------------------------------------------------------------
2zy4A           ----------------------------------------------------------------------
2zy3F           ----------------------------------------------------------------------
2zy3E           ----------------------------------------------------------------------
2zy3D           ----------------------------------------------------------------------
2zy3C           ----------------------------------------------------------------------
2zy3B           ----------------------------------------------------------------------
2zy3A           ----------------------------------------------------------------------
1lkcA           ----------------------------------------------------------------------
1lc8A           ----------------------------------------------------------------------
1lc7A           ----------------------------------------------------------------------
1lc5A           ----------------------------------------------------------------------
3dzzB           ----------------------------------------------------------------------
3dzzA           ----------------------------------------------------------------------
3fddA           ----------------------------------------------------------------------
1d2fB           ----------------------------------------------------------------------
1d2fA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxx
1bkgA           ----------
1b5oA           ----------
1b5pA           ----------
1bjwA           ----------
1gc3A           ----------
5bj3A           ----------
5bj4A           ----------
1j32A           ----------
1djuB           ----------
1djuA           ----------
1gd9A           ----------
1o4sB           ----------
1o4sA           ----------
1xi9C           ----------
1xi9A           ----------
1xi9B           ----------
1v2eB           ----------
1v2eA           ----------
1v2dA           ----------
1bw0B           ----------
1bw0A           ----------
1w7nA           ----------
1w7lA           ----------
1u08B           ----------
1u08A           ----------
2z1zA           ----------
3ei7B           ----------
3ei7A           ----------
3ei6B           ----------
3ei6A           ----------
3dydB           ----------
3dydA           ----------
3b46B           ----------
3b46A           ----------
3eiaB           ----------
3eiaA           ----------
3fvsA           ----------
3ei9B           ----------
3ei9A           ----------
3ei8A           ----------
3jtxB           ----------
2gb3F           ----------
2gb3E           ----------
2gb3D           ----------
2gb3C           ----------
2gb3B           ----------
2gb3A           ----------
2o0rB           ----------
2o0rA           ----------
3jtxA           ----------
2z61A           ----------
1yiyA           ----------
2r5cB           ----------
3e2yA           ----------
2z20B           ----------
2z20A           ----------
1yizA           ----------
2r5cA           ----------
3e2fA           ----------
3cq5B           ----------
3cq5A           ----------
3cq4B           ----------
3cq4A           ----------
3h14A           ----------
2zc0A           ----------
3ihjA           ----------
1iayA           ----------
1iaxA           ----------
3eleC           ----------
3eleA           ----------
2douB           ----------
2douA           ----------
3cq6A           ----------
1ynuA           ----------
1m7yA           ----------
1m4nA           ----------
1b8gB           ----------
1b8gA           ----------
2zyjA           ----------
2zg5A           ----------
2z1yB           ----------
2z1yA           ----------
2egyD           ----------
2egyC           ----------
2egyB           ----------
3cbfA           ----------
1vp4B           ----------
1vp4A           ----------
2zy2A           ----------
1c7nA           ----------
2zy5F           ----------
2zy5E           ----------
2zy5D           ----------
2zy5B           ----------
2zy5A           ----------
2zy4F           ----------
2zy4E           ----------
2zy4D           ----------
2zy4C           ----------
2zy4B           ----------
2zy4A           ----------
2zy3F           ----------
2zy3E           ----------
2zy3D           ----------
2zy3C           ----------
2zy3B           ----------
2zy3A           ----------
1lkcA           ----------
1lc8A           ----------
1lc7A           ----------
1lc5A           ----------
3dzzB           ----------
3dzzA           ----------
3fddA           ----------
1d2fB           ----------
1d2fA           ----------