[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56417.1

[Show Plain Result]

#ERROR : Can't open dsspfile "2nq2C.bssp"
#ERROR : Can't open dsspfile "2nq2D.bssp"
#ERROR : Can't open dsspfile "2qi9C.bssp"
#ERROR : Can't open dsspfile "1l7vC.bssp"
#ERROR : Can't open dsspfile "2oukB.bssp"
#ERROR : Can't open dsspfile "2oljA.bssp"
#ERROR : Can't open dsspfile "2yyzA.bssp"
#ERROR : Can't open dsspfile "1xefA.bssp"
#ERROR : Can't open dsspfile "1mt0A.bssp"
#ERROR : Can't open dsspfile "2it1B.bssp"
#ERROR : Can't open dsspfile "2it1A.bssp"
#ERROR : Can't open dsspfile "2ffaA.bssp"
#ERROR : Can't open dsspfile "2ff7A.bssp"
#ERROR : Can't open dsspfile "3d31A.bssp"
#ERROR : Can't open dsspfile "1q12A.bssp"
#ERROR : Can't open dsspfile "3fh6A.bssp"
#ERROR : Can't open dsspfile "2awoA.bssp"
#ERROR : Can't open dsspfile "2awnB.bssp"
#ERROR : Can't open dsspfile "3dhwC.bssp"
#ERROR : Can't open dsspfile "2fgkA.bssp"
#ERROR : Can't open dsspfile "2ffbA.bssp"
#ERROR : Can't open dsspfile "3b5jA.bssp"
#ERROR : Can't open dsspfile "2r6gB.bssp"
#ERROR : Can't open dsspfile "2r6gA.bssp"
#ERROR : Can't open dsspfile "1g291.bssp"
#ERROR : Can't open dsspfile "1gajA.bssp"
#ERROR : Can't open dsspfile "1g9xA.bssp"
#ERROR : Can't open dsspfile "2pcjA.bssp"
#ERROR : Can't open dsspfile "1g6hA.bssp"
#ERROR : Can't open dsspfile "1b0uA.bssp"
#ERROR : Can't open dsspfile "1oxvA.bssp"
#ERROR : Can't open dsspfile "1oxsC.bssp"
#ERROR : Can't open dsspfile "1l2tB.bssp"
#ERROR : Can't open dsspfile "1l2tA.bssp"
#ERROR : Can't open dsspfile "3fvqB.bssp"
#ERROR : Can't open dsspfile "3fvqA.bssp"
#ERROR : Can't open dsspfile "2awoC.bssp"
#ERROR : Can't open dsspfile "2onkA.bssp"
#ERROR : Can't open dsspfile "3g60A.bssp"
#ERROR : Can't open dsspfile "3g5uA.bssp"
#ERROR : Can't open dsspfile "1mv5D.bssp"
#ERROR : Can't open dsspfile "1mv5A.bssp"
#ERROR : Can't open dsspfile "2d62A.bssp"
#ERROR : Can't open dsspfile "3bk7A.bssp"
#ERROR : Can't open dsspfile "3gfoA.bssp"
#ERROR : Can't open dsspfile "2d2fA.bssp"
#ERROR : Can't open dsspfile "1jj7A.bssp"
#ERROR : Can't open dsspfile "2d2eA.bssp"
#ERROR : Can't open dsspfile "2ixeD.bssp"
#ERROR : Can't open dsspfile "2ixfD.bssp"
#ERROR : Can't open dsspfile "2ixfC.bssp"
#ERROR : Can't open dsspfile "2ixfA.bssp"
#ERROR : Can't open dsspfile "2awoD.bssp"
#ERROR : Can't open dsspfile "2ixeA.bssp"
#ERROR : Can't open dsspfile "2awnD.bssp"
#ERROR : Can't open dsspfile "1yqtA.bssp"
#ERROR : Can't open dsspfile "2hydA.bssp"
#ERROR : Can't open dsspfile "2awnC.bssp"
#ERROR : Can't open dsspfile "2zu0C.bssp"
#ERROR : Can't open dsspfile "2d3wD.bssp"
#ERROR : Can't open dsspfile "2d3wC.bssp"
#ERROR : Can't open dsspfile "2d3wB.bssp"
#ERROR : Can't open dsspfile "2d3wA.bssp"
#ERROR : Can't open dsspfile "2ihyB.bssp"
#ERROR : Can't open dsspfile "2awnA.bssp"
#ERROR : Can't open dsspfile "1v43A.bssp"
#ERROR : Can't open dsspfile "1f3oA.bssp"
#ERROR : Can't open dsspfile "2ihyA.bssp"
#ERROR : Can't open dsspfile "1pf4A.bssp"
#ERROR : Can't open dsspfile "2ixgA.bssp"
#ERROR : Can't open dsspfile "1oxxK.bssp"
#ERROR : Can't open dsspfile "1sgwA.bssp"
#ERROR : Can't open dsspfile "2ix8A.bssp"
#ERROR : Can't open dsspfile "2ix3A.bssp"
#ERROR : Can't open dsspfile "2iwhB.bssp"
#ERROR : Can't open dsspfile "2iw3B.bssp"
#ERROR : Can't open dsspfile "2iw3A.bssp"
#ERROR : Can't open dsspfile "1z47B.bssp"
#ERROR : Can't open dsspfile "1z47A.bssp"
#ERROR : Can't open dsspfile "1ji0A.bssp"
#ERROR : Can't open dsspfile "1z2rA.bssp"
#ERROR : Can't open dsspfile "2cbzA.bssp"
#ERROR : Can't open dsspfile "3b60A.bssp"
#ERROR : Can't open dsspfile "2yz2B.bssp"
#ERROR : Can't open dsspfile "2yz2A.bssp"
#ERROR : Can't open dsspfile "1vplA.bssp"
#ERROR : Can't open dsspfile "2pjzA.bssp"
#ERROR : Can't open dsspfile "1xfaA.bssp"
#ERROR : Can't open dsspfile "1xf9D.bssp"
#ERROR : Can't open dsspfile "1xf9C.bssp"
#ERROR : Can't open dsspfile "1xf9B.bssp"
#ERROR : Can't open dsspfile "1xf9A.bssp"
#ERROR : Can't open dsspfile "1r10A.bssp"
#ERROR : Can't open dsspfile "1r0zD.bssp"
#ERROR : Can't open dsspfile "1r0zC.bssp"
#ERROR : Can't open dsspfile "1r0zB.bssp"
#ERROR : Can't open dsspfile "1r0zA.bssp"
#ERROR : Can't open dsspfile "1r0xD.bssp"
#ERROR : Can't open dsspfile "1r0xC.bssp"
#ERROR : Can't open dsspfile "1r0xB.bssp"
#ERROR : Can't open dsspfile "1r0xA.bssp"
#ERROR : Can't open dsspfile "1r0wC.bssp"
#ERROR : Can't open dsspfile "1r0wB.bssp"
#ERROR : Can't open dsspfile "1r0wA.bssp"
#ERROR : Can't open dsspfile "1q3hD.bssp"
#ERROR : Can't open dsspfile "1q3hC.bssp"
#ERROR : Can't open dsspfile "1q3hB.bssp"
#ERROR : Can't open dsspfile "1q3hA.bssp"
#ERROR : Can't open dsspfile "2ghiA.bssp"
#ERROR : Can't open dsspfile "1xmiE.bssp"
#ERROR : Can't open dsspfile "1xmiD.bssp"
#ERROR : Can't open dsspfile "1xmiC.bssp"
#ERROR : Can't open dsspfile "1xmiB.bssp"
#ERROR : Can't open dsspfile "1xmiA.bssp"
#ERROR : Can't open dsspfile "2pzgB.bssp"
#ERROR : Can't open dsspfile "2pzgA.bssp"
#ERROR : Can't open dsspfile "2pzfB.bssp"
#ERROR : Can't open dsspfile "2pzfA.bssp"
#ERROR : Can't open dsspfile "2pzeB.bssp"
#ERROR : Can't open dsspfile "2pzeA.bssp"
#ERROR : Can't open dsspfile "2bbtB.bssp"
#ERROR : Can't open dsspfile "2bbtA.bssp"
#ERROR : Can't open dsspfile "2bbsB.bssp"
#ERROR : Can't open dsspfile "2bbsA.bssp"

## Summary of PDB Search
:284
    2e-18  33%  2nq2C  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    6e-18  34%  2nq2D  [x.x.x] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    2e-15  39%  2qi9C  [x.x.x] VITAMIN B12 IMPORT ATP-BINDING PROTEIN BTUD
    3e-15  39%  1l7vC  [c.37.1] VITAMIN B12 TRANSPORT ATP-BINDING PROTEIN BTUD
    5e-14  31%  2oukB  [x.x.x] PROTEIN ARTP
    5e-14  31%  2oljA  [x.x.x] AMINO ACID ABC TRANSPORTER
    3e-13  33%  2yyzA  [x.x.x] SUGAR ABC TRANSPORTER, ATP-BINDING PROTEIN
    5e-13  25%  1xefA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-13  25%  1mt0A  [c.37.1] HAEMOLYSIN SECRETION ATP-BINDING PROTEIN
    5e-13  27%  2it1B  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    5e-13  27%  2it1A  [x.x.x] 362AA LONG HYPOTHETICAL MALTOSE/MALTODEXTRIN
    5e-13  25%  2ffaA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-13  25%  2ff7A  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    5e-13  31%  3d31A  [x.x.x] SULFATE/MOLYBDATE ABC TRANSPORTER, ATP-BINDING
    7e-13  24%  1q12A  [c.37.1 - b.40.6] MALTOSE/MALTODEXTRIN TRANSPORT ATP-BINDING
    7e-13  24%  3fh6A  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-13  24%  2awoA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    7e-13  24%  2awnB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    9e-13  30%  3dhwC  [x.x.x] METHIONINE IMPORT ATP-BINDING PROTEIN METN
    1e-12  25%  2fgkA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-12  25%  2ffbA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    1e-12  25%  3b5jA  [x.x.x] ALPHA-HEMOLYSIN TRANSLOCATION ATP-BINDING
    2e-12  23%  2r6gB  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-12  23%  2r6gA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    5e-12  29%  1g291  [c.37.1 - b.40.6 - b.40.6] MALTOSE TRANSPORT PROTEIN MALK
    6e-12  27%  1gajA  [c.37.1] HIGH-AFFINITY BRANCHED CHAIN AMINO ACID
    6e-12  28%  1g9xA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    8e-12  31%  2pcjA  [x.x.x] LIPOPROTEIN-RELEASING SYSTEM ATP-BINDING PROTEIN
    8e-12  28%  1g6hA  [c.37.1] HIGH-AFFINITY BRANCHED-CHAIN AMINO ACID
    8e-12  29%  1b0uA  [c.37.1] HISTIDINE PERMEASE
    1e-11  26%  1oxvA  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    1e-11  26%  1oxsC  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    3e-11  27%  1l2tB  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-11  27%  1l2tA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    3e-11  45%  3fvqB  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    3e-11  45%  3fvqA  [x.x.x] FE(3+) IONS IMPORT ATP-BINDING PROTEIN FBPC
    3e-11  24%  2awoC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    4e-11  40%  2onkA  [x.x.x] MOLYBDATE/TUNGSTATE ABC TRANSPORTER, ATP-BINDING
    4e-11  29%  3g60A  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    4e-11  29%  3g5uA  [x.x.x] MULTIDRUG RESISTANCE PROTEIN 1A
    5e-11  26%  1mv5D  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    5e-11  26%  1mv5A  [c.37.1] MULTIDRUG RESISTANCE ABC TRANSPORTER ATP-BINDING
    9e-11  31%  2d62A  [x.x.x] MULTIPLE SUGAR-BINDING TRANSPORT ATP-BINDING
    9e-11  32%  3bk7A  [x.x.x] ABC TRANSPORTER ATP-BINDING PROTEIN
    1e-10  29%  3gfoA  [x.x.x] COBALT IMPORT ATP-BINDING PROTEIN CBIO 1
    1e-10  43%  2d2fA  [x.x.x] SUFC PROTEIN
    3e-10  28%  1jj7A  [c.37.1] PEPTIDE TRANSPORTER TAP1
    7e-10  44%  2d2eA  [x.x.x] SUFC PROTEIN
    1e-09  30%  2ixeD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-09  27%  2ixfD  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-09  27%  2ixfC  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-09  27%  2ixfA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    2e-09  32%  2awoD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    3e-09  27%  2ixeA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    5e-09  31%  2awnD  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    6e-09  32%  1yqtA  [x.x.x] RNASE L INHIBITOR
    6e-09  25%  2hydA  [x.x.x] ABC TRANSPORTER HOMOLOG
    6e-09  26%  2awnC  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    8e-09  37%  2zu0C  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-09  37%  2d3wD  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-09  37%  2d3wC  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-09  37%  2d3wB  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    8e-09  37%  2d3wA  [x.x.x] PROBABLE ATP-DEPENDENT TRANSPORTER SUFC
    1e-08  31%  2ihyB  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-08  34%  2awnA  [x.x.x] MALTOSE/MALTODEXTRIN IMPORT ATP-BINDING PROTEIN
    2e-08  30%  1v43A  [c.37.1 - b.40.6 - b.40.6] SUGAR-BINDING TRANSPORT
    2e-08  28%  1f3oA  [c.37.1] HYPOTHETICAL ABC TRANSPORTER ATP-BINDING PROTEIN
    4e-08  32%  2ihyA  [x.x.x] ABC TRANSPORTER, ATP-BINDING PROTEIN
    7e-08  22%  1pf4A  [f.37.1 - c.37.1] TRANSPORT ATP-BINDING PROTEIN MSBA
    7e-08  26%  2ixgA  [x.x.x] ANTIGEN PEPTIDE TRANSPORTER 1
    1e-07  37%  1oxxK  [c.37.1 - b.40.6] ABC TRANSPORTER, ATP BINDING PROTEIN
    2e-07  26%  1sgwA  [c.37.1] PUTATIVE ABC TRANSPORTER
    2e-07  45%  2ix8A  [x.x.x] ELONGATION FACTOR 3A
    2e-07  47%  2ix3A  [x.x.x] ELONGATION FACTOR 3
    2e-07  47%  2iwhB  [x.x.x] ELONGATION FACTOR 3A
    2e-07  45%  2iw3B  [x.x.x] ELONGATION FACTOR 3A
    2e-07  45%  2iw3A  [x.x.x] ELONGATION FACTOR 3A
    3e-07  44%  1z47B  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    3e-07  44%  1z47A  [x.x.x] PUTATIVE ABC-TRANSPORTER ATP-BINDING PROTEIN
    4e-07  36%  1ji0A  [c.37.1] ABC TRANSPORTER
    3e-06  32%  1z2rA  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    3e-06  26%  2cbzA  [x.x.x] MULTIDRUG RESISTANCE-ASSOCIATED PROTEIN 1
    3e-06  32%  3b60A  [x.x.x] LIPID A EXPORT ATP-BINDING/PERMEASE PROTEIN MSBA
    5e-06  43%  2yz2B  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-06  43%  2yz2A  [x.x.x] PUTATIVE ABC TRANSPORTER ATP-BINDING PROTEIN
    5e-06  22%  1vplA  [c.37.1] ABC TRANSPORTER, ATP-BINDING PROTEIN
    1e-05  24%  2pjzA  [x.x.x] HYPOTHETICAL PROTEIN ST1066
    3e-05  38%  1xfaA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1xf9D  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1xf9C  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1xf9B  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1xf9A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r10A  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0zD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0zC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0zB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0zA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0xD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0xC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0xB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0xA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0wC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0wB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1r0wA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1q3hD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1q3hC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1q3hB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    3e-05  38%  1q3hA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    4e-05  23%  2ghiA  [x.x.x] TRANSPORT PROTEIN
    6e-04  35%  1xmiE  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  1xmiD  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  1xmiC  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  1xmiB  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  1xmiA  [c.37.1] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2pzgB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2pzgA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2pzfB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2pzfA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2pzeB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2pzeA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2bbtB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2bbtA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2bbsB  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
    6e-04  35%  2bbsA  [x.x.x] CYSTIC FIBROSIS TRANSMEMBRANE CONDUCTANCE
:284

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxGTVVLGARHLSKSYGARTVLDDVSLDVRTGEVLALVGPNGAG
2nq2C           --------------------------------LSVENLGFYYQAENFLQQLNFDLNKGDILAVLGQNGCG
2nq2D           --------------------------------------------------LNFDLNKGDILAVLGQNGCG
2qi9C           ---------------------------------------------TRLGPLSGEVRAGEILHLVGPNGAG
1l7vC           ---------------------------------------------TRLGPLSGEVRAGEILHLVGPNGAG
2oukB           -------------------------------MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSG
2oljA           -------------------------------MIDVHQLKKSFGSLEVLKGINVHIREGEVVVVIGPSGSG
2yyzA           ------------------------------------NLKKYFGKVKAVDGVSFEVKDGEFVALLGPSGCG
1xefA           ----------------------------------------------ILDNINLSIKQGEVIGIVGRSGSG
1mt0A           ----------------------------------------------ILDNINLSIKQGEVIGIVGRSGSG
2it1B           ------------------------------VEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSG
2it1A           ------------------------------VEIKLENIVKKFGNFTALNNINLKIKDGEFMALLGPSGSG
2ffaA           ----------------------------------------------ILDNINLSIKQGEVIGIVGRSGSG
2ff7A           ----------------------------------------------ILDNINLSIKQGEVIGIVGRSGSG
3d31A           -----------------------------------------------LDNLSLKVESGEYFVILGPTGAG
1q12A           -----------------------------------QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
3fh6A           -----------------------------------QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2awoA           -----------------------------------QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2awnB           -----------------------------------QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
3dhwC           ------------------------------------------GTRTILNNVSLHVPAGQIYGVIGASGAG
2fgkA           ----------------------------------------------ILDNINLSIKQGEVIGIVGRSGSG
2ffbA           ----------------------------------------------ILDNINLSIKQGEVIGIVGRSGSG
3b5jA           ----------------------------------------------ILDNINLSIKQGEVIGIVGRAGSG
2r6gB           -----------------------------------QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2r6gA           -----------------------------------QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
1g291           ---------------------------------------KVFGEVTAVREMSLEVKDGEFMILLGPSGCG
1gajA           -------------------------------ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSG
1g9xA           -------------------------------ILRTENIVKYFGEFKALDGVSISVCKGDVTLIIGPNGSG
2pcjA           -------------------------------ILRAENIKKVIRGYEILKGISLSVKKGEFVSIIGASGSG
1g6hA           -------------------------------ILRTENIVKYFGEFKALDGVSISVNKGDVTLIIGPNGSG
1b0uA           -------------------------------------LHKRYGGHEVLKGVSLQARAGDVXXXXXXXXXX
1oxvA           -----------------------------------KNVSKVFGKVVALDNVNINIENGERFGILGPSGAG
1oxsC           -----------------------------------KNVSKVFGKVVALDNVNINIENGERFGILGPSGAG
1l2tB           -----------------------------------------------LKNVNLNIKEGEFVSIMGPSGSG
1l2tA           -----------------------------------------------LKNVNLNIKEGEFVSIMGPSGSG
3fvqB           -----------------------------TAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCG
3fvqA           -----------------------------TAALHIGHLSKSFQNTPVLNDISLSLDPGEILFIIGASGCG
2awoC           ---------------------------------------------TVSKDINLDIHEGEFVVFVGPSGCG
2onkA           --------------------------------------------------LNVDFEMGDYCVLLGPTGAG
3g60A           ----------------------------------------------VLQGLSLEVKKGQTLALVGSSGCG
3g5uA           ----------------------------------------------VLQGLSLEVKKGQTLALVGSSGCG
1mv5D           -------------------------------MLSARHVDFAYDSEQILRDISFEAQPNSIIAFAGPSGGG
1mv5A           -------------------------------MLSARHVDFAYDSEQILRDISFEAQPNSIIAFAGPSGGG
2d62A           ---------------------------------------KRFGDVTAVKDLSLEIKDGEFLVLLGPSGCG
3bk7A           -------------------------------------LVKDYGSFK-LEVEPGEIRKGEVIGIVGPNGIG
3gfoA           -------------------------------ILKVEELNYNYSDGTALKGINMNIKRGEVTAILGGNGVG
2d2fA           --------------------------------LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAG
1jj7A           ----------------------------------------------VLQGLTFTLRPGEVTALVGPNGSG
2d2eA           --------------------------------LEIRDLWASIDGETILKGVNLVVPKGEVHALMGPNGAG
2ixeD           ----------------------------------------------VLQGLTFTLYPGKVTALVGPNGSG
2ixfD           ----------------------------------------------VLQGLTFTLYPGKVTALVGPNGSG
2ixfC           ----------------------------------------------VLQGLTFTLYPGKVTALVGPNGSG
2ixfA           ----------------------------------------------VLQGLTFTLYPGKVTALVGPNGSG
2awoD           -----------------------------------QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
2ixeA           ----------------------------------------------VLQGLTFTLYPGKVTALVGPNGSG
2awnD           -----------------------------------QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
1yqtA           -------------------------------------LVKDYGSFR-LEVEPGEIKKGEVIGIVGPNGIG
2hydA           ------------------------------------HVSFQYNDNEILKDINLSIEKGETVAFVGMSGGG
2awnC           ---------------------------------------------TVSKDINLDIHEGEFVVFVGPSGCG
2zu0C           -------------------------------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSG
2d3wD           -------------------------------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSG
2d3wC           -------------------------------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSG
2d3wB           -------------------------------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSG
2d3wA           -------------------------------MLSIKDLHVSVEDKAILRGLSLDVHPGEVHAIMGPNGSG
2ihyB           --------------------------------------------KTILKKISWQIAKGDKWILYGLNGAG
2awnA           -----------------------------------QNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCG
1v43A           ------------------------------------NLTKRFGNFTAVNKLNLTIKDGEFLVLLGPSGCG
1f3oA           -----------------------------------KNVTKTYKGEEILKNVNLNIKEGEFVS-IGPSGSG
2ihyA           --------------------------------------------KTILKKISWQIAKGDKWILYGLNGAG
1pf4A           --------------------------------------------KPALSHVSFSIPQGKTVALVGRSGSG
2ixgA           ----------------------------------------------VLQGLTFTLYPGKVTALVGPNGSG
1oxxK           -----------------------------------KNVSKVFGKVVALDNVNINIENGERFGILGPSGAG
1sgwA           --------------------------------LEIRDLSVGYD-KPVLERITMTIEKGNVVNFHGPNGIG
2ix8A           -----------------------------------------------ITDINFQCSLSSRIAVIGPNGAG
2ix3A           -----------------------------------------------ITDINFQCSLSSRIAVIGPNGAG
2iwhB           -----------------------------------------------ITDINFQCSLSSRIAVIGPNGAG
2iw3B           -----------------------------------------------ITDINFQCSLSSRIAVIGPNGAG
2iw3A           -----------------------------------------------ITDINFQCSLSSRIAVIGPNGAG
1z47B           ------------------------------------------GARSVRG-VSFQIREGEMVGLLGPSGSG
1z47A           ------------------------------------------GARSVRG-VSFQIREGEMVGLLGPSGSG
1ji0A           ------------------------------IVLEVQSLHVYYGAIHAIKGIDLKVPRGQIVTLIGANGAG
1z2rA           -----------------------------------RNVTFTYPGREVLRNINLKIPAGKTVALVGRSGSG
2cbzA           -----------------------------------------------LNGITFSIPEGALVAVVGQVGCG
3b60A           -----------------------------------RNVTFTYPGREVLRNINLKIPAGKTVALVGRSGSG
2yz2B           --------------------------------------------KKALENVSLVINEGECLLVAGNTGSG
2yz2A           --------------------------------------------KKALENVSLVINEGECLLVAGNTGSG
1vplA           ----------------------------GAVVV--KDLRKRIGKKEILKXXXXXXXXXXXXXXXXPNGAG
2pjzA           --------------------------------------------RFSLENINLEVN-GEKVIILGPNGSG
1xfaA           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1xf9D           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1xf9C           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1xf9B           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1xf9A           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r10A           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0zD           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0zC           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0zB           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0zA           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0xD           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0xC           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0xB           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0xA           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0wC           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0wB           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1r0wA           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1q3hD           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1q3hC           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1q3hB           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
1q3hA           ----------------------------------------------VLKNINLNIEKGEMLAITGSTGSG
2ghiA           -----------------------------------------------LKSINFFIPSGTTCALVGHTGSG
1xmiE           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           KSTLLSILTGDTPPDRGEVTVLDRPLAAWSPAELALRRAVLPQSFTVSFPFDVVDVVHMGRAPWXXXXXX
2nq2C           KSTLLDLLLGIHRPIQGKI-------------EVYQSIGFVPQFFSSPFAYSVLDIVLMGRSTHTFAKPK
2nq2D           KSTLLDLLLGIHRPIQGKI-------------EVYQSIGFVPQFFSSPFAYSVLDIVLMGRSTHTFAKPK
2qi9C           KSTLLA-RAGTS--GKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQ-------HD
1l7vC           KSTLLA-RAGTS--GKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPPFATPVWHYLTLHQ-------HD
2oukB           KSTFLRCLNLLEDFXXXXXXXXXXNLKAKDTNLNKVREEVVFQRFNL-FPHMTV-LNNITLAPMKVRKWP
2oljA           KSTFLRCLNLLEDFXXXXXXXXXXNLKAKDTNLNKVREEVVFQRFNL-FPHMTV-LNNITLAPMKVRKWP
2yyzA           KTTTLLMLAGIYKPTSGEVLVNDIPPKYREVGMVFQNYALYPHMTNIAFPLDEVEVVEIAR---------
1xefA           KSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLRSIIDNISLANPGMSVEKVIYAA
1mt0A           KSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLRSIIDNISLANPGMSVEKVIYAA
2it1B           KSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDLVFQNWALYPHMTVAFPLE------LRKAP-------
2it1A           KSTLLYTIAGIYKPTSGKIYFDEKDVTELPPKDLVFQNWALYPHMTVAFPLE------LRKAP-------
2ffaA           KSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLRSIIDNISLANPGMSVEKVIYAA
2ff7A           KSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLRSIIDNISLANPGMSVEKVIYAA
3d31A           KTLFLELIAGFHVPDSGRILLDGKDVTDLSPEKHDI--AFVYQNYSLFPHMNVKKNLEFG-----MRMKK
1q12A           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGV--GMVFQSYALYPHLSVAENMSFGLK--LAGAKK
3fh6A           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGV--GMVFQSYALYPHLSVAENMSFGLK--LAGAKK
2awoA           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGV--GMVFQSYALYPHLSVAENMSFGLK--LAGAKK
2awnB           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGV--GMVFQSYALYPHLSVAENMSFGLK--LAGAKK
3dhwC           KSTLIRCVNLLERPTEGSVLVDGQELTTLSESELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTP
2fgkA           KSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLRSIIDNISLANPGMSVEKVIYAA
2ffbA           KSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLRSIIDNISLANPGMSVEKVIYAA
3b5jA           KSTLTKLIQRFYIPENGQVLIDGHDLALADPNWLRRQVGVVLQDNVLRSIIDNISLANPGMSVEKVIYAA
2r6gB           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGV--GMVFQSYALYPHLSVAENMSFGLK--LAGAKK
2r6gA           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGV--GMVFQSYALYPHLSVAENMSFGLK--LAGAKK
1g291           KTTTLRMIAGLEEPSRGQIYIGDKLVADPEKGIFVPPKAMVFQSYALYPHMTVYDNIKLRKVP------R
1gajA           KSTLINVITGFLKADEGRVYFENKDITNKEPAELIVRTFQTPQPLKEMTVLELIGEINPGESPLKWIPKE
1g9xA           KSTLINVITGFLKADEGRVYFENKDITNKEPAELIVRTFQTPQPLKEMTVLELIGEINPGESPLKWIPKE
2pcjA           KSTLLYILGLLDAPTEGKVFLEGKEVDYTNEKELSLLRN-RKLGFVFQFHYVIVPMLKMGK-------PK
1g6hA           KSTLINVITGFLKADEGRVYFENKDITNKEPAELIVRTFQTPQPLKEMTVLELIGEICPGESPLKWIPKE
1b0uA           KSTFLRCINFLEKPSEGAIIVKDGQLKVADKNQLRLLRTRLTMVFQHFNLWSHMTVLNVMEAPIQVLGLS
1oxvA           KTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMS
1oxsC           KTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMS
1l2tB           KSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRG
1l2tA           KSTMLNIIGCLDKPTEGEVYIDNIKTNDLDDDELTIRRDKIGFVFQQFNLIPLLTALENVELPLIFKYRG
3fvqB           KTTLLRCLAGFEQPDSGEISL-------------------------------------------------
3fvqA           KTTLLRCLAGFEQPDSGEISL-------------------------------------------------
2awoC           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVALYPHLSVA--------ENMSFGLKLAGAKK
2onkA           KSVFLELIAGIVKPDRGEVRLNGADITPLPPERRGI--GFVPQDYALFPHLSVYRNIAYG----LXXXXX
3g60A           KSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQE-PILFDCSIAENIAYGDNSRVVSYEE
3g5uA           KSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQE-PILFDCSIAENIAYGDNSRVVSYEE
1mv5D           KSTIFSLLERFYQPTAGEITIDGQPIIGFVSQDSAIMAGTIRENLTYGLEGDYTD-----EDLWQVLDLA
1mv5A           KSTIFSLLERFYQPTAGEITIDGQPIIGFVSQDSAIMAGTIRENLTYGLEGDYTD-----EDLWQVLDLA
2d62A           KTTTLRI-AGLEEPTRGQIYIEDNLVAVFVPPK--ERDVAVFQSYAL-YPHTVYDNIAF---PLKLRKVP
3bk7A           KTTFVKMLAGVEEPTEGKV-------------EWDLTVAYKPQYIKAEYEGTVYELLS------KIDSSK
3gfoA           KSTLFQNFNGILKPSSGRILFDNKPIDYSRKGIMKLRESVFQDPDNQLFSASVYQDVSFGAV--NMKLPE
2d2fA           KSTLGKILAGDPTVERGEILLDGENILELSPDERARKGLFLAFQYPVEVP--------------------
1jj7A           KSTVAALLQNLYQPTGGQLLLDGKPLPQYEHRYLHRQVAAVPQVFGRSLQENIAYGLTQKPTMEEITAAA
2d2eA           KSTLGKILAGDPTVERGEILLDGENILELSPDERARKGLFLAFQYPV-----------------------
2ixeD           KSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQAAVGPLLFGRSFRENI--AYGLTRTPTMEEITA
2ixfD           KSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVGQLFGRSFRENIAYGLTRTPTMEEITAVA
2ixfC           KSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVPLLFGRSFRENIAYGLTRTPTMEEITAVA
2ixfA           KSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVPLLFGRSFRENIAYGLTRTPTMEEITAVA
2awoD           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGV-GMVEPSVFLLDEPLDAALRVQM-----------
2ixeA           KSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVPLLFGRSFRENIAYGLTRTPTMEEITAVA
2awnD           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGV-GMVEPSVFLLDEPLSNLD---------------
1yqtA           KTTFVK-LAGVEEPTEGKI-------------EWDLTVAYKPQYIKADYEGTVYELLSKIDAS------K
2hydA           KSTLINLIPRFYDVTSGQILIDGHNIKDFLTGSLR-NQIGLVQQDNILFSDTVKENILLGRTDEEVVEAA
2awnC           KSTLLRMIAGLGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAH---------
2zu0C           KSTLSATLAGDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIP--------------------
2d3wD           KSTLSATLAGDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIP--------------------
2d3wC           KSTLSATLAGDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIP--------------------
2d3wB           KSTLSATLAGDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIP--------------------
2d3wA           KSTLSATLAGDYEVTGGTVEFKGKDLLALSPEDRAGEGIFMAFQYPVEIP--------------------
2ihyB           KTTLLNILNAYEPATSGTVNLFGKPGKVGYSAE-TVRQHIGFVSHSLLEKFQVIDVVISGAFKSIGVYQD
2awnA           KSTLLRMIAGLETITSGDLFIGEKRMNDTPPAE-------------------------------------
1v43A           KTTTLRMIAGLEEPTEGRIYFGDRDVTYLPPKDRNI--SMVFQHMTVKFPKDEID----KRVRW------
1f3oA           KSTLNIIGCLDKPTE-GEVYIDNIKTNDLDDDELTIRRDKIGQQFNLIPLLTALENVELPLIFKYRGASG
2ihyA           KTTLLNILNAYEPATSGTVNLFGKP--GYSAETVRQHIGFVSHSLLEKFQEGVIDVVISG--------AI
1pf4A           KSTIANLFTRFYDVDSGSICLDGHDVRDYKLTNLRRHFALVSQNVHLFNDTIANNIAYAAEGEYTREQIE
2ixgA           KSTVAALLQNLYQPTGGKVLLDGEPLVQYDHHYLHTQVAAVPLLFGRSFRENIAYGLTRTPTMEEITAVA
1oxxK           KTTFMRIIAGLDVPSTGELYFDDRLVAS------------------------------------------
1sgwA           KTTLLKTISTYLKPLKGEIIYNGVPI-----TKVKGKIFFLPEEIIVPRKISVEDYLKAVASLY-----G
2ix8A           KSTLINVLTGELLPTSGEV---------------------------------------------------
2ix3A           KSTLINVLTGELLPTSGEV---------------------------------------------------
2iwhB           KSTLINVLTGELLPTSGEV---------------------------------------------------
2iw3B           KSTLINVLTGELLPTSGEV---------------------------------------------------
2iw3A           KSTLINVLTGELLPTSGEV---------------------------------------------------
1z47B           KTTILRLIAGLERPTKGDVWI-------------------------------------------------
1z47A           KTTILRLIAGLERPTKGDVWI-------------------------------------------------
1ji0A           KTTTLSAIAGLVRAQKGKI---------------------------------------------------
1z2rA           KSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALVSQN--------------------------
2cbzA           KSSLLSALLAEMDKVEGHVAI--KGSVAYVPQQAWIQNDSLRENILFGCQLEEPYYRSVIQA--------
3b60A           KSTIASLITRFYDIDEGHILMDGHDLREYTLASLRNQVALVSQN--------------------------
2yz2B           KSTLLQIVAGLIEPTSGDV---------------------------------------------------
2yz2A           KSTLLQIVAGLIEPTSGDV---------------------------------------------------
1vplA           KTTTLRIISTLIKPSSGIVTVFGKNVVE-EPHEVRKLISYLPEEAGAYRNMQGIEYLRFVAGFYASSSSE
2pjzA           KTTLLRAISG-LLPYSGNIFI--NGMEVRKIRNYIRYSTNLPEAYEIG--VTVNDIVYL-----YEELKG
1xfaA           KTSLLMLILGELEASEG-----------------------------------------------------
1xf9D           KTSLLMLILGELEASEG-----------------------------------------------------
1xf9C           KTSLLMLILGELEASEG-----------------------------------------------------
1xf9B           KTSLLMLILGELEASEG-----------------------------------------------------
1xf9A           KTSLLMLILGELEASEG-----------------------------------------------------
1r10A           KTSLLMLILGELEASEG-----------------------------------------------------
1r0zD           KTSLLMLILGELEASEG-----------------------------------------------------
1r0zC           KTSLLMLILGELEASEG-----------------------------------------------------
1r0zB           KTSLLMLILGELEASEG-----------------------------------------------------
1r0zA           KTSLLMLILGELEASEG-----------------------------------------------------
1r0xD           KTSLLMLILGELEASEG-----------------------------------------------------
1r0xC           KTSLLMLILGELEASEG-----------------------------------------------------
1r0xB           KTSLLMLILGELEASEG-----------------------------------------------------
1r0xA           KTSLLMLILGELEASEG-----------------------------------------------------
1r0wC           KTSLLMLILGELEASEG-----------------------------------------------------
1r0wB           KTSLLMLILGELEASEG-----------------------------------------------------
1r0wA           KTSLLMLILGELEASEG-----------------------------------------------------
1q3hD           KTSLLMLILGELEASEG-----------------------------------------------------
1q3hC           KTSLLMLILGELEASEG-----------------------------------------------------
1q3hB           KTSLLMLILGELEASEG-----------------------------------------------------
1q3hA           KTSLLMLILGELEASEG-----------------------------------------------------
2ghiA           KSTIAKLLYRFYDAE-GDIKIGGKNVNKYNRNSIRSIIGIVPQD-TILFNETIKYNILYGKTDEEVIKAT
1xmiE           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           XXXXXXXXXXXXXXXXXXXXXRKFPSLSGGEKARVMLARVLAQQTQIMLWDEPTAALDIRHQESVLRIAR
2nq2C           SHDYQVAMQALDYLNLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSL--
2nq2D           SHDYQVAMQALDYLNLTHLAKREFTSLSGGQRQLILIARAIASECKLILLDEPTSALDLANQDIVLSL--
2qi9C           KTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITQLLLLDEPN-SLDVAQQSALDKILS
1l7vC           KTRTELLNDVAGALALDDKLGRSTNQLSGGEWQRVRLAAVVLQITQLLLLDEPN-SLDVAQQSALDKILS
2oukB           REKAEAKAMELLDKVGLKDKAHAYPSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMK
2oljA           REKAEAKAMELLDKVGLKDKAHAYPSLSGGQAQRVAIARALAMEPKIMLFDEPTSALDPEMVGEVLSVMK
2yyzA           ------------KLLIDNLLDRKPTQLSGGQQQRVALARALVKQPKVLLFDEPLSNLD-ANLRMIMRAEI
1xefA           KLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMR---
1mt0A           KLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMR---
2it1B           REEIDKKVREVAKMLHIDKLLNRYPQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDLLRLEVRAELKR
2it1A           REEIDKKVREVAKMLHIDKLLNRYPQLSGGQQQRVAIARALVKEPEVLLLDEPLSNLDLLRLEVRAELKR
2ffaA           KLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMR---
2ff7A           KLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMR---
3d31A           IKDPKRVLDTARDLKIEHLLDRNPLTLSGGEQQRVALARALVTNPKILLLDEPLSALDPRTQEN------
1q12A           EVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISR
3fh6A           EVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISR
2awoA           EVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISR
2awnB           EVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISR
3dhwC           KDEVKRRVTELLSLVGLGDKHDSYPSLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSILELLK
2fgkA           KLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMR---
2ffbA           KLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDQATSALDYESEHVIMR---
3b5jA           KLAGAHDFISELREGYNTIVGEQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHVIMR---
2r6gB           EVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMIEISR
2r6gA           EVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDQPLSNLDAALRVQMIEISR
1g291           QEIDQRVREVAELLGLTELLNRKPRELSGGQRQRVALGRAIVRKPQVFLMDEPLSNLDVRMRAELKKLQR
1gajA           EEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDQPIAGV-------------
1g9xA           EEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGV-------------
2pcjA           KEAKERGEYLLSELGLGDKLSRKPYELSGGEQQRVAIARALANEPILLFADEPTGNLDSANTKRVMDI--
1g6hA           EEMVEKAFKILEFLKLSHLYDRKAGELSGGQMKLVEIGRALMTNPKMIVMDEPIAGV-------------
1b0uA           KHDARERALKYLAKVGIDERAQKYPHLSGGQQQRVSIARALAMEPDVLLFDEPTSALDPELVGEVLRIMQ
1oxvA           KEEIRKRVEEVAKILDIHHVLNHFPELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVK
1oxsC           KEEIRKRVEEVAKILDIHHVLNHFPELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVK
1l2tB           AMSGEERRKRALECLKMAELEERFANLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLK
1l2tA           AMSGEERRKRALECLKMAELEERFANLSGGQQQRVAIARALANNPPIILADQPTGALDSKTGEKIMQLLK
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2awoC           EVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISR
2onkA           XXXXXXXXXMAEKLGIAHLLDRKPARLSGGERQRVALARALVIQPRLLLLDEPLSAVDLK----------
3g60A           IVRAAKEANIHQFIDSLPDKYNKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALD-TESEKVVQEAL
3g5uA           IVRAAKEANIHQFIDSLPDKYNKGTQLSGGQKQRIAIARALVRQPHILLLDEATSALD-TESEKVVQEAL
1mv5D           FARSFVENMPDQLNTEVGERGVK---ISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMV-----
1mv5A           FARSFVENMPDQLNTEVGERGVK---ISGGQRQRLAIARAFLRNPKILMLDEATASLDSESESMV-----
2d62A           KQEIDKRVREVAELGLTELLNRKPRELSGGQRQRVALGRAIIRRPKVFL-DEPLSNLDAK----------
3bk7A           LNSNFYKTELLKPLGIIDLYDRNVEDLSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIR
3gfoA           DEIRKRVDNALKRTGIEHLKDKPTHCLSFGQKKRVAIAGVLVMEPKVLILDEPTAGLDPMGVSEIMKLVE
2d2fA           ----------------------------------------------------------------------
1jj7A           VKSGAHSFISGLPQGYDTEVDEAGSQLSGGQRQAVALARALIRKPCVLILDDATSALDANSQLQV-----
2d2eA           ----------------------------------------------------------------------
2ixeD           VAMESGAHDFISGFPQGYDTE---VQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRL--
2ixfD           MESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRL--
2ixfC           MESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRL--
2ixfA           MESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDQATSALDAGNQLRVQRL--
2awoD           ----------------------------------------------------------------------
2ixeA           MESGAHDFISGFPQGYDTEVGETGNQLSGGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRL--
2awnD           ----------------------------------------------------------------------
1yqtA           LNSNFYKTELLKPLGIIDLYDREVNELSGGELQRVAIAATLLRDADIYLLDEPSAYLDVEQRLAVSRAIR
2hydA           KMANAHDFIMNLPQGYDTEVGERGVKLSGGQKQRLSIARIFLNNPPILILDEATSALDL-ESESIIQEA-
2awnC           ------------------LLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMIEISR
2zu0C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ihyB           IDDEIRNEAHQLLKLVGSAKAQQYIGLSTGEKQRV-IARALG-QPQVLILDEPAAGLDFIARE-------
2awnA           ----------------------------------------------------------------------
1v43A           ----------AAELLQIEELLNRYPALSGGXXXXXXXXXXXXXEPDVLLMDEPLSNLDAK----------
1f3oA           EERRKRALECLKAELEERFANHKPNQLSGGQQQRVAIARALANNPPIILADEPTGALDSKTGEKIQLLKK
2ihyA           DDEIRNEAHQLLKLVGSAKAQQYIGYLSTGEKQRV-IARALG-QPQVLILDEPAAGLDFIARE-------
1pf4A           QAARQAHAMEFIENMPQGLDTENGTSLSGGQRQRVAIARALLRDAPVLILDEATSALDTESERAI-----
2ixgA           MESGAHDFISGFPQGYDTEVGETGNQLAVGQRQAVALARALIRKPRLLILDNATSALDAGNQLRVQRL--
1oxxK           ----------------------------------------------------------------------
1sgwA           VKVNKNEIMDALESVEVLDLKKKLGELSQGTIRRVQLASTLLVNAEIYVLDDPVVAIDEDSKHKVLK---
2ix8A           ----------------------------------------------------------------------
2ix3A           -------------------------ALSGGWKMKLALARAVLRNADILLLDEPTNHLD------------
2iwhB           -------------------------ALSGGWKMKLALARAVLRNADILLLDEPTNHLD------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2cbzA           --CALLPDLEILPSGDRTEIGEKGVNLSGGQKQRVSLARAVYSNADIYLFDDPLSAVD------------
3b60A           ----------------------------------------------------------------------
2yz2B           --------------------------LSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVE
2yz2A           --------------------------LSGGEKRRVAIASVIVHEPDILILDEPLVGLDREGKTDLLRIVE
1vplA           IEEMVERATEIAGLGEKIKD--RVSTYSKGMVRKLLIARALMVNPRLAILDEPTSGLDVLNAREVRKILK
2pjzA           LDRDLFLEMLKALKLGEEILRRKLYKLSAGQSVLVRTSLALASQPEIVGLDEPFENVDAARRHVISRYIK
1xfaA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1xf9D           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1xf9C           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1xf9B           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1xf9A           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r10A           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0zD           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0zC           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0zB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0zA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0xD           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0xC           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0xB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0xA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0wC           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0wB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1r0wA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1q3hD           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1q3hC           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1q3hB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
1q3hA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVFTEEQV-----
2ghiA           KSAQLYDFIEALPKKWDTIVGNKGMKLSGGERQRIAIARCLLKDPKIVIFDEATSSLD------------
1xmiE           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
1xmiD           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
1xmiC           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
1xmiB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
1xmiA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2pzgB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2pzgA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2pzfB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2pzfA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2pzeB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2pzeA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2bbtB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2bbtA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2bbsB           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----
2bbsA           -------------------------TLSGGQRARISLARAVYKDADLYLLDSPFGYLDVLTEKEI-----


                         .         .         .         +         .         .         .:280
query           QRAAQGXXXXXXXXXXXXXXXXXXXXXXXSQGQIAAYGPPAEVFTAKxxxxxxxxxxxxxxxxxxxxxxx
2nq2C           ----------------------------------------------------------------------
2nq2D           ----------------------------------------------------------------------
2qi9C           ALSQQG----------------------------------------------------------------
1l7vC           ALCQQG----------------------------------------------------------------
2oukB           QLANEG----------------------------------------------------------------
2oljA           QLANEG----------------------------------------------------------------
2yyzA           KHLQQGITSVYVTHDQAEAMTMASRIAVFNQGKLVQYGTPDEVY--------------------------
1xefA           ----------------------------------------------------------------------
1mt0A           ----------------------------------------------------------------------
2it1B           LQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVY--------------------------
2it1A           LQKELGITTVYVTHDQAEALAMADRIAVIREGEILQVGTPDEVY--------------------------
2ffaA           ----------------------------------------------------------------------
2ff7A           ----------------------------------------------------------------------
3d31A           ----------------------------------------------------------------------
1q12A           LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY--------------------------
3fh6A           LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY--------------------------
2awoA           LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY--------------------------
2awnB           LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY--------------------------
3dhwC           ----------------------------------------------------------------------
2fgkA           ----------------------------------------------------------------------
2ffbA           ----------------------------------------------------------------------
3b5jA           ----------------------------------------------------------------------
2r6gB           LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY--------------------------
2r6gA           LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY--------------------------
1g291           Q---------------------------------------------------------------------
1gajA           ----------------------------------------------------------------------
1g9xA           ----------------------------------------------------------------------
2pcjA           ----------------------------------------------------------------------
1g6hA           ----------------------------------------------------------------------
1b0uA           QLAEEGKTMVVVTHEMGFARHVSSHVIFLHQGKIEEEGDPEQVF--------------------------
1oxvA           E---------------------------------------------------------------------
1oxsC           E---------------------------------------------------------------------
1l2tB           K---------------------------------------------------------------------
1l2tA           K---------------------------------------------------------------------
3fvqB           ----------------------------------------------------------------------
3fvqA           ----------------------------------------------------------------------
2awoC           LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY--------------------------
2onkA           ----------------------------------------------------------------------
3g60A           DKAREG----------------------------------------------------------------
3g5uA           DKAREG----------------------------------------------------------------
1mv5D           ----------------------------------------------------------------------
1mv5A           ----------------------------------------------------------------------
2d62A           ----------------------------------------------------------------------
3bk7A           ----------------------------------------------------------------------
3gfoA           MQKELGXXXXXXXXXXXXVPLYCDNVFVMKEGRVILQGNPKEVFAEK-----------------------
2d2fA           ----------------------------------------------------------------------
1jj7A           ----------------------------------------------------------------------
2d2eA           ----------------------------------------------------------------------
2ixeD           ----------------------------------------------------------------------
2ixfD           ----------------------------------------------------------------------
2ixfC           ----------------------------------------------------------------------
2ixfA           ----------------------------------------------------------------------
2awoD           ----------------------------------------------------------------------
2ixeA           ----------------------------------------------------------------------
2awnD           ----------------------------------------------------------------------
1yqtA           ----------------------------------------------------------------------
2hydA           ----------------------------------------------------------------------
2awnC           LHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELY--------------------------
2zu0C           ----------------------------------------------------------------------
2d3wD           ----------------------------------------------------------------------
2d3wC           ----------------------------------------------------------------------
2d3wB           ----------------------------------------------------------------------
2d3wA           ----------------------------------------------------------------------
2ihyB           ----------------------------------------------------------------------
2awnA           ----------------------------------------------------------------------
1v43A           ----------------------------------------------------------------------
1f3oA           LNEEDG----------------------------------------------------------------
2ihyA           ----------------------------------------------------------------------
1pf4A           ----------------------------------------------------------------------
2ixgA           ----------------------------------------------------------------------
1oxxK           ----------------------------------------------------------------------
1sgwA           ----------------------------------------------------------------------
2ix8A           ----------------------------------------------------------------------
2ix3A           ----------------------------------------------------------------------
2iwhB           ----------------------------------------------------------------------
2iw3B           ----------------------------------------------------------------------
2iw3A           ----------------------------------------------------------------------
1z47B           ----------------------------------------------------------------------
1z47A           ----------------------------------------------------------------------
1ji0A           ----------------------------------------------------------------------
1z2rA           ----------------------------------------------------------------------
2cbzA           ----------------------------------------------------------------------
3b60A           ----------------------------------------------------------------------
2yz2B           K---------------------------------------------------------------------
2yz2A           K---------------------------------------------------------------------
1vplA           QASQEG----------------------------------------------------------------
2pjzA           EYGKEG----------------------------------------------------------------
1xfaA           ----------------------------------------------------------------------
1xf9D           ----------------------------------------------------------------------
1xf9C           ----------------------------------------------------------------------
1xf9B           ----------------------------------------------------------------------
1xf9A           ----------------------------------------------------------------------
1r10A           ----------------------------------------------------------------------
1r0zD           ----------------------------------------------------------------------
1r0zC           ----------------------------------------------------------------------
1r0zB           ----------------------------------------------------------------------
1r0zA           ----------------------------------------------------------------------
1r0xD           ----------------------------------------------------------------------
1r0xC           ----------------------------------------------------------------------
1r0xB           ----------------------------------------------------------------------
1r0xA           ----------------------------------------------------------------------
1r0wC           ----------------------------------------------------------------------
1r0wB           ----------------------------------------------------------------------
1r0wA           ----------------------------------------------------------------------
1q3hD           ----------------------------------------------------------------------
1q3hC           ----------------------------------------------------------------------
1q3hB           ----------------------------------------------------------------------
1q3hA           ----------------------------------------------------------------------
2ghiA           ----------------------------------------------------------------------
1xmiE           ----------------------------------------------------------------------
1xmiD           ----------------------------------------------------------------------
1xmiC           ----------------------------------------------------------------------
1xmiB           ----------------------------------------------------------------------
1xmiA           ----------------------------------------------------------------------
2pzgB           ----------------------------------------------------------------------
2pzgA           ----------------------------------------------------------------------
2pzfB           ----------------------------------------------------------------------
2pzfA           ----------------------------------------------------------------------
2pzeB           ----------------------------------------------------------------------
2pzeA           ----------------------------------------------------------------------
2bbtB           ----------------------------------------------------------------------
2bbtA           ----------------------------------------------------------------------
2bbsB           ----------------------------------------------------------------------
2bbsA           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxx
2nq2C           ----
2nq2D           ----
2qi9C           ----
1l7vC           ----
2oukB           ----
2oljA           ----
2yyzA           ----
1xefA           ----
1mt0A           ----
2it1B           ----
2it1A           ----
2ffaA           ----
2ff7A           ----
3d31A           ----
1q12A           ----
3fh6A           ----
2awoA           ----
2awnB           ----
3dhwC           ----
2fgkA           ----
2ffbA           ----
3b5jA           ----
2r6gB           ----
2r6gA           ----
1g291           ----
1gajA           ----
1g9xA           ----
2pcjA           ----
1g6hA           ----
1b0uA           ----
1oxvA           ----
1oxsC           ----
1l2tB           ----
1l2tA           ----
3fvqB           ----
3fvqA           ----
2awoC           ----
2onkA           ----
3g60A           ----
3g5uA           ----
1mv5D           ----
1mv5A           ----
2d62A           ----
3bk7A           ----
3gfoA           ----
2d2fA           ----
1jj7A           ----
2d2eA           ----
2ixeD           ----
2ixfD           ----
2ixfC           ----
2ixfA           ----
2awoD           ----
2ixeA           ----
2awnD           ----
1yqtA           ----
2hydA           ----
2awnC           ----
2zu0C           ----
2d3wD           ----
2d3wC           ----
2d3wB           ----
2d3wA           ----
2ihyB           ----
2awnA           ----
1v43A           ----
1f3oA           ----
2ihyA           ----
1pf4A           ----
2ixgA           ----
1oxxK           ----
1sgwA           ----
2ix8A           ----
2ix3A           ----
2iwhB           ----
2iw3B           ----
2iw3A           ----
1z47B           ----
1z47A           ----
1ji0A           ----
1z2rA           ----
2cbzA           ----
3b60A           ----
2yz2B           ----
2yz2A           ----
1vplA           ----
2pjzA           ----
1xfaA           ----
1xf9D           ----
1xf9C           ----
1xf9B           ----
1xf9A           ----
1r10A           ----
1r0zD           ----
1r0zC           ----
1r0zB           ----
1r0zA           ----
1r0xD           ----
1r0xC           ----
1r0xB           ----
1r0xA           ----
1r0wC           ----
1r0wB           ----
1r0wA           ----
1q3hD           ----
1q3hC           ----
1q3hB           ----
1q3hA           ----
2ghiA           ----
1xmiE           ----
1xmiD           ----
1xmiC           ----
1xmiB           ----
1xmiA           ----
2pzgB           ----
2pzgA           ----
2pzfB           ----
2pzfA           ----
2pzeB           ----
2pzeA           ----
2bbtB           ----
2bbtA           ----
2bbsB           ----
2bbsA           ----