[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56580.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1b6sB.bssp"
#ERROR : Can't open dsspfile "3ethA.bssp"
#ERROR : Can't open dsspfile "1b6sA.bssp"
#ERROR : Can't open dsspfile "3etjB.bssp"
#ERROR : Can't open dsspfile "1b6sC.bssp"
#ERROR : Can't open dsspfile "1b6rA.bssp"
#ERROR : Can't open dsspfile "2z04B.bssp"
#ERROR : Can't open dsspfile "2z04A.bssp"
#ERROR : Can't open dsspfile "2dwcB.bssp"
#ERROR : Can't open dsspfile "2dwcA.bssp"
#ERROR : Can't open dsspfile "2czgB.bssp"
#ERROR : Can't open dsspfile "2czgA.bssp"
#ERROR : Can't open dsspfile "1kjqB.bssp"
#ERROR : Can't open dsspfile "1kjqA.bssp"
#ERROR : Can't open dsspfile "1kjjB.bssp"
#ERROR : Can't open dsspfile "1kj9B.bssp"
#ERROR : Can't open dsspfile "1kj8B.bssp"
#ERROR : Can't open dsspfile "1kj8A.bssp"
#ERROR : Can't open dsspfile "1eyzA.bssp"
#ERROR : Can't open dsspfile "2dzdB.bssp"
#ERROR : Can't open dsspfile "1jdbB.bssp"
#ERROR : Can't open dsspfile "1a9xA.bssp"
#ERROR : Can't open dsspfile "1wr2A.bssp"

## Summary of PDB Search
:385
    8e-31  36%  1b6sB  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    2e-30  35%  3ethA  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE ATPASE
    1e-26  35%  1b6sA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    3e-26  35%  3etjB  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE ATPASE
    6e-26  35%  1b6sC  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    8e-26  35%  1b6rA  [c.30.1 - d.142.1 - b.84.2] PROTEIN (N5-CARBOXYAMINOIMIDAZOLE
    2e-24  34%  2z04B  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE ATPASE
    3e-22  35%  2z04A  [x.x.x] PHOSPHORIBOSYLAMINOIMIDAZOLE CARBOXYLASE ATPASE
    7e-08  28%  2dwcB  [x.x.x] 433AA LONG HYPOTHETICAL
    2e-07  28%  2dwcA  [x.x.x] 433AA LONG HYPOTHETICAL
    3e-07  28%  2czgB  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    5e-07  28%  2czgA  [x.x.x] PHOSPHORIBOSYLGLYCINAMIDE FORMYL TRANSFERASE
    2e-06  32%  1kjqB  [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLGLYCINAMIDE
    2e-06  32%  1kjqA  [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLGLYCINAMIDE
    2e-06  32%  1kjjB  [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLGLYCINAMIDE
    2e-06  32%  1kj9B  [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLGLYCINAMIDE
    2e-06  32%  1kj8B  [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLGLYCINAMIDE
    2e-06  32%  1kj8A  [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLGLYCINAMIDE
    2e-06  32%  1eyzA  [c.30.1 - d.142.1 - b.84.2] PHOSPHORIBOSYLGLYCINAMIDE
    2e-04  27%  2dzdB  [x.x.x] PYRUVATE CARBOXYLASE
    4e-04  28%  1jdbB  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    5e-04  29%  1a9xA  [c.30.1 - d.142.1 - a.92.1 - c.30.1 - d.142.1 - c.24.1]
    6e-04  39%  1wr2A  [x.x.x] HYPOTHETICAL PROTEIN PH1789
:385

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxVGMVGGGQLARMTHQAAIALGVDFRVLAARPTDSAARVVADVHXXXXXXXXXXXAFAKDS
1b6sB           ----------VCVLGNGQLGRMLRQAGEPLGI-----AVWPVGLDAEPAA---------------VPFQQ
3ethA           ----------VCVLGNGQLGRMLRQAGEPLGI-----AVWPVGLDAEPAA---------------VPFQQ
1b6sA           ----------VCVLGNGQLGRMLRQAGEPLGI-----AVWPVGLDAEPAA---------------VPFQQ
3etjB           ----------VCVLGNGQLGRMLRQAGEPLGI-----AVWPVGLDAEPAA---------------VPFQQ
1b6sC           ----------VCVLGNGQLGRMLRQAGEPLGI-----AVWPVGLDAEPAA---------------VPFQQ
1b6rA           ----------VCVLGNGQLGRMLRQAGEPLGI-----AVWPVGLDAEPAA---------------VPFQQ
2z04B           ----------VGILGGGQLG-WTILEGRKLGFKFHVLEDKENAPACRVA-----DRCFRTGQISEFVDSC
2z04A           ----------VGILGGGQLG-WTILEGRKLGFKFHVLEDKENAPACRVA-----DRCFRTGQISEFVDSC
2dwcB           ------------LLGSGELGKEIAIEAQRLGVEV-VAVDRYANAPAMQVAHVGNMMDKDFLWSVVEREKP
2dwcA           ------------LLGSGELGKEIAIEAQRLGVEV-VAVDRYANAPAMQVAHVGNMMDKDFLWSVVEREKP
2czgB           ------------LLGSGELGKEIAIEAQRLGVEV-VAVDRYANAPAMQVAHVGNMMDKDFLWSVVEREKP
2czgA           ------------LLGSGELGKEIAIEAQRLGVEV-VAVDRYANAPAMQVAHVGNMMDKDFLWSVVEREKP
1kjqB           ----------------------------------------------------------------------
1kjqA           ----------------------------------------------------------------------
1kjjB           ----------------------------------------------------------------------
1kj9B           ----------------------------------------------------------------------
1kj8B           ----------------------------------------------------------------------
1kj8A           ----------------------------------------------------------------------
1eyzA           ----------------------------------------------------------------------
2dzdB           ----------------------------------------------------------------------
1jdbB           ----------------------------------------------------------------------
1a9xA           ----------------------------------------------------------------------
1wr2A           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DVVTFDHEHVPQPVLRELHDAGIVLRPGPEALHHAQDKLVMRTRLSELGAPCPRWRGITSLDEVTEFAGQ
1b6sB           SVITAEIERWPETALRELHPAFV----NRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
3ethA           SVITAEIERWPETALRQLHPAFV----NRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
1b6sA           SVITAEIERWPETALRELHPAFV----NRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
3etjB           SVITAEIERWPETALRQLHPAFV----NRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
1b6sC           SVITAEIERWPETALRELHPAFV----NRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSEWPAVFDR
1b6rA           SVITAEIERWPETALRQLHPAFV----NRDVFPIIADRLTQKQLFDKLHLPTAPWQLLAERSE-------
2z04B           DIITYEFEHIKDEVLEKCESK---LIPNPQALYVKKSRIREKLFLKKHGFPVPEFL-VIKRDEIID----
2z04A           DIITYEFEHIKDEVLEKCESK---LIPNPQALYVKKSRIREKLFLKKHGFPVPEFLVI------------
2dwcB           DAIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHRERLRTLVKEAKVPTSRYMYATTLDELYEACEK
2dwcA           DAIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHRERLRTLVKEAKVPTSRYMYATTLDELYEACEK
2czgB           DAIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHRERLRTLVKEAKVPTSRYMYATTLDELYEACEK
2czgA           DAIIPEIEAINLDALFEFEKDGYFVVPNARATWIAMHRERLRTLVKEAKVPTSRYMYATTLDELYEACEK
1kjqB           ----------------------------------------------------------------------
1kjqA           ----------------------------------------------------------------------
1kjjB           ----------------------------------------------------------------------
1kj9B           ----------------------------------------------------------------------
1kj8B           ----------------------------------------------------------------------
1kj8A           ----------------------------------------------------------------------
1eyzA           ----------------------------------------------------------------------
2dzdB           ----------------------IFIGPNENHLDMFGDKVKARHAAVNAGIPVPGSDGVDGLEDVVAFAEA
1jdbB           ----------PLKLARALEAAGVVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAIEMAVEKAKE
1a9xA           ----------PLKLARALEAAGVVIGTSPDAIDRAEDRERFQHAVERLKLKQPANATVTAIEMAVEKAKE
1wr2A           -----------------------VLKQGRTAMVEYEAKQVLKA----YGLPVPEEKLAKTLDEALEYAKE


                         +         .         .         .         .         *         .:210
query           TGWPVVLKAARGGYDGKGVWVVGDXXXXXXXXXXXXXXQVPLLVEEKIAFRRELAVQVARSPYGQVAAYP
1b6sB           LGELAIVKRRTGGYDGRGQWRL----------RANETEQLPAIVEQGINFSGEVSLVGARGFDGSTVFYP
3ethA           LGELAIVKRRTGGYDGRGQWRL----------RANETEQLPAIVEQGINFSGEVSLVGARGFDGSTVFYP
1b6sA           LGELAIVKRRTGG----GQWRL----------RANETEQLPAIVEQGINFSGEVSLVGARGFDGSTVFYP
3etjB           LGELAIVKRRTGG----GQWRL----------RANETEQLPAIVEQGINFSGEVSLVGARGFDGSTVFYP
1b6sC           LGELAIVKRRTGGQ-----WRL----------RANETEQLPAIVEQGINFSGEVSLVGARGFDGSTVFYP
1b6rA           --WPAV-------FDRLGELAIVKRRTGQWRLRANETEQLPAIVEQGINFSGEVSLVGARGFDGSTVFYP
2z04B           ----VVIKAEKLGY-----------------------KEESFIIEEFVKFEAEISCIGVRDREGKTYFYP
2z04A           ---PVVIKAE-------------------------------FIIEEFVKFEAEISCIGVRDREGKTYFYP
2dwcB           IGYPCHTKAMSGSYFVKG-----------PEDIPKAWEEEKIIVEEHIDFDTELAVRHFDENGEIVTTFP
2dwcA           IGYPCHTKAVKGPEDIPKAW-----------------EEEKIIVEEHIDFDTELAVRHFDENGEIVTTFP
2czgB           IGYPCHTKAVKGPEDIPKAW--------------------KIIVEEHIDFDTELAVRHFDENGEIVTTFP
2czgA           IGYPCHTKAVKGPEDIPKAWE-------------------KIIVEEHIDFDTELAVRHFDENGEIVTTFP
1kjqB           ----------------------------------------------------------------------
1kjqA           ----------------------------------------------------------------------
1kjjB           ----------------------------------------------------------------------
1kj9B           ----------------------------------------------------------------------
1kj8B           ----------------------------------------------------------------------
1kj8A           ----------------------------------------------------------------------
1eyzA           ----------------------------------------------------------------------
2dzdB           HGYPIIIKAALGG-GGRGMRIVRSKSEVKEAFERAKSEAKEVYVEKLIENPKHIEVQILGDYEGNIVLYE
1jdbB           IGYPLVVRAMEIVYD-------------------------------------------------------
1a9xA           IGYPLVVRAA------------------------------------------------------------
1wr2A           IGYPVVLK--------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VVETVQRGGICHEVIAPAPHLSEDRXXXXXXXXXXXXXXXXXXXXXXXELFETDTGVVVNELAMRPHNSG
1b6sB           LTHNLHQDGILRTSVA-FPXXXXXXXXXXEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSG
3ethA           LTHNLHQDGILRTSVA-FPXXXXXXXXXXEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSG
1b6sA           LTHNLHQDGILRTSVA-FPXXXXXXXXXXEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSG
3etjB           LTHNLHQDGILRTSVA-FPXXXXXXXXXXEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSG
1b6sC           LTHNLHQDGILRTSVA-FPXXXXXXXXXXEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSG
1b6rA           LTHNLHQDGILRTSVA-FPXXXXXXXXXXEEMLSAIMQELGYVGVMAMECFVTPQGLLINELAPRVHNSG
2z04B           QPFNKHEEGILIYNYVPYAKLKE------AEEITKRLELLDIVGVFTVEFFLLKDGVLINEFAPRVHNTG
2z04A           QPFNKHEEGILIYNYVPYAKLKEAEEITKRLELLDIVGVFTV------EFFLLKDGVLINEFAPRVHNTG
2dwcB           PVGHYQIDGDYHASWQPA-EISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
2dwcA           PVGHYQIDGDYHASWQPA-EISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
2czgB           PVGHYQIDGDYHASWQPA-EISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
2czgA           KVGHYQIDGDYHASWQPA-EISEKAEREVYRIAKRITDVLGGLGIFGVEMFVKGDKVWANEVSPRPHDTG
1kjqB           ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
1kjqA           ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
1kjjB           ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
1kj9B           ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
1kj8B           ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
1kj8A           ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
1eyzA           ------------------------------------------------ELFVCGDEVIFSEVSPRPHDTG
2dzdB           RDCSVQRRHQKVVEVAPSVSLSDE----------------------------------------------
1jdbB           ----------------------------------------------------------------------
1a9xA           ----------------------------------------------------------------------
1wr2A           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           HWTIDGACTSQFEQHLRAVLDLPLGSPRTVAPFTVMANLLGGHDPHVFNRYIHVMARDPELKVHFYGKEV
1b6sB           HWTQNGASISQFELHLRAITDLPLPQPVVNNP-SVMINLIGSDVNYDWLKL-------PLVHLHWYDKEV
3ethA           HWTQNGASISQFELHLRAITDLPLPQPVVNNP-SVMINLIGSDVNYDWLKL-------PLVHLHWYDKEV
1b6sA           HWTQNGASISQFELHLRAITDLPLPQPVVNNP-SVMINLIGSDVNYDWLKL-------PLVHLHWYDKEV
3etjB           HWTQNGASISQFELHLRAITDLPLPQPVVNNP-SVMINLIGSDVNYDWLKL-------PLVHLHWYDKEV
1b6sC           HWTQNGASISQFELHLRAITDLPLPQPVVNNP-SVMINLIGSDVNYDWLKL-------PLVHLHWYDKEV
1b6rA           HWTQNGASISQFELHLRAITDLPLPQPVVNNP-SVMINLIGSDVNYDWLKL-------PLVHLHWYDKEV
2z04B           HWTLDGAYTSQFENLLRAITE-PLGSTELKLPSGV--NILGSYEEIPLKEILSVEG----AKLYWYGKEK
2z04A           HWTLDGAYTSQFENLLRAITE-PLGSTELKLPSGV--NILGSYEEIPLKEILSVEG----AKLYWYGKEK
2dwcB           MVTLASPGFSEFALHLRAVLGLPIPGPMLIPAATVIKAKVSGYSPR-FRGLVKALS-VPNATVRLFGKEA
2dwcA           MVTLASPGFSEFALHLRAVLGLPIPGPMLIPAATVIKAKVSGYSPR-FRGLVKALS-VPNATVRLFGKEA
2czgB           MVTLASPGFSEFALHLRAVLGLPIPGPMLIPAATVIKAKVSGYSPR-FRGLVKALS-VPNATVRLFGKEA
2czgA           MVTLASHPPSEFALHLRAVLGLPIPGPMLIPAATVIKAKVSGYSPR-FRGLVKALS-VPNATVRLFGKEA
1kjqB           MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
1kjqA           MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
1kjjB           MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
1kj9B           MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
1kj8B           MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
1kj8A           MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
1eyzA           MVTLISQDLSEFALHVRAFLGLPVGGIRQYGPAASAVILPQLTSQNVFDNVQNAVGAD--LQIRLFGKEI
2dzdB           ----------------------------------------------------------------------
1jdbB           ----------------------------------------------------------------------
1a9xA           ----------------------------------------------------------------------
1wr2A           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           RPGRKIGHVTVVGDDxxxxxxxxxxxxxxxxxxxx
1b6sB           RPGRKVGHLNLTDSD--------------------
3ethA           RPGRKVGHLNLTDSD--------------------
1b6sA           RPGRKVGHLNLTDSD--------------------
3etjB           RPGRKVGHLNLTDSD--------------------
1b6sC           RPGRKVGHLNLTDSD--------------------
1b6rA           RPGRKVGHLNLTDSD--------------------
2z04B           KPRRKVGHV--------------------------
2z04A           KPRRKVGHV--------------------------
2dwcB           YVGRRLG----------------------------
2dwcA           YVGRRLG----------------------------
2czgB           YVGRRLG----------------------------
2czgA           YVGRRLG----------------------------
1kjqB           DGSRRLG----------------------------
1kjqA           DGSRRLG----------------------------
1kjjB           DGSRRLG----------------------------
1kj9B           DGSRRLG----------------------------
1kj8B           DGSRRLG----------------------------
1kj8A           DGSRRLG----------------------------
1eyzA           DGSRRLG----------------------------
2dzdB           -----------------------------------
1jdbB           -----------------------------------
1a9xA           -----------------------------------
1wr2A           -----------------------------------