[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56592.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xdiA.bssp"
#ERROR : Can't open dsspfile "1ebdA.bssp"
#ERROR : Can't open dsspfile "1zy8A.bssp"
#ERROR : Can't open dsspfile "2yquA.bssp"
#ERROR : Can't open dsspfile "2eq7A.bssp"
#ERROR : Can't open dsspfile "1zmdE.bssp"
#ERROR : Can't open dsspfile "1zmcD.bssp"
#ERROR : Can't open dsspfile "1zmcB.bssp"
#ERROR : Can't open dsspfile "1zmcA.bssp"
#ERROR : Can't open dsspfile "3ladA.bssp"
#ERROR : Can't open dsspfile "2f5zI.bssp"
#ERROR : Can't open dsspfile "2eq6A.bssp"
#ERROR : Can't open dsspfile "1lpfA.bssp"
#ERROR : Can't open dsspfile "1dxlA.bssp"
#ERROR : Can't open dsspfile "1jehA.bssp"
#ERROR : Can't open dsspfile "1lvlA.bssp"
#ERROR : Can't open dsspfile "1zx9A.bssp"
#ERROR : Can't open dsspfile "1zk7A.bssp"
#ERROR : Can't open dsspfile "2a8xA.bssp"
#ERROR : Can't open dsspfile "2r9zB.bssp"
#ERROR : Can't open dsspfile "2r9zA.bssp"
#ERROR : Can't open dsspfile "2rabB.bssp"
#ERROR : Can't open dsspfile "2rabA.bssp"
#ERROR : Can't open dsspfile "1ojtA.bssp"
#ERROR : Can't open dsspfile "1bhyA.bssp"
#ERROR : Can't open dsspfile "2qaeA.bssp"
#ERROR : Can't open dsspfile "2grtA.bssp"
#ERROR : Can't open dsspfile "1grtA.bssp"
#ERROR : Can't open dsspfile "2w0hB.bssp"
#ERROR : Can't open dsspfile "2w0hA.bssp"
#ERROR : Can't open dsspfile "2jk6A.bssp"
#ERROR : Can't open dsspfile "2ve2B.bssp"
#ERROR : Can't open dsspfile "2ve2A.bssp"
#ERROR : Can't open dsspfile "1grbA.bssp"
#ERROR : Can't open dsspfile "3dk9A.bssp"
#ERROR : Can't open dsspfile "1gesB.bssp"
#ERROR : Can't open dsspfile "1gesA.bssp"
#ERROR : Can't open dsspfile "1grgA.bssp"
#ERROR : Can't open dsspfile "2tprA.bssp"
#ERROR : Can't open dsspfile "1gxfA.bssp"
#ERROR : Can't open dsspfile "1fecB.bssp"
#ERROR : Can't open dsspfile "1fecA.bssp"
#ERROR : Can't open dsspfile "1feaB.bssp"
#ERROR : Can't open dsspfile "1feaA.bssp"
#ERROR : Can't open dsspfile "1bzlA.bssp"
#ERROR : Can't open dsspfile "1aogB.bssp"
#ERROR : Can't open dsspfile "1aogA.bssp"
#ERROR : Can't open dsspfile "1ndaA.bssp"
#ERROR : Can't open dsspfile "1tytB.bssp"
#ERROR : Can't open dsspfile "1tytA.bssp"
#ERROR : Can't open dsspfile "1typB.bssp"
#ERROR : Can't open dsspfile "1typA.bssp"
#ERROR : Can't open dsspfile "1gerB.bssp"
#ERROR : Can't open dsspfile "1gerA.bssp"
#ERROR : Can't open dsspfile "1dncA.bssp"
#ERROR : Can't open dsspfile "1gsnA.bssp"
#ERROR : Can't open dsspfile "1zkqA.bssp"
#ERROR : Can't open dsspfile "1zdlA.bssp"
#ERROR : Can't open dsspfile "2nvkX.bssp"
#ERROR : Can't open dsspfile "3dh9A.bssp"
#ERROR : Can't open dsspfile "3dghA.bssp"
#ERROR : Can't open dsspfile "3dghB.bssp"
#ERROR : Can't open dsspfile "2v6oA.bssp"
#ERROR : Can't open dsspfile "3h4kA.bssp"
#ERROR : Can't open dsspfile "2hqmA.bssp"
#ERROR : Can't open dsspfile "1onfA.bssp"
#ERROR : Can't open dsspfile "3eanF.bssp"
#ERROR : Can't open dsspfile "3eanD.bssp"
#ERROR : Can't open dsspfile "3eanC.bssp"
#ERROR : Can't open dsspfile "3eanA.bssp"
#ERROR : Can't open dsspfile "1h6vE.bssp"
#ERROR : Can't open dsspfile "1h6vC.bssp"
#ERROR : Can't open dsspfile "1h6vB.bssp"
#ERROR : Can't open dsspfile "1h6vA.bssp"
#ERROR : Can't open dsspfile "2zzcA.bssp"
#ERROR : Can't open dsspfile "2zzbC.bssp"
#ERROR : Can't open dsspfile "2zz0B.bssp"
#ERROR : Can't open dsspfile "2j3nF.bssp"
#ERROR : Can't open dsspfile "2j3nD.bssp"
#ERROR : Can't open dsspfile "2j3nC.bssp"
#ERROR : Can't open dsspfile "2j3nB.bssp"
#ERROR : Can't open dsspfile "2j3nA.bssp"
#ERROR : Can't open dsspfile "2cfyA.bssp"
#ERROR : Can't open dsspfile "3ic9C.bssp"
#ERROR : Can't open dsspfile "3ic9A.bssp"
#ERROR : Can't open dsspfile "3cgcA.bssp"
#ERROR : Can't open dsspfile "2cduB.bssp"
#ERROR : Can't open dsspfile "2cduA.bssp"
#ERROR : Can't open dsspfile "1joaA.bssp"
#ERROR : Can't open dsspfile "1f8wA.bssp"
#ERROR : Can't open dsspfile "2v3aA.bssp"
#ERROR : Can't open dsspfile "1nhsA.bssp"
#ERROR : Can't open dsspfile "3iwaA.bssp"
#ERROR : Can't open dsspfile "1nhqA.bssp"
#ERROR : Can't open dsspfile "1nhrA.bssp"
#ERROR : Can't open dsspfile "1nhpA.bssp"
#ERROR : Can't open dsspfile "1mo9A.bssp"
#ERROR : Can't open dsspfile "2bc1A.bssp"
#ERROR : Can't open dsspfile "2bc0A.bssp"
#ERROR : Can't open dsspfile "3ctyB.bssp"
#ERROR : Can't open dsspfile "3ctyA.bssp"
#ERROR : Can't open dsspfile "1m6iA.bssp"
#ERROR : Can't open dsspfile "3cgbA.bssp"
#ERROR : Can't open dsspfile "1gv4A.bssp"
#ERROR : Can't open dsspfile "3gd4B.bssp"
#ERROR : Can't open dsspfile "3gd4A.bssp"
#ERROR : Can't open dsspfile "3gd3D.bssp"
#ERROR : Can't open dsspfile "3gd3C.bssp"
#ERROR : Can't open dsspfile "3gd3B.bssp"
#ERROR : Can't open dsspfile "3gd3A.bssp"
#ERROR : Can't open dsspfile "3f8pD.bssp"
#ERROR : Can't open dsspfile "3ef6A.bssp"
#ERROR : Can't open dsspfile "1xhcA.bssp"
#ERROR : Can't open dsspfile "1yqzA.bssp"
#ERROR : Can't open dsspfile "1q1wB.bssp"
#ERROR : Can't open dsspfile "1q1wA.bssp"
#ERROR : Can't open dsspfile "1q1rA.bssp"
#ERROR : Can't open dsspfile "3f8rD.bssp"
#ERROR : Can't open dsspfile "3f8dD.bssp"
#ERROR : Can't open dsspfile "3f8rB.bssp"
#ERROR : Can't open dsspfile "3f8rA.bssp"
#ERROR : Can't open dsspfile "3f8pC.bssp"
#ERROR : Can't open dsspfile "3f8pB.bssp"
#ERROR : Can't open dsspfile "3f8pA.bssp"
#ERROR : Can't open dsspfile "3f8dC.bssp"
#ERROR : Can't open dsspfile "3f8dB.bssp"
#ERROR : Can't open dsspfile "3f8dA.bssp"
#ERROR : Can't open dsspfile "1hyuA.bssp"
#ERROR : Can't open dsspfile "1cl0A.bssp"
#ERROR : Can't open dsspfile "1tdfA.bssp"
#ERROR : Can't open dsspfile "1f6mA.bssp"
#ERROR : Can't open dsspfile "1fl2A.bssp"
#ERROR : Can't open dsspfile "2q7vB.bssp"
#ERROR : Can't open dsspfile "2q7vA.bssp"
#ERROR : Can't open dsspfile "2yvjA.bssp"
#ERROR : Can't open dsspfile "2gr3A.bssp"
#ERROR : Can't open dsspfile "2gqwA.bssp"
#ERROR : Can't open dsspfile "1d7yA.bssp"
#ERROR : Can't open dsspfile "1vdcA.bssp"
#ERROR : Can't open dsspfile "3fg2P.bssp"
#ERROR : Can't open dsspfile "2i0zA.bssp"
#ERROR : Can't open dsspfile "2vhyB.bssp"
#ERROR : Can't open dsspfile "2vhyA.bssp"
#ERROR : Can't open dsspfile "2vhxD.bssp"
#ERROR : Can't open dsspfile "2vhxC.bssp"
#ERROR : Can't open dsspfile "2vhxB.bssp"
#ERROR : Can't open dsspfile "2vhxA.bssp"
#ERROR : Can't open dsspfile "2vhwE.bssp"
#ERROR : Can't open dsspfile "2vhwB.bssp"
#ERROR : Can't open dsspfile "2vhwA.bssp"
#ERROR : Can't open dsspfile "2vhvA.bssp"
#ERROR : Can't open dsspfile "3d8xA.bssp"

## Summary of PDB Search
:460
    e-139  60%  1xdiA  [c.3.1 - d.87.1] RV3303C-LPDA
    2e-63  34%  1ebdA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    2e-56  33%  1zy8A  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE, MITOCHONDRIAL
    2e-56  31%  2yquA  [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E3 COMPONENT
    2e-56  31%  2eq7A  [x.x.x] 2-OXOGLUTARATE DEHYDROGENASE E3 COMPONENT
    1e-55  33%  1zmdE  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    1e-55  33%  1zmcD  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    1e-55  33%  1zmcB  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    1e-55  33%  1zmcA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    1e-55  31%  3ladA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    2e-55  32%  2f5zI  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    5e-54  33%  2eq6A  [x.x.x] PYRUVATE DEHYDROGENASE COMPLEX, DIHYDROLIPOAMIDE
    1e-53  31%  1lpfA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    4e-51  30%  1dxlA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    6e-51  32%  1jehA  [c.3.1 - c.3.1 - d.87.1] DIHYDROLIPOAMIDE DEHYDROGENASE
    8e-51  32%  1lvlA  [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE
    2e-45  32%  1zx9A  [x.x.x] MERCURIC REDUCTASE
    2e-45  32%  1zk7A  [x.x.x] MERCURIC REDUCTASE
    1e-42  30%  2a8xA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    2e-42  30%  2r9zB  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    7e-42  30%  2r9zA  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    2e-41  30%  2rabB  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    2e-41  30%  2rabA  [x.x.x] GLUTATHIONE AMIDE REDUCTASE
    3e-41  30%  1ojtA  [x.x.x] SURFACE PROTEIN
    4e-41  30%  1bhyA  [x.x.x] P64K
    3e-40  28%  2qaeA  [x.x.x] DIHYDROLIPOYL DEHYDROGENASE
    2e-39  30%  2grtA  [x.x.x] GLUTATHIONE REDUCTASE
    2e-39  30%  1grtA  [x.x.x] GLUTATHIONE REDUCTASE
    6e-38  28%  2w0hB  [x.x.x] TRYPANOTHIONE REDUCTASE
    6e-38  28%  2w0hA  [x.x.x] TRYPANOTHIONE REDUCTASE
    6e-38  28%  2jk6A  [x.x.x] TRYPANOTHIONE REDUCTASE
    2e-37  31%  2ve2B  [x.x.x] TRYPANOTHIONE REDUCTASE
    2e-37  31%  2ve2A  [x.x.x] TRYPANOTHIONE REDUCTASE
    9e-37  30%  1grbA  [c.3.1 - c.3.1 - d.87.1 (1bwcA)] GLUTATHIONE REDUCTASE
    9e-37  30%  3dk9A  [x.x.x] GLUTATHIONE REDUCTASE
    3e-36  29%  1gesB  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    3e-36  29%  1gesA  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    4e-36  30%  1grgA  [x.x.x] GLUTATHIONE REDUCTASE
    1e-35  29%  2tprA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-35  31%  1gxfA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
    4e-35  29%  1fecB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-35  29%  1fecA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-35  29%  1feaB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-35  29%  1feaA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-35  31%  1bzlA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE (OXIDIZED
    4e-35  31%  1aogB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    4e-35  31%  1aogA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    5e-35  30%  1ndaA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE OXIDOREDUCTASE
    8e-35  28%  1tytB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE, OXIDIZED
    8e-35  28%  1tytA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE, OXIDIZED
    8e-35  28%  1typB  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    8e-35  28%  1typA  [c.3.1 - c.3.1 - d.87.1] TRYPANOTHIONE REDUCTASE
    2e-34  29%  1gerB  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    2e-34  29%  1gerA  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    2e-34  30%  1dncA  [x.x.x] GLUTATHIONE REDUCTASE
    2e-32  30%  1gsnA  [x.x.x] GLUTATHIONE REDUCTASE
    8e-30  28%  1zkqA  [x.x.x] THIOREDOXIN REDUCTASE 2, MITOCHONDRIAL
    8e-30  28%  1zdlA  [x.x.x] THIOREDOXIN REDUCTASE 2, MITOCHONDRIAL
    2e-29  30%  2nvkX  [x.x.x] THIOREDOXIN REDUCTASE
    2e-29  30%  3dh9A  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-29  30%  3dghA  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    3e-29  30%  3dghB  [x.x.x] THIOREDOXIN REDUCTASE 1, MITOCHONDRIAL
    3e-28  28%  2v6oA  [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
    3e-28  28%  3h4kA  [x.x.x] THIOREDOXIN GLUTATHIONE REDUCTASE
    1e-27  25%  2hqmA  [x.x.x] GLUTATHIONE REDUCTASE
    3e-25  25%  1onfA  [c.3.1 - c.3.1 - d.87.1] GLUTATHIONE REDUCTASE
    1e-22  27%  3eanF  [x.x.x] THIOREDOXIN REDUCTASE 1
    1e-22  27%  3eanD  [x.x.x] THIOREDOXIN REDUCTASE 1
    1e-22  27%  3eanC  [x.x.x] THIOREDOXIN REDUCTASE 1
    1e-22  27%  3eanA  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-22  26%  1h6vE  [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
    2e-22  26%  1h6vC  [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
    2e-22  26%  1h6vB  [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
    2e-22  26%  1h6vA  [c.3.1 - c.3.1 - d.87.1] THIOREDOXIN REDUCTASE
    2e-22  27%  2zzcA  [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC
    2e-22  27%  2zzbC  [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC
    2e-22  27%  2zz0B  [x.x.x] THIOREDOXIN REDUCTASE 1, CYTOPLASMIC
    2e-22  27%  2j3nF  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-22  27%  2j3nD  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-22  27%  2j3nC  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-22  27%  2j3nB  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-22  27%  2j3nA  [x.x.x] THIOREDOXIN REDUCTASE 1
    2e-22  27%  2cfyA  [x.x.x] THIOREDOXIN REDUCTASE 1
    3e-21  28%  3ic9C  [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE
    3e-21  28%  3ic9A  [x.x.x] DIHYDROLIPOAMIDE DEHYDROGENASE
    3e-20  29%  3cgcA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    2e-18  24%  2cduB  [x.x.x] NADPH OXIDASE
    2e-18  24%  2cduA  [x.x.x] NADPH OXIDASE
    9e-15  28%  1joaA  [x.x.x] NADH PEROXIDASE
    9e-15  28%  1f8wA  [c.3.1 - c.3.1 - d.87.1] NADH PEROXIDASE
    4e-14  31%  2v3aA  [x.x.x] RUBREDOXIN REDUCTASE
    4e-14  28%  1nhsA  [x.x.x] NADH PEROXIDASE
    5e-14  29%  3iwaA  [x.x.x] FAD-DEPENDENT PYRIDINE NUCLEOTIDE-DISULPHIDE
    6e-14  28%  1nhqA  [x.x.x] NADH PEROXIDASE
    1e-13  28%  1nhrA  [x.x.x] NADH PEROXIDASE
    1e-13  28%  1nhpA  [x.x.x] NADH PEROXIDASE
    1e-13  24%  1mo9A  [c.3.1 - c.3.1 - d.87.1] ORF3
    9e-13  27%  2bc1A  [x.x.x] NADH OXIDASE
    9e-13  27%  2bc0A  [x.x.x] NADH OXIDASE
    3e-11  47%  3ctyB  [x.x.x] THIOREDOXIN REDUCTASE
    3e-11  47%  3ctyA  [x.x.x] THIOREDOXIN REDUCTASE
    7e-10  30%  1m6iA  [c.3.1 - c.3.1 - d.87.1] PROGRAMMED CELL DEATH PROTEIN 8
    7e-10  29%  3cgbA  [x.x.x] PYRIDINE NUCLEOTIDE-DISULFIDE OXIDOREDUCTASE,
    5e-09  30%  1gv4A  [c.3.1 - c.3.1 - d.87.1] PROGRAMED CELL DEATH PROTEIN 8
    5e-09  30%  3gd4B  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-09  30%  3gd4A  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-09  30%  3gd3D  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-09  30%  3gd3C  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-09  30%  3gd3B  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-09  30%  3gd3A  [x.x.x] APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL
    5e-09  23%  3f8pD  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    6e-09  28%  3ef6A  [x.x.x] TOLUENE 1,2-DIOXYGENASE SYSTEM FERREDOXIN--
    1e-08  32%  1xhcA  [c.3.1 - c.3.1 - d.87.1] NADH OXIDASE /NITRITE REDUCTASE
    3e-08  27%  1yqzA  [x.x.x] COENZYME A DISULFIDE REDUCTASE
    4e-08  26%  1q1wB  [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE
    4e-08  26%  1q1wA  [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE
    4e-08  26%  1q1rA  [c.3.1 - c.3.1 - d.87.1] PUTIDAREDOXIN REDUCTASE
    5e-08  25%  3f8rD  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    5e-08  25%  3f8dD  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    7e-08  25%  3f8rB  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    7e-08  25%  3f8rA  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    7e-08  25%  3f8pC  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    7e-08  25%  3f8pB  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    7e-08  25%  3f8pA  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    7e-08  25%  3f8dC  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    7e-08  25%  3f8dB  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    7e-08  25%  3f8dA  [x.x.x] THIOREDOXIN REDUCTASE (TRXB-3)
    1e-07  31%  1hyuA  [c.47.1 - c.47.1 - c.3.1 - c.3.1] ALKYL HYDROPEROXIDE
    1e-07  31%  1cl0A  [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE
    1e-07  31%  1tdfA  [x.x.x] THIOREDOXIN REDUCTASE
    1e-07  31%  1f6mA  [c.3.1 - c.3.1] THIOREDOXIN REDUCTASE
    2e-07  31%  1fl2A  [c.3.1 - c.3.1] ALKYL HYDROPEROXIDE REDUCTASE SUBUNIT F
    2e-06  28%  2q7vB  [x.x.x] THIOREDOXIN REDUCTASE
    2e-06  28%  2q7vA  [x.x.x] THIOREDOXIN REDUCTASE
    3e-06  32%  2yvjA  [x.x.x] FERREDOXIN REDUCTASE
    3e-06  32%  2gr3A  [x.x.x] FERREDOXIN REDUCTASE
    3e-06  32%  2gqwA  [x.x.x] FERREDOXIN REDUCTASE
    3e-06  32%  1d7yA  [c.3.1 - c.3.1 - d.87.1] FERREDOXIN REDUCTASE
    1e-05  33%  1vdcA  [x.x.x] NADPH DEPENDENT THIOREDOXIN REDUCTASE
    1e-05  27%  3fg2P  [x.x.x] PUTATIVE RUBREDOXIN REDUCTASE
    7e-04  48%  2i0zA  [x.x.x] NAD(FAD)-UTILIZING DEHYDROGENASES
    0.001  54%  2vhyB  [x.x.x] ALANINE DEHYDROGENASE
    0.001  54%  2vhyA  [x.x.x] ALANINE DEHYDROGENASE
    0.001  54%  2vhxD  [x.x.x] ALANINE DEHYDROGENASE
    0.001  54%  2vhxC  [x.x.x] ALANINE DEHYDROGENASE
    0.001  54%  2vhxB  [x.x.x] ALANINE DEHYDROGENASE
    0.001  54%  2vhxA  [x.x.x] ALANINE DEHYDROGENASE
    0.001  54%  2vhwE  [x.x.x] ALANINE DEHYDROGENASE
    0.001  54%  2vhwB  [x.x.x] ALANINE DEHYDROGENASE
    0.001  54%  2vhwA  [x.x.x] ALANINE DEHYDROGENASE
    0.001  54%  2vhvA  [x.x.x] ALANINE DEHYDROGENASE
    0.001  26%  3d8xA  [x.x.x] THIOREDOXIN REDUCTASE 1
:460

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTKVVIIGGGPGGYEAALVAAQLGADVTVIERDGIGGASVLTDCVPSKTLIATSVRTSYVKEAATLGINV
1xdiA           VTRIVILGGGPAGYEAALVAATSHPEVTVIDCDGIGGAAVLDDCVPSKTFIASTGLRTELRRAPHLGFH-
1ebdA           -------------------AAQLGQKVTIVEKGNLGGVCLNVGCIPSKALISASHRYEQAKHSEEMGIKA
1zy8A           ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHMAHGKDFASRGIEM
2yquA           MYDLLVIGAGPGGYVAAIRAAQLGMKVGVVEKEALGGTCLRVGCIPSKALLETTERI-YXXXXXXXXXXX
2eq7A           MYDLLVIGAGPGGYVAAIRAAQLGMKVGVVEKEALGGTCLRVGCIPSKALLETTERI-YXXXXXXXXXXX
1zmdE           ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHMAHGTDFASRGIEM
1zmcD           ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHMAHGTDFASRGIEM
1zmcB           ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHMAHGTDFASRGIEM
1zmcA           ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHMAHGTDFASRGIEM
3ladA           ---VIVIGAGPGGYVAAIKSAQLGLKTALIEKTALGGTCLNVGCIPSKALLDSSYKFHEAHESFKLGIST
2f5zI           ---VTVIGSGPGGYVAAIKAAQLGFKTVCIEKETLGGTCLNVGCIPSKALLNNSYHMAHGTDFASRGIEM
2eq6A           ---LIVIGTGPGGYHAAIRAAQLGLKVLXXXXXXXXXXCLNVGCIPTKXXXXXXXXXXXXKVAEGFGLKA
1lpfA           ---VVVIGAGPGGYVAAIRAAQLGLKTACIEKYALGGTCLNVGCIPSKALLDSSYKYHEAKEAFKVGIEA
1dxlA           -------------------AAQLGFKTTCIEKRGLGGTCLNVGCIPSKALLHSSHMYHEAKHSANHGVKV
1jehA           ---VVIIGGGPAGYVAAIKAAQLGFNTACVEKRGLGGTCLNVGCIPSKALLNNSMHTEAQKRGIDVNINV
1lvlA           ----------PGGYVAAIRAGQLGIPTVLVEGQALGGTCLNIGCIPSKALIHVAEQASRFTEPSPLGISV
1zx9A           -----------------------GAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFDGGIA
1zk7A           -----------------------GAQVTLIERGTIGGTCVNVGCVPSKIMIRAAHIAHLRRESPFDGGIA
2a8xA           ---VVVLGAGPGGYVAAIRAAQLGLSTAIVEPKYWGGVCLNVGCIPSKALLRNAELVHFTKDAKAFGIS-
2r9zB           -------------------AAAFGKRVALIESKALGGTCVNVGCVPKKVMWYASHLAEAVRDAPGFGVQA
2r9zA           -------------------AAAFGKRVALIESKALGGTCVNVGCVPKKVMWYASHLAEAVRDAPGFGVQA
2rabB           -------------------AAAFGKRVALIESKALGGTCVNVGCVPKKVMWYASHLAEAVRDAPGFGVQA
2rabA           -------------------AAAFGKRVALIESKALGGTCVNVGCVPKKVMWYASHLAEAVRDAPGFGVQA
1ojtA           ---VVVLGGGPGGYSAAFAAADEGLKVAIVERKTLGGVCLNVGCIPSKALLHNAAVIDEVRHLAANGIKY
1bhyA           ---VVVLGGGPGGYSAAFAAADEGLKVAIVERKTLGGVCLNVGCIPSKALLHNAAVIDEVRHLAANGIKY
2qaeA           ---------------ASIKAAQLGMKTACVEKRGLGGTCLNVGCIPSKALLATHLYHDAHANFARYGL-M
2grtA           ----LVIGGGSGGLESXXXXXXXXXXXXXXXSHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFP-
1grtA           ----LVIGGGSGGLESXXXXXXXXXXXXXXXSHKLGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFP-
2w0hB           ---LVVLGAGSGGLEAGWNXXXXXXXXXXXXXXALGGTCVNVGCVPKKLMVTGAQYMDLIRESGGFGWEM
2w0hA           ---LVVLGAGSGGLEAGWNXXXXXXXXXXXXXXALGGTCVNVGCVPKKLMVTGAQYMDLIRESGGFGWEM
2jk6A           ---LVVLGAGSGGLEAGWNXXXXXXXXXXXXXXALGGTCVNVGCVPKKLMVTGAQYMDLIRESGGFGWEM
2ve2B           ---LVVIGAGSGGLEAGWNAATLYKKVAVIDVQALGGTCVNVGCVPKKLMVTGAQYMDHLRESAGFGWEF
2ve2A           ---LVVIGAGSGGLEAGWNAATLYKKVAVIDVQALGGTCVNVGCVPKKLMVTGAQYMDHLRESAGFGWEF
1grbA           ----------------------------------LGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFP-
3dk9A           ----------------------------------LGGTCVNVGCVPKKVMWNTAVHSEFMHDHADYGFP-
1gesB           -------------------AAMYGQKCALIEAKELGGTCVNVGCVPKKVMW----HAAQIREAIHMGPDY
1gesA           -------------------AAMYGQKCALIEAKELGGTCVNVGCVPKKVMW----HAAQIREAIHMGPDY
1grgA           ------------------------------------GGTVNVGCVPKKVMWNTAVHSEFMHDHADYGFP-
2tprA           ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
1gxfA           ---LVVIGAGSGGLEAAWNAATLYKDVQMVHGSALGGTCVNVGCVPKKLMVTGAQYMEHLRESAGFGWEF
1fecB           ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
1fecA           ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
1feaB           ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
1feaA           ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
1bzlA           ---LVVIGAGSGGLEAAWNAATLYKDVQMVHGSALGGTCVNVGCVPKKLMVTGAQYMEHLRESAGFGWEF
1aogB           ---LVVIGAGSGGLEAAWNAATLYKDVQMVHGSALGGTCVNVGCVPKKLMVTGAQYMEHLRESAGFGWEF
1aogA           ---LVVIGAGSGGLEAAWNAATLYKDVQMVHGSALGGTCVNVGCVPKKLMVTGAQYMEHLRESAGFGWEF
1ndaA           ---LVVIGAGSGGLEAAWNAATLYKDVQMVHGSALGGTCVNVGCVPKKLMVTGAQYMEHLRESAGFGWEF
1tytB           ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
1tytA           ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
1typB           ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
1typA           ---LVVIGAGSGGLEAGWNAASLHKKVAVIDLQALGGTCVNVGCVPKKLMVTGANYMDTIRESAGFGWEL
1gerB           -------------------AAMYGQKCALIEAKELGGTCVNVGCVPKKVMW----HAAQIREAIHMGPDY
1gerA           -------------------AAMYGQKCALIEAKELGGTCVNVGCVPKKVMW----HAAQIREAIHMGPDY
1dncA           ------------------------------------GGTCVNVGVPKKVMWNTAVHSEFMHDHADYGFP-
1gsnA           ------------------------------------GGTCVNVGVPKKVMWNTAVHSEFMHDHADYGFP-
1zkqA           ---LLVIGGGSGGLACAKEAAQLGKKVAVADKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAHHYGWEV
1zdlA           ---LLVIGGGSGGLACAKEAAQLGKKVAVADKWGLGGTCVNVGCIPKKLMHQAALLGGMIRDAHHYGWEV
2nvkX           ---LIVIGGGSAGLACAKEAVLNGARVACLDKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNV
3dh9A           ---LIVIGGGSAGLACAKEAVLNGARVACLDKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNV
3dghA           ---LIVIGGGSAGLACAKEAVLNGARVACLDKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNV
3dghB           ---LIVIGGGSAGLACAKEAVLNGARVACLDKWGVGGTCVNVGCIPKKLMHQASLLGEAVHEAAAYGWNV
2v6oA           ---------------------------------GLGGTCVNVGCIPKKLMHQAGLLSHALEDAEHFGWSL
3h4kA           ---------------------------------GLGGTCVNVGCIPKKLMHQAGLLSHALEDAEHFGWSL
2hqmA           ----------------------------LVEAKALGGTCVNVGCVPKKVMWYASDLATRVSHANEYGL-Y
1onfA           ------------------------AKVALVEKSRLGGTCVNVGCVPKKIMFNAASVHDILENSRHYGFDT
3eanF           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
3eanD           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
3eanC           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
3eanA           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
1h6vE           ---------------------------------GLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
1h6vC           ---------------------------------GLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
1h6vB           ---------------------------------GLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
1h6vA           ---------------------------------GLGGTCVNVGCIPKKLMHQAALLGQALKDSRNYGWKL
2zzcA           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
2zzbC           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
2zz0B           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
2j3nF           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
2j3nD           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
2j3nC           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
2j3nB           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
2j3nA           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
2cfyA           -------------------------------RWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKV
3ic9C           -------------------AAKKHTDKVVLIEGGAYGTTCARVGCPSKLLIAAADASYHASQTDLFGIQV
3ic9A           -------------------AAKKHTDKVVLIEGGAYGTTCARVGCPSKLLIAAADASYHASQTDLFGIQV
3cgcA           ----------------------------------------------------------------------
2cduB           ----------------------------------------------------------------------
2cduA           ----------------------------------------------------------------------
1joaA           --KVIVLGSSHGGYEAVEELLNLHPDAEIQKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNV
1f8wA           --KVIVLGSSHGGYEAVEELLNLHPDAEIQKGDFISFLSGMQLYLEGKVKDVNSVRYMTGEKMESRGVNV
2v3aA           ----------------------------------------------------------------------
1nhsA           --KVIVLGSSHGGYEAVEELLNLHPDAEIQKGDFISFLCGMQLYLEGKVKDVNSVRYMTGEKMESRGVNV
3iwaA           ----------------------------------------------------------------------
1nhqA           --KVIVLGSSHGGYEAVEELLNLHPDAEIQWYEKGDFISFLSSYLEGKVKDVNSVRYMTGEKMESRGVNV
1nhrA           ----------------------------------------------------------------------
1nhpA           ----------------------------------------------------------------------
1mo9A           ----------------------------------------------------------------------
2bc1A           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1m6iA           ----------------------------------------------------------------------
3cgbA           ----VIIGGDAAGSAAQIVRNDENANVVTLEKGEIGLPYVISGAIASEKLIARNVKTFRDKYG-------
1gv4A           ----------------------------------------------------------------------
3gd4B           ----------------------------------------------------------------------
3gd4A           ----------------------------------------------------------------------
3gd3D           ----------------------------------------------------------------------
3gd3C           ----------------------------------------------------------------------
3gd3B           ----------------------------------------------------------------------
3gd3A           ----------------------------------------------------------------------
3f8pD           -----------------------------------------------KTLVIGETPGGQLTEAGIVDDYL
3ef6A           ----------------------------------------------------------------------
1xhcA           ----------------------------------------------------------------------
1yqzA           ----------------------------------------------------------------------
1q1wB           ----------------------------------------------------------------------
1q1wA           ----------------------------------------------------------------------
1q1rA           ----------------------------------------------------------------------
3f8rD           -----------------------------------------------KTLVIGETPGGQLTEAGIVDDYL
3f8dD           -----------------------------------------------KTLVIGETPGGQLTEAGIVDDYL
3f8rB           ----------------------------------------------------------------------
3f8rA           ----------------------------------------------------------------------
3f8pC           ----------------------------------------------------------------------
3f8pB           ----------------------------------------------------------------------
3f8pA           ----------------------------------------------------------------------
3f8dC           ----------------------------------------------------------------------
3f8dB           ----------------------------------------------------------------------
3f8dA           ----------------------------------------------------------------------
1hyuA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
1tdfA           ----------------------------------------------------------------------
1f6mA           ----------------------------------------------------------------------
1fl2A           ----------------------------------------------------------------------
2q7vB           ---VVIIGGGPAGLTAAIYTGRAQLSTLILEKGMPGGQIAWSEEVE----------------------NF
2q7vA           ---VVIIGGGPAGLTAAIYTGRAQLSTLILEKGMPGGQIAWSEEVE----------------------NF
2yvjA           ----------------------------------------------------------------------
2gr3A           ----------------------------------------------------------------------
2gqwA           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
1vdcA           ----------------------------------------------------------------------
3fg2P           ----------------------------------------------------------------------
2i0zA           ---VIVIGGGPSGLMAAIGAAEEGANVLLLDK--------------------------------------
2vhyB           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
2vhyA           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
2vhxD           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
2vhxC           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
2vhxB           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
2vhxA           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
2vhwE           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
2vhwB           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
2vhwA           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
2vhvA           ---VVVIGAGTAGYNAARIANGMGATVTVLD---------------------------------------
3d8xA           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           GNEPEDKDLVRVELKTVNARVKRLAQAQSVDTANRLRTEGVEIIIGEARLVDPHIVAVGDERIRADVVLI
1xdiA           ----------KISLPQIHARVKTLAAAQSADITAQLLSMGVQVIAGRGELIDS-TPGLARHRIKADVVLV
1ebdA           EN-------VTIDFAKVQEWKASVVKKLTGGVEGLLKGNKVEIVKGEAYFVDANTVRVGDQTYTFKNAII
1zy8A           SE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTAGTQVIDTKNILI
2yquA           XXXXXD-------LPALMAHKDKVVQANTQGVEFLFKKNGIARHQGTARFLSERKVLVEEEELEARYILI
2eq7A           XXXXXD-------LPALMAHKDKVVQANTQGVEFLFKKNGIARHQGTARFLSERKVLVEEEELEARYILI
1zmdE           SE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTAGTQVIDTKNILI
1zmcD           SE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTAGTQVIDTKNILI
1zmcB           SE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTAGTQVIDTKNILI
1zmcA           SE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTAGTQVIDTKNILI
3ladA           GE-------VAIDVPTMIARKDQIVRNLTGGVASLIKANGVTLFEGHGKLLAGKKVEVSSQVLDTENVIL
2f5zI           SE-------VRLNLDKMMEQKSTAVKALTGGIAHLFKQNKVVHVNGYGKITGKNQVTAGTQVIDTKNILI
2eq6A           --KPE------LDLKKLGGWRDQXXXXXXXXXXXXXXXNGVELLRGFARLVGPKEVEVGGERYGAKSLIL
1lpfA           KG-------VTIDVPAMVARKANIVKNLTGGIATLFKANGVTSFEGHGKLLANKQVEVTGQVLEAENVII
1dxlA           SN-------VEIDLAAMMGQKDKAVSNLTRGIEGLFKKNKVTYVKGYGKFVSPSEISVDNTVVKGKHIII
1jehA           ANFQKAKDDAGIELLFKKNKVTYYKGNGSFEDETKIRVTPVDGLEGTVK--EDHILDVKN-------IIV
1lvlA           ASP-------RLDIGQSVAWKDGIVDRLTTGVAALLKKHGVKVVHGWAKVLDGKQVEVDGQRIQCEHLLL
1zx9A           ATVP-----------TID-RSKLLAQQQAVDELRHAKYEGITVVHGEARFKDDQSLTVGERVVMFDRCLV
1zk7A           ATVP-----------TID-RSKLLAQQQAVDELRHAKYEGITVVHGEARFKDDQSLTVGERVVMFDRCLV
2a8xA           -------GEVTFDYGIAYDRSRKVAEGR-VAGVHFLKKNKITEIHGYGTFADANTLLVGTESVTFDNAII
2r9zB           SGTLDWPRLV--------AGRDRYIGAINSFWDGYVERLGITRVDGHARFVDAHTIEVEGQRLSADHIVI
2r9zA           S----------LDWPRLVAGRDRYIGAINSFWDGYVERLGITRVDGHARFVDAHTIEVEGQRLSADHIVI
2rabB           ST---------LDWPRLVAGRDRYIGAINSFWDGYVERLGITRVDGHARFVDAHTIEVEGQRLSADHIVI
2rabA           ST---------LDWPRLVAGRDRYIGAINSFWDGYVERLGITRVDGHARFVDAHTIEVEGQRLSADHIVI
1ojtA           PEPELDIDMLRAYKDGVVSRL-------TGGLAGMAKSRKVDVIQGDGQFLDPHHLEVGEKKIVAKNCII
1bhyA           PEPELDIDMLRAYKDGVVSRL-------TGGLAGMAKSRKVDVIQGDGQFLDPHHLEVGEKKIVAKNCII
2qaeA           GGEGVTMDSAKMQQQK-----ERAVKGLTGGVEYLFKKNKVTYYKGEGSFETAHSIRVNQEMLETKKTII
2grtA           --SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTDPKTIEVSGKKYTAPHILI
1grtA           --SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTDPKTIEVSGKKYTAPHILI
2w0hB           DREPNWKTLIAAKNKVVNS-INESYKSMFADT------EGLSFHMGFGALQDAHTVVVRKETLDTEYILI
2w0hA           DREPNWKTLIAAKNKVVNS-INESYKSMFADT------EGLSFHMGFGALQDAHTVVVRKETLDTEYILI
2jk6A           DREPNWKTLIAAKNKVVNS-INESYKSMFADT------EGLSFHMGFGALQDAHTVVVRKETLDTEYILI
2ve2B           DGS------------SVKANWKKLAKNEAVLDINKSYTEGLDFFLGWGSLESKNVVVVREERLQADHILL
2ve2A           DGS------------SVKANWKKLAKNEAVLDINKSYTEGLDFFLGWGSLESKNVVVVREERLQADHILL
1grbA           --SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTDPKTIEVSGKKYTAPHILI
3dk9A           --SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTDPKTIEVSGKKYTAPHILI
1gesB           GF---DTTINKFNWETLIA--SRTAYIDRIHTSNVLGKNNVDVIKGFARFVDAKTLEVNGETITADHILI
1gesA           GF---DTTINKFNWETLIA--SRTAYIDRIHTSNVLGKNNVDVIKGFARFVDAKTLEVNGETITADHILI
1grgA           --SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTDPKTIEVSGKKYTAPHILI
2tprA           DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGFGALQDNHTVLVREETLDTEYILL
1gxfA           -----DRTTLRAEWKNLIA-VKDEAVLKSYDEMFR-DTEGLEFFLGWGSLESKNVVNVREERLETEHILL
1fecB           DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGFGALQDNHTVLVREETLDTEYILL
1fecA           DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGFGALQDNHTVLVREETLDTEYILL
1feaB           DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGFGALQDNHTVLVREETLDTEYILL
1feaA           DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGFGALQDNHTVLVREETLDTEYILL
1bzlA           -----DRTTLRAEWKNLIA-VKDEAVLKSYDEMFR-DTEGLEFFLGWGSLESKNVVNVREERLETEHILL
1aogB           -----DRTTLRAEWKNLIA-VKDEAVLKSYDEMFR-DTEGLEFFLGWGSLESKNVVNVREERLETEHILL
1aogA           -----DRTTLRAEWKNLIA-VKDEAVLKSYDEMFR-DTEGLEFFLGWGSLESKNVVNVREERLETEHILL
1ndaA           -----DRTTLRAEWKKLIAVKDEAVLNINKSYEEMFRTEGLEFFLGWGSLESKNVVNVREERLETENILL
1tytB           DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGFGALQDNHTVLVREETLDTEYILL
1tytA           DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGFGALQDNHTVLVREETLDTEYILL
1typB           DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGWGALQDNHTVLVREETLDTEYILL
1typA           DREPNWKALIAAKNKAVSG-INDSYEGMFADT------EGLTFHQGWGALQDNHTVLVREETLDTEYILL
1gerB           GF---DTTINKFNWETLIA--SRTAYIDRIHTSNVLGKNNVDVIKGFARFVDAKTLEVNGETITADHILI
1gerA           GF---DTTINKFNWETLIA--SRTAYIDRIHTSNVLGKNNVDVIKGFARFVDAKTLEVNGETITADHILI
1dncA           --SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTDPKTIEVSGKKYTAPHILI
1gsnA           --SCEGKFNWRVIKEKRDAYVSRLNAIYQ----NNLTKSHIEIIRGHAAFTDPKTIEVSGKKYTAPHILI
1zkqA           AQP------VQHNWKTMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVRGVDKGLSAEHIVI
1zdlA           AQP------VQHNWKTMAEAVQNHVKSLNWGHRVQLQDRKVKYFNIKASFVDEHTVRGVDKGLSAEHIVI
2nvkX           DDKPDWHKLV----QSVQNHIKSVNWVTRVD----LRDKKVEYINGLGSFVDSHTLLAGERTITAQTFVI
3dh9A           DDKPDWHKLV----QSVQNHIKSVNWVTRVD----LRDKKVEYINGLGSFVDSHTLLAGERTITAQTFVI
3dghA           DDKPDWHKLV----QSVQNHIKSVNWVTRVD----LRDKKVEYINGLGSFVDSHTLLAGERTITAQTFVI
3dghB           DDKPDWHKLV----QSVQNHIKSVNWVTRVD----LRDKKVEYINGLGSFVDSHTLLAGERTITAQTFVI
2v6oA           -----DRSKISHNWSTMVEGVQSHIGSLNWGYKVALRDNQVTYLNAKGRLISPHEVQITDKNITGNKIIL
3h4kA           -----DRSKISHNWSTMVEGVQSHIGSLNWGYKVALRDNQVTYLNAKGRLISPHEVQITDKNITGNKIIL
2hqmA           QNLPLDKEHLTFNWPEFKQKRDAYVHRLNGIYQKNLEKEKVDVVFGWARFNKDGNVEVQKEVYSANHILV
1onfA           ------KFSFNLPL-LVERRDKYIQRLNNIYRQN-LSKDKVDLYEGTASFLEGRLIAVGNKPVFPPVKGI
3eanF           ------EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMAGKEKVSAERFLI
3eanD           ------EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMAGKEKVSAERFLI
3eanC           ------EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMAGKEKVSAERFLI
3eanA           ------EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMAGKEKVSAERFLI
1h6vE           ------EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMAGKEKVSAERFLI
1h6vC           ------EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMAGKEKVSAERFLI
1h6vB           ------EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMAGKEKVSAERFLI
1h6vA           ------EDTVKHDWEKMTESVQNHIGSLNWGYRVALREKKVVYENAYGKFIGPHKIMAGKEKVSAERFLI
2zzcA           -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
2zzbC           -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
2zz0B           -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
2j3nF           -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
2j3nD           -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
2j3nC           -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
2j3nB           -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
2j3nA           -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
2cfyA           -EETVKHDWDRM-IEAVQNHIGSLNWGYRV----ALREKKVVYENAYGQFIGPHRIKAGKEKISAERFLI
3ic9C           DRSVNGKAVKRIQTERDRXXXXXXXXXXXXDEQDKIR--------GFAKFLDEHTLQVDDHQVIAKRIVI
3ic9A           DRSVNGKAVKRIQTERDRXXXXXXXXXXXXDEQDKIR--------GFAKFLDEHTLQVDDHQVIAKRIVI
3cgcA           -----------------------------------------------------------------DRLLI
2cduB           ------------ELSNLGANVQMRHQVTNVDP--------------ETKTIKVKDLITNEEKTEADKLIM
2cduA           ------------ELSNLGANVQMRHQVTNVDP--------------ETKTIKVKDLITNEEKTEADKLIM
1joaA           FSNTE---ITAIQPKEHQVTVKDLVS--------------------------------GEERVENDKLII
1f8wA           FSNTE---ITAIQPKEHQVTVKDLVS--------------------------------GEERVENDKLII
2v3aA           ---------------------------------------------------------IGEEEVRYRDLVL
1nhsA           FSNTE---ITAIQPKEHQVTVKDLVS--------------------------------GEERVENDKLII
3iwaA           ----------------------------------------------------------------------
1nhqA           FSNTE---ITAIQPKEHQVTVKDLVS--------------------------------GEERVENDKLII
1nhrA           -------------------------------TGEKMESRGVNVFSNEITAIQPHQVTVGEERVENDKLII
1nhpA           -------------------------------TGEKMESRGVNVFSNEITAIQPHQVTVGEERVENDKLII
1mo9A           -----------------------------------------------AKVIDNHTVEAAGKVFKAKNLIL
2bc1A           ----------------------------------------------------------------------
2bc0A           ----------------------------------------------------------------------
3ctyB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1m6iA           ---------------------------------------GVAVLTGKKVVVRDNMVKLNDSQITYEKCLI
3cgbA           ----------------IDAKVRH--EVTKVDTEKK-------IVYAE------HTKTKDVFEFSYDRLLI
1gv4A           ---------------------------------------GVAVLTGKKVVVRGNMVKLNDSQITFEKCLI
3gd4B           ---------------------------------------GVAVLTGKKVVVRGNMVKLNDSQITFEKCLI
3gd4A           ---------------------------------------GVAVLTGKKVVVRGNMVKLNDSQITFEKCLI
3gd3D           ---------------------------------------GVAVLTGKKVVVRGNMVKLNDSQITFEKCLI
3gd3C           ---------------------------------------GVAVLTGKKVVVRGNMVKLNDSQITFEKCLI
3gd3B           ---------------------------------------GVAVLTGKKVVVRGNMVKLNDSQITFEKCLI
3gd3A           ---------------------------------------GVAVLTGKKVVVRGNMVKLNDSQITFEKCLI
3f8pD           GLEIQASDMIKV----FNKHIEKYEVPVLLDIVEKIENRGDEFVVKTKRKGE----------FKADSVIL
3ef6A           --------------------------------------------------------------LSADAIVI
1xhcA           ------------------------------------RKRGIEIRLAEAKLIDRKVVITEKGEVPYDTLVL
1yqzA           ----------------------------------------------------------------------
1q1wB           -------------LRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALD------------YDRLVL
1q1wA           -------------LRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALD------------YDRLVL
1q1rA           -------------LRTPDAYAAQNIQLLGGTQVTAINRDRQQVILSDGRALD------------YDRLVL
3f8rD           GLEIQASDMIKV----FNKHIEKYEVPVLLDIVEKIENRGDEFVVKTKRKGE----------FKADSVIL
3f8dD           GLEIQASDMIKV----FNKHIEKYEVPVLLDIVEKIENRGDEFVVKTKRKGE----------FKADSVIL
3f8rB           ---------------------------------------------------------------KADSVIL
3f8rA           ---------------------------------------------------------------KADSVIL
3f8pC           ---------------------------------------------------------------KADSVIL
3f8pB           ---------------------------------------------------------------KADSVIL
3f8pA           ---------------------------------------------------------------KADSVIL
3f8dC           ---------------------------------------------------------------KADSVIL
3f8dB           ---------------------------------------------------------------KADSVIL
3f8dA           ---------------------------------------------------------------KADSVIL
1hyuA           --------------------------------------------------------------LKARSIII
1cl0A           -----------------------------------------------------------------DALII
1tdfA           -----------------------------------------------------------------DALII
1f6mA           -----------------------------------------------------------------DALII
1fl2A           --------------------------------------------------------------LKARSIIV
2q7vB           PGFPEP--IAGMEL------AQRMHQ-QAEKFGAKVEMDEVQGVQHDATSHPPFTVRGYNGEYRAKAVIL
2q7vA           PGFPEP--IAGMEL------AQRMHQ-QAEKFGAKVEMDEVQGVQHDATSHPPFTVRGYNGEYRAKAVIL
2yvjA           ------------------------------------RAPEVEWLLGTAQSFDPHTVALSDGRLPYGTLVL
2gr3A           ------------------------------------RAPEVEWLLGTAQSFDPHTVALSDGRLPYGTLVL
2gqwA           ------------------------------------RAPEVEWLLGTAQSFDPHTVALSDGRLPYGTLVL
1d7yA           ------------------------------------RAPEVEWLLGTAQSFDPHTVALSDGRLPYGTLVL
1vdcA           ----------------------------------------------------------------------
3fg2P           -------------------------------------------------------------------LVL
2i0zA           ----------------------------------------------------------------------
2vhyB           ----------------------------------------------------------------------
2vhyA           ----------------------------------------------------------------------
2vhxD           ----------------------------------------------------------------------
2vhxC           ----------------------------------------------------------------------
2vhxB           ----------------------------------------------------------------------
2vhxA           ----------------------------------------------------------------------
2vhwE           ----------------------------------------------------------------------
2vhwB           ----------------------------------------------------------------------
2vhwA           ----------------------------------------------------------------------
2vhvA           ----------------------------------------------------------------------
3d8xA           ------------------------------------------------------------EPVTTDAIIL


                         +         .         .         .         .         *         .:210
query           ATGAHPRELPTARPDGERILTWRQLYDLNELPEKLIVVGSGVTGAEFANAYQALGSDVTLVSSRDRVMPT
1xdiA           ATGASPRILPSAQPDGERILTWRQLYDLDALPDHLIVVGSGVTGAEFVDAYTELGVPVTVVASQDHVLPY
1ebdA           ATGSRPIELPNFK-FSNRILDSTGALNLGEVPKSLVVIGGGYIGIELGTAYANFGTKVTILEGAGEILSG
1zy8A           ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV
2yquA           ATGSAPLIPPWAQVDYERVVTSTEALSFPEVPKRXXXXXXXXXXXXXXXXWHRLGAEVIVLEYMDRILPT
2eq7A           ATGSAPLIPPWAQVDYERVVTSTEALSFPEVPKRXXXXXXXXXXXXXXXXWHRLGAEVIVLEYMDRILPT
1zmdE           ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV
1zmcD           ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV
1zmcB           ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV
1zmcA           ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV
3ladA           ASGSKPVEIPPAPVDQDVIVDSTGALDFQNVPGKLGVIGAGVIGLELGSVWARLGAEVTVLEAMDKFLPA
2f5zI           ATGSEVTPFPGITIDEDTIVSSTGALSLKKVPEKMVVIGAGVIGVELGSVWQRLGADVTAVEFLGHVGGV
2eq6A           ATGSEPLELK-GFPFGEDVWDSTRALKVEELPKRLLVIGGGAVGLELGQVYRRLGAEVTLIEYMPEILPQ
1lpfA           ASGSRPVEIPPAPLSDDIIVDSTGALEFQAVPKKLGVIGAGVIGLELGSVWARLGAEVTVLEALDKFLPA
1dxlA           ATGSDVKSLPGVTIDEKKIVSSTGALALSEIPKKLVVIGAGYIGLEMGSVWGRIGSEVTVVEFASEIVPT
1jehA           ATGSEVTPFPGIEIDEEKIVSSTGALSLKEIPKRLTXXXXXXXXLEMGSVYSRLGSKVTVVEFQPQIGAS
1lvlA           ATGSSSVELPML-PLGGPVISSTEALAPKALPQHLVVVGGGYIGLELGIAYRKLGAQVSVVEARERILPT
1zx9A           ATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVVALELAQAFARLGSKVTVLA-RNTLFFR
1zk7A           ATGASPAVPPIPGLKESPYWTSTEALASDTIPERLAVIGSSVVALELAQAFARLGSKVTVLA-RNTLFFR
2a8xA           ATGSSTRLVPGTSLSAN-VVTYEEQILSRELP-KSXXXXXXXXXXEFGYVLKNYGVDVTIVEFLPRALPN
2r9zB           ATGGRP--IVPRLPGAELGITSDGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRLLFQ
2r9zA           ATGGRP--IVPRLPGAELGITSDGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRLLFQ
2rabB           ATGGRP--IVPRLPGAELGITSDGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRLLFQ
2rabA           ATGGRP--IVPRLPGAELGITSDGFFALQQQPKRVAIIGAGYIGIELAGLLRSFGSEVTVVALEDRLLFQ
1ojtA           AAGSRVTKLPFI-PEDPRIIDSSGALALKEVPGKXXXXXXXXXXXEMGTVYSTLGSRLDVVEMMDGLMQG
1bhyA           AAGSRVTKLPFI-PEDPRIIDSSGALALKEVPGKXXXXXXXXXXXEMGTVYSTLGSRLDVVEMMDGLMQG
2qaeA           ATGSEPTELPFLPFDEKVVLSSTGALALPRVPKTMXXXXXXXXXLELGSVWARLGAEVTVVEFAPRCAPT
2grtA           ATGGMPSTPHESQIPGASLITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
1grtA           ATGGMPSTPHESQIPGASLITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
2w0hB           ATGSWPTRLGV--PGDEFCITSNEAFYLEDAPKRMLCVGGGYIAVEFANGYKPCGGYVDLCYRGDLILRG
2w0hA           ATGSWPTRLGV--PGDEFCITSNEAFYLEDAPKRMLCVGGGYIAVEFANGYKPCGGYVDLCYRGDLILRG
2jk6A           ATGSWPTRLGV--PGDEFCITSNEAFYLEDAPKRMLCVGGGYIAVEFANGYKPCGGYVDLCYRGDLILRG
2ve2B           ATGSWP-QMP-AIPGIEHCISSNEAFYLPEPPRRVLTVGGGFISVEFANAYKPPGGKVTLCYRNNLILRG
2ve2A           ATGSWP-QMP-AIPGIEHCISSNEAFYLPEPPRRVLTVGGGFISVEFANAYKPPGGKVTLCYRNNLILRG
1grbA           ATGGMPSTPHESQIPGASLITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
3dk9A           ATGGMPSTPHESQIPGASLITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
1gesB           ATGGRPSHPDI--PGVEYGIDSDGFFALPALPERVAVVGAGYIGVELGGVINGLGAKTHLFEMFDAPLPS
1gesA           ATGGRPSHPDI--PGVEYGIDSDGFFALPALPERVAVVGAGYIGVELGGVINGLGAKTHLFEMFDAPLPS
1grgA           ATGGMPSTPHESQIPGASLITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
2tprA           ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
1gxfA           ASGSWPH-MPNI-PGIEHCISSNEAFYLPEPPRRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRG
1fecB           ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
1fecA           ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
1feaB           ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
1feaA           ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
1bzlA           ASGSWPH-MPNI-PGIEHCISSNEAFYLPEPPRRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRG
1aogB           ASGSWPH-MPNI-PGIEHCISSNEAFYLPEPPRRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRG
1aogA           ASGSWPH-MPNI-PGIEHCISSNEAFYLPEPPRRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRG
1ndaA           ASGSWPH-MPNI-PGIEHCISSNEAFYLPEPPRRVLTVGGGFISVEFANAYKPKDGQVTLCYRGEMILRG
1tytB           ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
1tytA           ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
1typB           ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
1typA           ATGSWPQHLGIEGDD--LCITSNEAFYLDEAPKRALCVGGGYISIEFANAYKARGGQVDLAYRGDMILRG
1gerB           ATGGRPSHPDI--PGVEYGIDSDGFFALPALPERVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRS
1gerA           ATGGRPSHPDI--PGVEYGIDSDGFFALPALPERVAVVGAGYIAVELAGVINGLGAKTHLFVRKHAPLRS
1dncA           ATGGMPSTPHESQIPGASLITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
1gsnA           ATGGMPSTPHESQIPGASLITSDGFFQLEELPGRSVIVGAGYIAVEMAGILSALGSKTSLMIRHDKVLRS
1zkqA           ATGGRPRYPTQVKGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGIGLDTT-VMMRSIPLRG
1zdlA           ATGGRPRYPTQVKGALEYGITSDDIFWLKESPGKTLVVGASYVALECAGFLTGIGLDTT-VMMRSIPLRG
2nvkX           AVGGRPRDIPGAVEYG---ITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPT-VMVRSIVLRG
3dh9A           AVGGRPRDIPGAVEYG---ITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPT-VMVRSIVLRG
3dghA           AVGGRPRDIPGAVEYG---ITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPT-VMVRSIVLRG
3dghB           AVGGRPRDIPGAVEYG---ITSDDLFSLDREPGKTLVVGAGYIGLECAGFLKGLGYEPT-VMVRSIVLRG
2v6oA           ATGERPKEIPGAVEYG---ITSDDLFSLPYFPGKTLVIGASYVALECAGFLASLGGDVT-VMVRSILLRG
3h4kA           ATGERPKEIPGAVEYG---ITSDDLFSLPYFPGKTLVIGASYVALECAGFLASLGGDVT-VMVRSILLRG
2hqmA           ATGGKAI-FPENIPGFELGTDSDGFFRLEEQPKKVVVVGAGYIGIELAGVFHGLGSETHLVIRGETVLRK
1onfA           ----------------ENTISSDEFFNIKE-SKKIGIVGSGYIAVELINVIKRLGIDSYIFARGNRILRK
3eanF           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
3eanD           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
3eanC           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
3eanA           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
1h6vE           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
1h6vC           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
1h6vB           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
1h6vA           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2zzcA           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2zzbC           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2zz0B           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2j3nF           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2j3nD           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2j3nC           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2j3nB           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2j3nA           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
2cfyA           ATGERPRYLGIPG-DKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVT-VMVRSILLRG
3ic9C           ATGSRPNYPEFLAAAGSRLLTNDNLFELNDLPKSVAVFGPGVIGLELGQALSRLGVIVKVFGRSGSVANL
3ic9A           ATGSRPNYPEFLAAAGSRLLTNDNLFELNDLPKSVAVFGPGVIGLELGQALSRLGVIVKVFGRSGSVANL
3cgcA           ATGVRPRDLQGVHPDAERIL---KTLETNKV-EDVTIIGGGAIGLEMAETFVELGKKVRMIERNDHIGTI
2cduB           TTGSKPTVPPIPGIDSSRVYLCKNYNDAKKLFEEITIIGSGYIGAELAEAYSNQNYNVNLIDGHERVLYK
2cduA           TTGSKPTVPPIPGIDSSRVYLCKNYNDAKKLFEEITIIGSGYIGAELAEAYSNQNYNVNLIDGHERVLYK
1joaA           SPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGV
1f8wA           SPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGV
2v3aA           AWGAEPIRVPV---EGD---AQDALYPINDLEDRVLLLGAGLIGCEFANDLSSGGYQLDVVAPCEQVMPL
1nhsA           SPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGV
3iwaA           ---------------------------------KAVIVGGGFIGLEMAVSLADMGIDTTVVELADQIMPG
1nhqA           SPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGV
1nhrA           SPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGV
1nhpA           SPGAVPFELDIPGKDLDNIYLMRGRQWAIKLKQKVVVIGSGYXXXXXXXXXXXXXXKVTVIDILDRPLGV
1mo9A           AVGAGPGTLDVPGVNAKGVFDHATLVELDYEPSTXXXXXXSKTAVEYGCFFNATGRRTVMLVRTEPLKLI
2bc1A           --------------------------------KRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAG
2bc0A           --------------------------------KRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAG
3ctyB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1m6iA           ATGGTPRSLSAIDRAGAEVKSFRSLEKISREVKSITIIGGGFLGSELACALRALGTEVIQLGNMGKILPE
3cgbA           ATGVRPRDLQGVHPDAERIL---KTLETNKVED--VTXXXXXXXXLEAETFVELGKKVR-IERNDHIGTI
1gv4A           ATGGTPRSLSAIDRAGAEVKSFRALEKISREVKSITVIGGGFLGSELACALQASGIEVIQLGNMGKILPQ
3gd4B           ATGGTPRSLSAIDRAGAEVKSFRALEKISREVKSITVIGGGFLGSELACALQASGIEVIQLGNMGKILPQ
3gd4A           ATGGTPRSLSAIDRAGAEVKSFRALEKISREVKSITVIGGGFLGSELACALQASGIEVIQLGNMGKILPQ
3gd3D           ATGGTPRSLSAIDRAGAEVKSFRALEKISREVKSITVIGGGFLGSELACALQASGIEVIQLGNMGKILPQ
3gd3C           ATGGTPRSLSAIDRAGAEVKSFRALEKISREVKSITVIGGGFLGSELACALQASGIEVIQLGNMGKILPQ
3gd3B           ATGGTPRSLSAIDRAGAEVKSFRALEKISREVKSITVIGGGFLGSELACALQASGIEVIQLGNMGKILPQ
3gd3A           ATGGTPRSLSAIDRAGAEVKSFRALEKISREVKSITVIGGGFLGSELACALQASGIEVIQLGNMGKILPQ
3f8pD           GIGVKRRKLPGEQEFAGRGISYCSVCDAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPI
3ef6A           ATGSRARTMALPGSQLPGVVTLRTYGDVQVLRDRLLIVGGGLIGCEVATTARKLGLSVTILEAGDELLRV
1xhcA           ATGARARE-PQIKGK-EYLLTLRTIFDADRIKESIXXXXXXXXXXXXXNLAEA-GYHVKLIH-RGAMFLG
1yqzA           --------------------------------DKVLVVGAGYVSLEVLENLYERGLHPTLIHRSDKINKL
1q1wB           ATGGRPRPLPVASGAVGKANNFRYLRTLEDAENRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLER
1q1wA           ATGGRPRPLPVASGAVGKANNFRYLRTLEDAENRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLER
1q1rA           ATGGRPRPLPVASGAVGKANNFRYLRTLEDAENRLVVIGGGYIGLEVAATAIKANMHVTLLDTAARVLER
3f8rD           GIGVKRRKLPGEQEFAGRGISYCSVCDAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRD----T
3f8dD           GIGVKRRKLPGEQEFAGRGISYCSVADAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRD----T
3f8rB           GIGVKRRKLPGEQEFAGRGISYCSVCDAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPI
3f8rA           GIGVKRRKLPGEQEFAGRGISYCSVCDAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPI
3f8pC           GIGVKRRKLPGEQEFAGRGISYCSVCDAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPI
3f8pB           GIGVKRRKLPGEQEFAGRGISYCSVCDAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPI
3f8pA           GIGVKRRKLPGEQEFAGRGISYCSVCDAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPI
3f8dC           GIGVKRRKLPGEQEFAGRGISYCSVADAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPI
3f8dB           GIGVKRRKLPGEQEFAGRGISYCSVADAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPI
3f8dA           GIGVKRRKLPGEQEFAGRGISYCSVADAPLFKNRVVVIGGGDSALEGAEILSSYSTKVYLIHRRDKAQPI
1hyuA           ATGAKWRNMNVPGEDQYRTVTYCPHCDGPLFKGKRVVIGGGNSGVEAAIDLAGIVEHVTLLE----FAPE
1cl0A           ATGASARYLGLPSEEGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFR-A
1tdfA           ATGASARYLGLPSEEGRGVSACATSDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFR-A
1f6mA           ATGASARYLGLPSEEGRGVSASATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFR-A
1fl2A           ATGAKWRNMNVPGEDQYRTVTYCPHCDGPLFKGKRVVIGGGNSGVEAAIDLAGIVEHVTLLE----FAPE
2q7vB           ATGADPRKLGIPGEDGKGVSTCATCDGFFYXXXXXXXXXXXDAAVEEGMFLTKFADEVTVIHRRDTLRAN
2q7vA           ATGADPRKLGIPGEDGKGVSTCATCDGFFYXXXXXXXXXXXDAAVEEGMFLTKFADEVTVIHRRDTLRAN
2yvjA           ATGAAPRALPTLQGATMPVHTLRTLEDARRIQSRXXXXXXXXXXXXXAATARTAGVHVSLVETQPRLM--
2gr3A           ATGAAPRALPTLQGATMPVHTLRTLEDARRIQSRXXXXXXXXXXXXXAATARTAGVHVSLVETQPRLM--
2gqwA           ATGAAPRALPTLQGATMPVHTLRTLEDARRIQSRXXXXXXXXXXXXXAATARTAGVHVSLVETQPRLM--
1d7yA           ATGAAPRALPTLQGATMPVHTLRTLEDARRIQSRXXXXXXXXXXXXXAATARTAGVHVSLVETQPRLM--
1vdcA           ----------------------------------LAVIGGGDSAMEEANFLTKYGSKVYIIHRRDAFR--
3fg2P           ATGARNRMLDVPNASLPDVLYLRTLDESEVLRQRMVVIGAGFIGLEFAATARAKGLEVDVVELAPRVMAV
2i0zA           ----------------------------------------------------------------------
2vhyB           ----------------------------------------------------------------------
2vhyA           ----------------------------------------------------------------------
2vhxD           ----------------------------------------------------------------------
2vhxC           ----------------------------------------------------------------------
2vhxB           ----------------------------------------------------------------------
2vhxA           ----------------------------------------------------------------------
2vhwE           ----------------------------------------------------------------------
2vhwB           ----------------------------------------------------------------------
2vhwA           ----------------------------------------------------------------------
2vhvA           ----------------------------------------------------------------------
3d8xA           ATGASAKRLPGEETYWQKGISACAVCD-GAVPKPLAVIGGGDSACEEAQFLTKYGSKVFMLVRKDHLRAS


                         .         .         .         +         .         .         .:280
query           QDADAARVLEDVFARRGMTVLGNSRAESVTRTDAGVLVRLTDGRVIEGSHCLMTVGMVPNTANLGLEEAG
1xdiA           EDADAALVLEESFAERGVRLFKNARAASVTRTGAGVLVTMTDGRTVEGSHALMTIGSVPNTSGLGLERVG
1ebdA           FEKQMAAIIKKRLKKKGVEVVTNALAKGAEEREDGVTVTYEETKTIDADYVLVTVGRRPNTDELGLEQIG
1zy8A           GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGVSIEAASGGKAEVITCLVCIGRRPFTKNLGLEELG
2yquA           MDLEVSRAAERVFKKQGLTIRTGVRVTAVVPEAKGARVELEGGEVLEADRVLVAVGRRPYTEGLSLENAG
2eq7A           MDLEVSRAAERVFKKQGLTIRTGVRVTAVVPEAKGARVELEGGEVLEADRVLVAVGRRPYTEGLSLENAG
1zmdE           GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGVSIEAASGGKAEVITCLVCIGRRPFTKNLGLEELG
1zmcD           GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGVSIEAASGGKAEVITCLVCIGRRPFTKNLGLEELG
1zmcB           GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGVSIEAASGGKAEVITCLVCIGRRPFTKNLGLEELG
1zmcA           GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGVSIEAASGGKAEVITCLVCIGRRPFTKNLGLEELG
3ladA           VDEQVAKEAQKILTKQGLKILLGARVTGTEVKNKQVTVKFVDAEGEKSDKLIVAVGRRPVTTDLLAADSG
2f5zI           GDMEISKNFQRILQKQGFKFKLNTKVTGATKKSDGKIEAASKAEVITCDVLLVCIGRRPFTKNLGLEELG
2eq6A           GDPETAALLRRALEKEGIRVRTKTKAVGYEKKKDGLHVRLEPAXXXXXXXXXXXXXXXPRTEGLGLEKAG
1lpfA           ADEQIAKEALKVLTKQGLNIRLGARVTASEVKKKQVTVTFTDANGEQKEKLIVAVGRRPVTTDLLAADSG
1dxlA           MDAEIRKQFQRSLEKQGMKFKLKTKVVGVDTSGDGVKLTVEEQTIIEADVVLVSAGRTPFTSGLNLDKIG
1jehA           MDGEVAKATQKFLKKQGLDFKLSTKVISAKRNDDKNVVEIVDTKTLEAEVLLVAVGRRPYIAGLGAEKIG
1lvlA           YDSELTAPVAESLKKLGIALLGHS----VEGYENGCLLA-NDGKGLEADRVLVAVGRRPRTKGFNLECLD
1zx9A           EDPAIGEAVTAAFRAEGIEVLEHTQASQVAHMDGEFVLTTTHGE-LRADKLLVATGRTPNTRSLALDAAG
1zk7A           EDPAIGEAVTAAFRAEGIEVLEHTQASQVAHMDGEFVLTTTHGE-LRADKLLVATGRTPNTRSLALDAAG
2a8xA           EDADVSKEIEKQFKKLGVTILTATKVESIADGGSQVTVTVTKDGVLKAEKVLQAIGFAPNVEGYGLDKAG
2r9zB           FDPLLSATLAENMHAQGIETHLEFAVAALERDAQGTTLVAQDGTRLEGDSVIWAVGRAPNTRDLGLEAAG
2r9zA           FDPLLSATLAENMHAQGIETHLEFAVAALERDAQGTTLVAQDGTRLEGDSVIWAVGRAPNTRDLGLEAAG
2rabB           FDPLLSATLAENMHAQGIETHLEFAVAALERDAQGTTLVAQDGTRLGFDSVIWAVGRAPNTRDLGLEAAG
2rabA           FDPLLSATLAENMHAQGIETHLEFAVAALERDAQGTTLVAQDGTRLGFDSVIWAVGRAPNTRDLGLEAAG
1ojtA           ADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQVLVAAGRAPNGKLISAEKAG
1bhyA           ADRDLVKVWQKQNEYRFDNIMVNTKTVAVEPKEDGVYVTFEGANAPKEPQVLVAAGRAPNGKLISAEKAG
2qaeA           LDEDVTNALVGALAKNEMKFMTSTKVVGGTNNGDSVSLEVEGKRTVTCEALLVSVGRRPFTGGLGLDKIN
2grtA           FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLMVTAVPGRLIPDVDCLLAIGRVPNTKDLSLNKLG
1grtA           FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLMVTAVPGRLIPDVDCLLAIGRVPNTKDLSLNKLG
2w0hB           FDTEVRKSLTKQLGANGIRVRTNLNPTKITKNEDGSNVHFNDGTEEDYDQVMLAIGRVPRSQALQLDKAG
2w0hA           FDTEVRKSLTKQLGANGIRVRTNLNPTKITKNEDGSNVHFNDGTEEDYDQVMLAIGRVPRSQALQLDKAG
2jk6A           FDTEVRKSLTKQLGANGIRVRTNLNPTKITKNEDGSNVHFNDGTEEDYDQVMLAIGRVPRSQALQLDKAG
2ve2B           FDETIREEVTKQLTANGIEIMTNENPAKVSNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTNDLQLGNVG
2ve2A           FDETIREEVTKQLTANGIEIMTNENPAKVSNTDGSKHVTFESGKTLDVDVVMMAIGRIPRTNDLQLGNVG
1grbA           FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLMVTAVPGRLIPDVDCLLAIGRVPNTKDLSLNKLG
3dk9A           FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLMVTAVPGRLIPDVDCLLAIGRVPNTKDLSLNKLG
1gesB           FDPMISETLVEVMNAEGPQLHTNAIPKAVVKTDGSLTLELEDGRSETVDCLIWAIGREPANDNINLEAAG
1gesA           FDPMISETLVEVMNAEGPQLHTNAIPKAVVKTDGSLTLELEDGRSETVDCLIWAIGREPANDNINLEAAG
1grgA           FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLMVTAVPGRLIPDVDCLLAIGRVPNTKDLSLNKLG
2tprA           FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLEKAG
1gxfA           FDHTLREELTKQLTANGIQILTKENPAKVENADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAG
1fecB           FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLEKAG
1fecA           FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLEKAG
1feaB           FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLEKAG
1feaA           FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLEKAG
1bzlA           FDHTLREELTKQLTANGIQILTKENPAKVENADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAG
1aogB           FDHTLREELTKQLTANGIQILTKENPAKVENADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAG
1aogA           FDHTLREELTKQLTANGIQILTKENPAKVENADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAG
1ndaA           FDHTLREELTKQLTANGIQILTKENPAKVENADGSKSVTFESGKKMDFDLVMMAIGRSPRTKDLQLQNAG
1tytB           FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLDKAG
1tytA           FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLDKAG
1typB           FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLDKAG
1typA           FDSELRKQLTEQLRANGINVRTHENPAKVTKNADGTRVVFESGAEADYDVVMLAIGRVPRSQTLQLDKAG
1gerB           FDPMISETLVEVMNAEGPQLHTNAIPKAVVKTDGSLTLELEDGRSETVDCLIWAIGREPANDNINLEAAG
1gerA           FDPMISETLVEVMNAEGPQLHTNAIPKAVVKTDGSLTLELEDGRSETVDCLIWAIGREPANDNINLEAAG
1dncA           FDSMISTNCTEELENAGVEVLKFSQVKEVKKTLSGLMVTAVPGRLIPDVDCLLAIGRVPNTKDLSLNKLG
1gsnA           FDSMISTNTEEL-ENAGVEVLKFSQVKEVKKTLSGLMVTAVPGRLIPDVDLLWAIGRVPNTKDLSLNKLG
1zkqA           FDQQMSSLVTEHMESHGTQFLKGCVPSHIKKLPTNQLVTWEDGKEDTGTFVLWAIGRVPETRTLNLEKAG
1zdlA           FDQQMSSLVTEHMESHGTQFLKGCVPSHIKKLPTNQLVTWEDGKEDTGTFVLWAIGRVPETRTLNLEKAG
2nvkX           FDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGLLVKYKNVETGEESEVLWAIGRKGLVDDLNLPNAG
3dh9A           FDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGLLVKYKNVETGEESEVLWAIGRKGLVDDLNLPNAG
3dghA           FDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGLLVKYKNVETGEESEVLWAIGRKGLVDDLNLPNAG
3dghB           FDQQMAELVAASMEERGIPFLRKTVPLSVEKQDDGLLVKYKNVETGEESEVLWAIGRKGLVDDLNLPNAG
2v6oA           FDQQMAEKVGDYMENHGVKFIKQLKVVDTENNKPGLLLHYTDGKKFEEEFVIFAVGREPQLSKVLCETVG
3h4kA           FDQQMAEKVGDYMENHGVKFIKQLKVVDTENNKPGLLLHYTDGKKFEEEFVIFAVGREPQLSKVLCETVG
2hqmA           FDECIQNTITDHYVKEGINVHKLSKIVKVEKNVTDKLIHMNDSKSIDDDELIWTIGR-KSHLGMGSENVG
1onfA           FDESVINVLENDMKKNNINIVTFADVVEIKKSDKNLSIHLSDGRIYEHDHVIYCVGRSPDTENLKLEKLN
3eanF           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEDNTVLLAVGRDSCTRTIGLETVG
3eanD           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEDNTVLLAVGRDSCTRTIGLETVG
3eanC           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEDNTVLLAVGRDSCTRTIGLETVG
3eanA           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEDNTVLLAVGRDSCTRTIGLETVG
1h6vE           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEDNTVLLAVGRDSCTRTIGLETVG
1h6vC           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEDNTVLLAVGRDSCTRTIGLETVG
1h6vB           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEDNTVLLAVGRDSCTRTIGLETVG
1h6vA           FDQDMANKIGEHMEEHGIKFIRQFVPTKIEQIEAGTPGRLNSEETIEDNTVLLAVGRDSCTRTIGLETVG
2zzcA           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
2zzbC           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
2zz0B           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
2j3nF           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
2j3nD           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
2j3nC           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
2j3nB           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
2j3nA           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
2cfyA           FDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLNSEEIIEGEYVMLAIGRDACTRKIGLETVG
3ic9C           QD-EEKRYAEKTFNEEFYFDAKARVISTIEKEDAVEVIYFSGQKTTESQYVLAATGRKANVDKLGLENTS
3ic9A           QD-EEKRYAEKTFNEEFYFDAKARVISTIEKEDAVEVIYFSGQKTTESQYVLAATGRKANVDKLGLENTS
3cgcA           YDGDMAEYIYKEADKHHIEILTNENVKAFKGNERVEAVE-TDKGTYKADLVLVSVGVKPNTD--FLEGTN
2cduB           YDKEFTDILAKDYEAHGVNLVLGSKVAAFEEVDDEIITKTLDGKEIKSDIAILCIGFRPNTE---LLKGK
2cduA           YDKEFTDILAKDYEAHGVNLVLGSKVAAFEEVDDEIITKTLDGKEIKSDIAILCIGFRPNTE---LLKGK
1joaA           YDKEFTDVLTEEMEANNITIATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGT
1f8wA           YDKEFTDVLTEEMEANNITIATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGT
2v3aA           LHPAAAKAVQAGLEGLGVRFHLGPVLASLKKAGEGLEAHLSDGEVIPCDLVVSAVGLRPRT-ELAF-AAG
1nhsA           YDKEFTDVLTEEMEANNITIATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGT
3iwaA           FTSKSSQMLRHDLEKNDVVVHTGEKVVRLEGENGKVARVITDKRTLDADLVILAAGVSPNTQLA--RDAG
1nhqA           YDKEFTDVLTEEMEANNITIATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGT
1nhrA           YDKEFTDVLTEEMEANNITIATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGT
1nhpA           YDKEFTDVLTEEMEANNITIATGETVERY-EGDGRVQKVVTDKNAYDADLVVVAVGVRPNTAWL---KGT
1mo9A           KDNETRAYVLDRMKEQGMEIISGSNVTRIEEDANGVVAMTPNGEMIETDFVFLGLGEQPRSAELA-KILG
2bc1A           YDRDLTDLMAKNMEEHGIQVAGNGKVEKI----------ITDKNEYDVDMVILAVGFRPNTT---LGNGK
2bc0A           YDRDLTDLMAKNMEEHGIQVAGNGKVEKI----------ITDKNEYDVDMVILAVGFRPNTT---LGNGK
3ctyB           -------------------------------------------KLIETDGVFIYVGLIPQTSFL--KDSG
3ctyA           -------------------------------------------KLIETDGVFIYVGLIPQTSFL--KDSG
1m6iA           YLSNWT--MEKV-RREGVKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLE
3cgbA           YDGDAEYIYKEA-DKHHIEILTNENVKAFKGNERVEAVE-TDKGTYKADLVLVSVGVKPNTDFL--EGTN
1gv4A           YLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLE
3gd4B           YLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLE
3gd4A           YLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLE
3gd3D           YLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLE
3gd3C           YLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLE
3gd3B           YLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLE
3gd3A           YLSNWT--MEKV-KREGVKVMPNAIVQSVGVSGGRLLIKLKDGRKVETDHIVTAVGLEPNVELAKTGGLE
3f8pD           YVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNG
3ef6A           LGRRIGAWLRGLLTELGVQVELGTGVVGFSGEGQLEQVMASDGRSFVADSALICVGAEP--ADQLARQAG
1xhcA           LDEELSNMIKDMLEETGVKFFLNS--ELLEANEEGVL---TNSGFIEGKVKICAIGIVPNVDLA--RRSG
1yqzA           MDADMNQPILDELDKREIPY----RLXXXXXXXXXXXXTFKSGKVEHYDMIIEGVGTHPNSKFI--ESSN
1q1wB           VTAPPVSAFYEVDIRTGTQVCGFEMSTDQQKVTA---VLCEDGTRLPADLVIAGIGLIPNCEL--ASAAG
1q1wA           VTAPPVSAFYEVDIRTGTQVCGFEMSTDQQKVTA---VLCEDGTRLPADLVIAGIGLIPNCEL--ASAAG
1q1rA           VTAPPVSAFYEVDIRTGTQVCGFEMSTDQQKVTA---VLCEDGTRLPADLVIAGIGLIPNCEL--ASAAG
3f8rD           FKAQPIYV-ETVKKKPNVEFVLNSVVKEIXXXXXXXXXXXXXXXX---NGVFIEIGFDPPTDFA--KSNG
3f8dD           FKAQPIYV-ETVKKKPNVEFVLNSVVKEIXXXXXXXXXXXXXXXX---NGVFIEIGFDPPTDFA--KSNG
3f8rB           YVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNG
3f8rA           YVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNG
3f8pC           YVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNG
3f8pB           YVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNG
3f8pA           YVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNG
3f8dC           YVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNG
3f8dB           YVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNG
3f8dA           YVETVKKKPNVEFVLN--SVVKEIKGDKVVKQVVVENLKTGEIKELNVNGVFIEIGFDPPTDFA--KSNG
1hyuA           MKAD--QVLQDVRSLKNVDIILNAQTTEVKGDGSKVVGLEYRDRVSGDIHSVVQIGLLPNTHWL---EGA
1cl0A           EKILIKRLMDKV--ENGNIILHTNRTEEVTGDQMGVTVRLRDTQNSDNIESLDVAGLIGHSPNTAIFEGQ
1tdfA           EKILIKRLMDKV--ENGNIILHTNRTEEVTGDQMGVTVRLRDTQNSDNIESLDVAGLIGHSPNTAIFEGQ
1f6mA           EKILIKRLMDKV--ENGNIILHTNRTEEVTGDQMGVTVRLRDTQNSDNIESLDVAGLIGHSPNTAIFEGQ
1fl2A           MKAD--QVLQDKLSLKNVDIILNAQTTEV-KGDGSKVVGLEDIHNIELAGIFVQIGLLPNTNWL---EGA
2q7vB           KVAQAR-----AFANPKMKFIWDTAVEEIQGADSGVKLRLKTGEVSETDGVFIFIGHVPNTA---FVKDT
2q7vA           KVAQAR-----AFANPKMKFIWDTAVEEIQGADSGVKLRLKTGEVSETDGVFIFIGHVPNTA---FVKDT
2yvjA           -SRAAPATLADFVARYHAAQGVDLRFESVTGSVDGV-VLLDDGTRIAAD--MVVVGIXXXXXXXXXXXXX
2gr3A           -SRAAPATLADFVARYHAAQGVDLRFESVTGSVDGV-VLLDDGTRIAAD--MVVVGIXXXXXXXXXXXXX
2gqwA           -SRAAPATLADFVARYHAAQGVDLRFESVTGSVDGV-VLLDDGTRIAAD--MVVVGIXXXXXXXXXXXXX
1d7yA           -SRAAPATLADFVARYHAAQGVDLRFESVTGSVDGV-VLLDDGTRIAAD--MVVVGIXXXXXXXXXXXXX
1vdcA           ----ASKIMQQALSNPKIDVIWNSSVEAYGDGERDVLGGLKVKNVVTGSGLFFAIGHEPATKFL---DGG
3fg2P           VTPEISSYFHDRHSGAGIRMHYGVRAEIAAEGDRVTGVVLSDGNTLPCDLXXXXXXXIPNVE----XXXX
2i0zA           ----------------------------------------------------------------------
2vhyB           ----------------------------------------------------------------------
2vhyA           ----------------------------------------------------------------------
2vhxD           ----------------------------------------------------------------------
2vhxC           ----------------------------------------------------------------------
2vhxB           ----------------------------------------------------------------------
2vhxA           ----------------------------------------------------------------------
2vhwE           ----------------------------------------------------------------------
2vhwB           ----------------------------------------------------------------------
2vhwA           ----------------------------------------------------------------------
2vhvA           ----------------------------------------------------------------------
3d8xA           KRAEKNEKIEILYNTVALEAKGDGKLLNALRIKNTKKNEETDLPV---SGLFYAIGHTPATK---IVAGQ


                         .         *         .         .         .         .         +:350
query           IRLDERGFVQVDRVSRTSTPGVYAAGDCTGVNMLASVAAMQGRIAMWHALGAAVSPLRLSTVASTVFTHP
1xdiA           IQLGRGNYLTVDRVSRTLATGIYAAGDCTGLLPLASVAAMQGRIAMYHALGEGVSPIRLRTVAATVFTRP
1ebdA           IKMTNRGLIEVDQQCRTSVPNIFAIGDIVPGPALAHKASYEGKVAA-EAIAGHPSAVDYVAIPAVVFSDP
1zy8A           IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
2yquA           LSTDERGRIPVDEHLRTRVPHIYAIGDVVRGPMLAHKASEEGIAAVEHMV-RGFGHVDYQAIPSVVYTHP
2eq7A           LSTDERGRIPVDEHLRTRVPHIYAIGDVVRGPMLAHKASEEGIAAVEHMV-RGFGHVDYQAIPSVVYTHP
1zmdE           IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
1zmcD           IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
1zmcB           IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
1zmcA           IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
3ladA           VTLDERGFIYVDDYCATSVPGVYAIGDVVRGAMLAHKASEEG-VVVAERIAGHKAQMNYDLIPAVIYTHP
2f5zI           IELDPRGRIPVNTRFQTKIPNIYAIGDVVAGPMLAHKAEDEGIICVEGMAGGAVH-IDYNCVPSVIYTHP
2eq6A           VKVDERGFIRVNARMETSVPGVYAIGDAARPPLLAHKAMREGLIAAENAAGK--DSAFDYQVPSVVYTSP
1lpfA           VTLDERGFIYVDDHCKTSVPGVFAIGDVVRGAMLAHKASEEG-VMVAERIAGHKAQMNYDLIPSVIYTHP
1dxlA           VETDKLGRILVNERFSTNVSGVYAIGDVIPGPMLAHKAEEDG-VACVEYLAGKVGHVDYDKVPGVVYTNP
1jehA           LEVDKRGRLVIDDQFNSKFPHIKVVGDVTFGPMLAHKAEEEG-IAAVEMLKTGHGHVNYNNIPSVMYSHP
1lvlA           LKMNGAA-IAIDERCQTSMHNVWAIGDVAGEPMLAHRAMAQGEMVAEIIAGKA-RRFEPAAIAAVCFTDP
1zx9A           VTVNAQGAIVIDQGMRTSNPNIYAAGDCTDQPQFVYVXXXXXXXXXINMTGGDAA-LDLTAMPAVVFTDP
1zk7A           VTVNAQGAIVIDQGMRTSNPNIYAAGDCTDQPQFVYVXXXXXXXXXINMTGGDAA-LDLTAMPAVVFTDP
2a8xA           VALTDRKAIGVDDY-RTNVGHIYAIGDVNGLLQLAHVAEAQGVVAAETIAGAETLTLGDHRLPRATFCQP
2r9zB           IEVQSNGMVPTDAYQNTNVPGVYALGDITGRDQLTPVAIAAGRLAERLFDGQSERKLDYDNIPTVVFAHP
2r9zA           IEVQSNGMVPTDAYQNTNVPGVYALGDITGRDQLTPVAIAAGRLAERLFDGQSERKLDYDNIPTVVFAHP
2rabB           IEVQSNGMVPTDAYQNTNVPGVYALGDITGRDQLTPVAIAAGRLAERLFDGQSERKLDYDNIPTVVFAHP
2rabA           IEVQSNGMVPTDAYQNTNVPGVYALGDITGRDQLTPVAIAAGRLAERLFDGQSERKLDYDNIPTVVFAHP
1ojtA           VAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHK-AYFDARVIPGVAYTSP
1bhyA           VAVTDRGFIEVDKQMRTNVPHIYAIGDIVGQPMLAHKAVHEGHVAAENCAGHK-AYFDARVIPGVAYTSP
2qaeA           VAKNERGFVKIGDHFETSIPDVYAIGDVVDKGPMLAHKAEDEGVACAEILAGKPGHVNYGVIPAVIYTMP
2grtA           IQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-KLAHRLYKEDSKLDYNNIPTVVFSHP
1grtA           IQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-KLAHRLYKEDSKLDYNNIPTVVFSHP
2w0hB           VRTGKNGAVQVDAYSKTSVDNIYAIGDVTNRVMLTPVAINEGAAFVETVFGGKPRATDHTKVACAVFSIP
2w0hA           VRTGKNGAVQVDAYSKTSVDNIYAIGDVTNRVMLTPVAINEGAAFVETVFGGKPRATDHTKVACAVFSIP
2jk6A           VRTGKNGAVQVDAYSKTSVDNIYAIGDVTNRVMLTPVAINEGAAFVETVFGGKPRATDHTKVACAVFSIP
2ve2B           VKLTPKGGVQVDEFSRTNVPNIYAIGDITDRLMLTPVAINEGAALVDTVFGNKPRKTDHTRVASAVFSIP
2ve2A           VKLTPKGGVQVDEFSRTNVPNIYAIGDITDRLMLTPVAINEGAALVDTVFGNKPRKTDHTRVASAVFSIP
1grbA           IQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-KLAHRLYKEDSKLDYNNIPTVVFSHP
3dk9A           IQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-KLAHRLYKEDSKLDYNNIPTVVFSHP
1gesB           VKTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDELDYSNIPTVVFSHP
1gesA           VKTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDELDYSNIPTVVFSHP
1grgA           IQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-KLAHRLYKEDSKLDYNNIPTVVFSHP
2tprA           VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHTKVACAVFSIP
1gxfA           VMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIP
1fecB           VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHTKVACAVFSIP
1fecA           VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHTKVACAVFSIP
1feaB           VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHTKVACAVFSIP
1feaA           VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHTKVACAVFSIP
1bzlA           VMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIP
1aogB           VMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIP
1aogA           VMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTTPRKTDHTRVASAVFSIP
1ndaA           VMI-KNGGVQVDEYSRTNVSNIYAIGDVTNRVMLTPVAINEAAALVDTVFGTNPRKTDHTRVASAVFSIP
1tytB           VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHTKVACAVFSIP
1tytA           VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHTKVACAVFSIP
1typB           VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHTKVACAVFSIP
1typA           VEVAKNGAIKVDAYSKTNVDNIYAIGDVTDRVMLTPVAINEGAAFVDTVFANKPRATDHTKVACAVFSIP
1gerB           VKTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDELDYSNIPTVVFSHP
1gerA           VKTNEKGYIVVDKYQNTNIEGIYAVGDNTGAVELTPVAVAAGRRLSERLFNNKPDELDYSNIPTVVFSHP
1dncA           IQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-KLAHRLYKEDSKLDYNNIPTVVFSHP
1gsnA           IQTDDKGHIIVDEFQNTNVKGIYAVGDVCGKALLTPVAIAAGR-KLAHRLYKEDSKLDYNNIPTVVFSHP
1zkqA           ISTNPKNKIIVDAQEATSVPHIYAIGDAEGRPELTPTAIKAGKLLAQRLFGKSSTLMDYSNVPTTVFTPL
1zdlA           ISTNPKNKIIVDAQEATSVPHIYAIGDAEGRPELTPTAIKAGKLLAQRLFGKSSTLMDYSNVPTTVFTPL
2nvkX           VTV-QKDKIPVDSQEATNVANIYAVGDIIGKPELTPXXXXXXXXXXXXXXXXSTQRMDYKDVATTVFTPL
3dh9A           VTV-QKDKIPVDSQEATNVANIYAVGDIIGKPELTPXXXXXXXXXXXXXXXXSTQRMDYKDVATTVFTPL
3dghA           VTV-QKDKIPVDSQEATNVANIYAVGDIIGKPELTPXXXXXXXXXXXXXXXXSTQRMDYKDVATTVFTPL
3dghB           VTV-QKDKIPVDSQEATNVANIYAVGDIIGKPELTPXXXXXXXXXXXXXXXXSTQRMDYKDVATTVFTPL
2v6oA           VKLDKNGRVVCTDDEQTTVSNVYAIGDINGKPQLTPVAIQAGRYLARRLFAGATELTDYSNVATTVFTPL
3h4kA           VKLDKNGRVVCTDDEQTTVSNVYAIGDINGKPQLTPVAIQAGRYLARRLFAGATELTDYSNVATTVFTPL
2hqmA           IKLNSHDQIIADEYQNTNVPNIYSLGDVVGKVELTPVAIAAGRKLSNRLFGPEKDKLDYENVPSVIFSHP
1onfA           VETNNN-YIVVDENQRTSVNNIYAVGDCCMVKFLTPVAINAGRLLADRLFLKKTRKTNYKLIPTVIFSHP
3eanF           VKINEKGKIPVTDEEQTNVPYIYAIGDLEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
3eanD           VKINEKGKIPVTDEEQTNVPYIYAIGDLEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
3eanC           VKINEKGKIPVTDEEQTNVPYIYAIGDLEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
3eanA           VKINEKGKIPVTDEEQTNVPYIYAIGDLEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
1h6vE           VKINEKGKIPVTDEEQTNVPYIYAIGDLEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
1h6vC           VKINEKGKIPVTDEEQTNVPYIYAIGDLEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
1h6vB           VKINEKGKIPVTDEEQTNVPYIYAIGDLEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
1h6vA           VKINEKGKIPVTDEEQTNVPYIYAIGDLEGKLELTPVAIQAGRLLAQRLYGGSTVKCDYDNVPTTVFTPL
2zzcA           VKINEKGKIPVTDEEQTNVPYIYAIGDILEDKVLTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
2zzbC           VKINEKGKIPVTDEEQTNVPYIYAIGDILEDKVLTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
2zz0B           VKINEKGKIPVTDEEQTNVPYIYAIGDILEDKVLTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
2j3nF           VKINEKGKIPVTDEEQTNVPYIYAIGDILEDKVLTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
2j3nD           VKINEKGKIPVTDEEQTNVPYIYAIGDILEDKVLTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
2j3nC           VKINEKGKIPVTDEEQTNVPYIYAIGDILEDKVLTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
2j3nB           VKINEKGKIPVTDEEQTNVPYIYAIGDILEDKVLTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
2j3nA           VKINEKGKIPVTDEEQTNVPYIYAIGDILEDKVLTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
2cfyA           VKINEKGKIPVTDEEQTNVPYIYAIGDILEDKVLTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
3ic9C           IELDKKNSPLFDELTQTSVDHIFVAGDANNTLTLLHEAADDGKVAGTNA-GAVIAQGQRRAPLSVVFTEP
3ic9A           IELDKKNSPLFDELTQTSVDHIFVAGDANNTLTLLHEAADDGKVAGTNA-GAVIAQGQRRAPLSVVFTEP
3cgcA           IRTNHKGAIEVNAYMQTNVQDVYAAGDCTHYHVIKEIANKQGRLAGLNMLDKRRAFKGTLGTGIIKFMNL
2cduB           VAMLDNGAIITDEYMHSSNRDIFAAGDSAAVHYLATNAVRQGRLVGLNLTEDKVKD--MGTQSSSGLKLY
2cduA           VAMLDNGAIITDEYMHSSNRDIFAAGDSAAVHYLATNAVRQGRLVGLNLTEDKVKD--MGTQSSSGLKLY
1joaA           LELHPNGLIKTDEYMRTSEPDVFAVGDATLIKALATNARKQGRFAVKN-LEEPVKPFPQGSSGLAVFDY-
1f8wA           LELHPNGLIKTDEYMRTSEPDVFAVGDATLIKALATNAMKQGRFAVKN-LEEPVKPFPQGSSGLAVFDY-
2v3aA           LAVN-RGIV-VDRSLRTSHANIYALGDCAGLNLLYVMPLMACARALAQTLAGNPSQVAYGPMPVTVKT-P
1nhsA           LELHPNGLIKTDEYMRTSEPDVFAVGDATLIKALATNARKQGRFAVKN-LEEPVKPFPQGSSGLAVFDY-
3iwaA           LELDPRGAIIVDTRMRTSDPDIFAGGDCVGFFPLGSMANRQGRVIGTNADGDATFPGAVGSWAVKLF---
1nhqA           LELHPNGLIKTDEYMRTSEPDVFAVGDATLIKALATNARKQGRFAVKN-LEEPVKPFPQGSSGLAVFDY-
1nhrA           LELHPNGLIKTDEYMRTSEPDVFAVGDATLIKALATNARKQGRFAVKN-LEEPVKPFPQGSSGLAVFDY-
1nhpA           LELHPNGLIKTDEYMRTSEPDVFAVGDATLIKALATNARKQGRFAVKN-LEEPVKPFPQGSSGLAVFDY-
1mo9A           LDLGPKGEVLVNEYLQTSVPNVYAVGDLIGGPMEMFKARKSGCYAARNVMGEKIS-YTPKNYPDFLHTHY
2bc1A           IDLFRNGAFLVNKRQETSIPGVYAIGDCTNYIALASNAVRTGIVAAHNACGTDLEGIGVQGSNGISIYGL
2bc0A           IDLFRNGAFLVNKRQETSIPGVYAIGDCTNYIALASNAVRTGIVAAHNACGTDLEGIGVQGSNGISIYGL
3ctyB           VKLDERGYIVVDSRQRTSVPGVYAAGDVTSGN-FAQIASAVG----------------------------
3ctyA           VKLDERGYIVVDSRQRTSVPGVYAAGDVTSGN-FAQIASAVG----------------------------
1m6iA           IDSDFGGFVNAELQARSN---IWVAGD-------------------------------------------
3cgbA           IRTNHKGAIEVNAY-QTNVQDVYAAGDCTHYHVIKEIANKQGRLAGLNLDKRRAFKGTLGT--GIIKFNL
1gv4A           IDSDFGGFVNAELQARSN---IWVAGD-------------------------------------------
3gd4B           IDSDFGGFVNAELQARSN---IWVAGD-------------------------------------------
3gd4A           IDSDFGGFVNAELQARSN---IWVAGD-------------------------------------------
3gd3D           IDSDFGGFVNAELQARSN---IWVAGD-------------------------------------------
3gd3C           IDSDFGGFVNAELQARSN---IWVAGD-------------------------------------------
3gd3B           IDSDFGGFVNAELQARSN---IWVAGD-------------------------------------------
3gd3A           IDSDFGGFVNAELQARSN---IWVAGD-------------------------------------------
3f8pD           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3ef6A           LACD-RGVI-VDHCGATLAKGVFAVGD-------------------------------------------
1xhcA           IHTG-RGIL-IDDNFRTSAKDVYAIGDCSGIIAGTAKAAME-----------------------------
1yqzA           IKLDRKGFIPVNDKFETNVPNIYAIGD-------------------------------------------
1q1wB           LQVDNG--IVINEHMQTSDPLIMAVGDC------------------------------------------
1q1wA           LQVDNG--IVINEHMQTSDPLIMAVGDC------------------------------------------
1q1rA           LQVDNG--IVINEHMQTSDPLIMAVGDC------------------------------------------
3f8rD           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3f8dD           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3f8rB           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3f8rA           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3f8pC           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3f8pB           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3f8pA           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3f8dC           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3f8dB           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
3f8dA           IETDTNGYIKVDEWMRTSVPGVFAAGDCT-----------------------------------------
1hyuA           LERNRMGEIIIDAKCETSVKGVFAAGDCTTV---------------------------------------
1cl0A           LEL-ENGYIKVQNATQTSIPGVFAAGD-------------------------------------------
1tdfA           LEL-ENGYIKVQNATQTSIPGVFAAGD-------------------------------------------
1f6mA           LEL-ENGYIKVQNATQTSIPGVFAAGD-------------------------------------------
1fl2A           VERNRMGEIIIDAKCETNVKGVFAAGDCTTV---------------------------------------
2q7vB           VSLRDDGYVDVRDEIYTNIPMLFAAGD-------------------------------------------
2q7vA           VSLRDDGYVDVRDEIYTNIPMLFAAGD-------------------------------------------
2yvjA           XXXXXXIF--VDAYGRTTCPDVYALGDVT-----------------------------------------
2gr3A           XXXXXXIF--VDAYGRTTCPDVYALGDVT-----------------------------------------
2gqwA           XXXXXXIF--VDAYGRTTCPDVYALGDVT-----------------------------------------
1d7yA           XXXXXXIF--VDAYGRTTCPDVYALGDVT-----------------------------------------
1vdcA           VELDSDGYVVTKPTTQTSVPGVFAAGD-------------------------------------------
3fg2P           XXXXXXXXXXVDQQLLTSDPHISAIGDC------------------------------------------
2i0zA           ----------------------------------------------------------------------
2vhyB           ----------------------------------------------------------------------
2vhyA           ----------------------------------------------------------------------
2vhxD           ----------------------------------------------------------------------
2vhxC           ----------------------------------------------------------------------
2vhxB           ----------------------------------------------------------------------
2vhxA           ----------------------------------------------------------------------
2vhwE           ----------------------------------------------------------------------
2vhwB           ----------------------------------------------------------------------
2vhwA           ----------------------------------------------------------------------
2vhvA           ----------------------------------------------------------------------
3d8xA           VDTDEAGYIKVPGSSLTSVPGFFAAGD-------------------------------------------


                         .         .         .         .         *         .         .:420
query           ELAAVGATEDDVVSGRVDGRIVKLPLATNPRAKMHNTRDGFVKLICRQHTGIVLGGVIVGPRASELILAV
1xdiA           EIAAVGVPQSVIDAGSVAARTIMLPLRTNARAKMSEMRHGFVKIFCRRSTXXXXXXXXXAPIASELILPI
1ebdA           ECASVGYFEQQAKDEGIDVIAAKFPFAANGRALALNDTDGFLKLVVRKEDGVIIGAQIIGPNASDMIAEL
1zy8A           EVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEA
2yquA           EIAAVGYTEEELKAQGIPYKVGKFPYSASGRARAMGETEGFIKVLAHAKTDRILGVHGIGARVGDVXXXX
2eq7A           EIAAVGYTEEELKAQGIPYKVGKFPYSASGRARAMGETEGFIKVLAHAKTDRILGVHGIGARVGDVXXXX
1zmdE           EVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEA
1zmcD           EVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEA
1zmcB           EVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEA
1zmcA           EVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEA
3ladA           EIAGVGKTEQALKAEGVAINVGVFPFAASGRAMAANDTAGFVKVIADAKTDRVLGVHVIGPSAAELVQQG
2f5zI           EVAWVGKSEEQLKEEGIEYKVGKFPFAANSRAKTNADTDGMVKILGQKSTDRVLGAHILGPGAGEMVNEA
2eq6A           EWAGVGLTEEEAKRAGYKVKVGKFPLAASGRALTLGGAEGMVKVVGDEETDLLLGVFIVGPQXXXXXXXX
1lpfA           EIAWVGKTEQTLKAEGVEVNVGTFPFAASGRAMAANDTTGLVKVIADAKTDRVLGVHVIGPSAAELVQQG
1dxlA           EVASVGKTEEQVKETGVEYRVGKFPFMANSRAKAIDNAEGLVKIIAEKETDKILGVHIMAPNAGELIHEA
1jehA           EVAWVGKTEEQLKEAGIDYKIGKFPFAANSRAKTNQDTEGFVKILIDSKTERILGAHIIGPNAGEMIAEA
1lvlA           EVVVVGKTPEQASQQGLDCIVAQFPFAANGRAMSLESKSGFVRVVARRDNHLILGWQAVGVAVSELSTAF
1zx9A           QVATVGYSEAEAHHDGIETDSRTLTLDNVPRALANFDTRGFIKLVIEEGSHRLIGVQAVAPEAGELIQTA
1zk7A           QVATVGYSEAEAHHDGIETDSRTLTLDNVPRALANFDTRGFIKLVIEEGSHRLIGVQAVAPEAGELIQTA
2a8xA           NVASFGLTEQQARNEGYDVVVAKFPFTANAKAHGVGDPSGFVKLVADAKXXXXXXXXXXXXDVAELLPEL
2r9zB           PLSKVGLSEPEARERLGDVLTVYETSFTPMRYALHGPKTA-MKLVCAGPEQRVVGVHVIGDGADEMLQGF
2r9zA           PLSKVGLSEPEARERLGDVLTVYETSFTPMRYALHGPKTA-MKLVCAGPEQRVVGVHVIGDGADEMLQGF
2rabB           PLSKVGLSEPEARERLGDVLTVYETSFTPMRYALHGPKTA-MKLVCAGPEQRVVGVHVIGDGADEMLQGF
2rabA           PLSKVGLSEPEARERLGDVLTVYETSFTPMRYALHGPKTA-MKLVCAGPEQRVVGVHVIGDGADEMLQGF
1ojtA           EVAWVGETE---LSAKASARKINFPWAASGRAIANGCDKPFTKLIFDAETXXXXXXXXXXXXXXXXXXEV
1bhyA           EVAWVGETE---LSAKASARKINFPWAASGRAIANGCDKPFTKLIFDAETXXXXXXXXXXXXXXXXXXEV
2qaeA           EVASVGKSEDELKKEGVAYKVGKFPFNANSRAKAVSTEDGFVKVLVDKATDRILGVHIVCTTAGELIGEA
2grtA           PIGTVGLTEDEAIHGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGF
1grtA           PIGTVGLTEDEAIHGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGF
2w0hB           PIGTCGMTEEEAAKNYETVAVYATPLMHNISGSKH--KEFMIRIITNESNGEVLGVHMLGDSAPEIIQSV
2w0hA           PIGTCGMTEEEAAKNYETVAVYATPLMHNISGSKH--KEFMIRIITNESNGEVLGVHMLGDSAPEIIQSV
2jk6A           PIGTCGMTEEEAAKNYETVAVYATPLMHNISGSKH--KEFMIRIITNESNGEVLGVHMLGDSAPEIIQSV
2ve2B           PIGTCGL----IXXXXXXXXXXXXXYMSSFTPLMHNISGSFVAKIVTNHSGTVLGVHLLGDGAPEIIQAV
2ve2A           PIGTCGL----IXXXXXXXXXXXXXYMSSFTPLMHNISGSFVAKIVTNHSGTVLGVHLLGDGAPEIIQAV
1grbA           PIGTVGLTEDEAIHGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGF
3dk9A           PIGTVGLTEDEAIHGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGF
1gesB           PIGTVGLTEPQAREGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGF
1gesA           PIGTVGLTEPQAREGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGF
1grgA           PIGTVGLTEDEAIHGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGF
2tprA           PMGVCGYVEEDAAKKYDQVAVYETPLMHNISGSTY--KKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSV
1gxfA           PIGTCGLIE-EVASKRYEVVAVYLSSFTPLMHKVSGSKKTFVKIITNHSDGTVLGVHLLGDNAPEIIQGI
1fecB           PMGVCGYVEEDAAKKYDQVAVYETPLMHNISGSTY--KKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSV
1fecA           PMGVCGYVEEDAAKKYDQVAVYETPLMHNISGSTY--KKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSV
1feaB           PMGVCGYVEEDAAKKYDQVAVYETPLMHNISGSTY--KKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSV
1feaA           PMGVCGYVEEDAAKKYDQVAVYETPLMHNISGSTY--KKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSV
1bzlA           PIGTCGLIE-EVASKRYEVVAVYLSSFTPLMHKVSGSKKTFVKIITNHSDGTVLGVHLLGDNAPEIIQGI
1aogB           PIGTCGLIE-EVASKRYEVVAVYLSSFTPLMHKVSGSKKTFVKIITNHSDGTVLGVHLLGDNAPEIIQGI
1aogA           PIGTCGLIE-EVASKRYEVVAVYLSSFTPLMHKVSGSKKTFVKIITNHSDGTVLGVHLLGDNAPEIIQGI
1ndaA           PIGTCGLIE-EVASKRYEVVAVYLPLMHNISGSKYKT---FVKIITNHSDGTVLGVHLLGDNAPEIIQGV
1tytB           PMGVCGYVEEDAAKKYDQVAVYETPLMHNISGSTY--KKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSV
1tytA           PMGVCGYVEEDAAKKYDQVAVYETPLMHNISGSTY--KKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSV
1typB           PMGVCGYVEEDAAKKYDQVAVYETPLMHNISGSTY--KKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSV
1typA           PMGVCGYVEEDAAKKYDQVAVYETPLMHNISGSTY--KKFMVRIVTNHADGEVLGVHMLGDSSPEIIQSV
1gerB           PIGTVGLTEPQAREGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGF
1gerA           PIGTVGLTEPQAREGDDQVKVYKSSFTAMYTAVTTHRQPCRMKLVCVGSEEKIVGIHGIGFGMDEMLQGF
1dncA           PIGTVGLTEDEAIHGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGF
1gsnA           PIGTVGLTEDEAIHGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVANKEEKVV-GIHMQGLGCDEMLQGF
1zkqA           EYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDAYIKMVCREPPQLVLGLHFLGPNAGEVTQGF
1zdlA           EYGCVGLSEEEAVALHGQEHVEVYHAYYKPLEFTVADRDAYIKMVCREPPQLVLGLHFLGPNAGEVTQGF
2nvkX           EYACVGLSEEDAVKQFGADEIEVFHGYYKPTIPQKSVRYCYLKAVAERHDQRVYGLHYIGPVAGEVIQGF
3dh9A           EYACVGLSEEDAVKQFGADEIEVFHGYYKPTIPQKSVRYCYLKAVAERHDQRVYGLHYIGPVAGEVIQGF
3dghA           EYACVGLSEEDAVKQFGADEIEVFHGYYKPTIPQKSVRYCYLKAVAERHDQRVYGLHYIGPVAGEVIQGF
3dghB           EYACVGLSEEDAVKQFGADEIEVFHGYYKPTIPQKSVRYCYLKAVAERHDQRVYGLHYIGPVAGEVIQGF
2v6oA           EYGACGLSEEDAIEKYGDKDIEVYHSNFKPLEWTVAHREDYMKLVCRKSDNMVLGLHVLGPNAGEITQGY
3h4kA           EYGACGLSEEDAIEKYGDKDIEVYHSNFKPLEWTVAHREDYMKLVCRKSDNMVLGLHVLGPNAGEITQGY
2hqmA           EAGSIGISEKEAIEGKENIKVYNSKFTAMYYAMLSEKSPTRYKIVCAGPNEKVVGLHIVGDSSAEILQGF
1onfA           PIGTIGLSEEAAIQGKENVKIYESKF-TNLFFSVYDIEPEYLKLVCVGKDELIKGLHIIGLNADEIVQGF
3eanF           EYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNYAKVICNKDNERVVGFHVLGPNAGEVTQGF
3eanD           EYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNYAKVICNKDNERVVGFHVLGPNAGEVTQGF
3eanC           EYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNYAKVICNKDNERVVGFHVLGPNAGEVTQGF
3eanA           EYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNYAKVICNKDNERVVGFHVLGPNAGEVTQGF
1h6vE           EYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNYAKVICNKDNERVVGFHVLGPNAGEVTQGF
1h6vC           EYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNYAKVICNKDNERVVGFHVLGPNAGEVTQGF
1h6vB           EYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNYAKVICNKDNERVVGFHVLGPNAGEVTQGF
1h6vA           EYGCCGLSEEKAVEKFGEENIEVYHSFFWPLEWTVPSRDNYAKVICNKDNERVVGFHVLGPNAGEVTQGF
2zzcA           EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNYAKIICNKDNERVVGFHVLGPNAGEVTQGF
2zzbC           EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNYAKIICNKDNERVVGFHVLGPNAGEVTQGF
2zz0B           EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNYAKIICNKDNERVVGFHVLGPNAGEVTQGF
2j3nF           EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNYAKIICNKDNERVVGFHVLGPNAGEVTQGF
2j3nD           EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNYAKIICNKDNERVVGFHVLGPNAGEVTQGF
2j3nC           EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNYAKIICNKDNERVVGFHVLGPNAGEVTQGF
2j3nB           EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNYAKIICNKDNERVVGFHVLGPNAGEVTQGF
2j3nA           EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNYAKIICNKDNERVVGFHVLGPNAGEVTQGF
2cfyA           EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNYAKIICNKDNERVVGFHVLGPNAGEVTQGF
3ic9C           QVASVG----------------------------------------------------------------
3ic9A           QVASVG----------------------------------------------------------------
3cgcA           TLARTGLNEKEAKGLHIPYKTVKVD-STNMAGYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEVDKRIDVI
2cduB           GRTYVSTGINTALAKANNLKVSEVIIADNYRPEMLSTDEVLMSLVYDPKTRVILGGALSSMHVSQSANVL
2cduA           GRTYVSTGINTALAKANNLKVSEVIIADNYRPEMLSTDEVLMSLVYDPKTRVILGGALSSMHVSQSANVL
1joaA           KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNKQKAWFKLVYDPETTQILGAQLMSKALTANINAI
1f8wA           KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNKQKAWFKLVYDPETTQILGAQLMSKALTANINAI
2v3aA           ACPLVVSPPPRGMDGQVEGSGTDL------------------KVLCRDTAGRVIGYALTGAAVNE-----
1nhsA           KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNKQKAWFKLVYDPETTQILGAQLMSKALTANINAI
3iwaA           EGSASGA------GLTVEGALREGYDAVNVHVEQIMTLQLVVDRPTRRVLGI-QGFSTLGDALTARINAV
1nhqA           KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNKQKAWFKLVYDPETTQILGAQLMSKALTANINAI
1nhrA           KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNKQKAWFKLVYDPETTQILGAQLMSKALTANINAI
1nhpA           KFASTGINE---VMAQKLGKETKAVTVVEDYLMDFNKQKAWFKLVYDPETTQILGAQLMSKALTANINAI
1mo9A           EVSFLGMGEEEARAAGHEIVTIKMPLPASDRTMLYAHMSGFQKIVIDAKTRKVLGAHHVGYGAKDAFQYL
2bc1A           HMVSTGLTLEKAKRLGFDAAVTEYTDNQKPEFIEHGNFPVTIKIVYDKDSRRILGAQMAAREVSMGIHMF
2bc0A           HMVSTGLTLEKAKRLGFDAAVTEYTDNQKPEFIEHGNFPVTIKIVYDKDSRRILGAQMAAREVSMGIHMF
3ctyB           ----------------------------------------------------------------------
3ctyA           ----------------------------------------------------------------------
1m6iA           ----------------------------------------------------------------------
3cgbA           TLARTGLNEKEAKGLHIPYKTVKVD-STNA-GYYPNAKPLYLKLLYRSDTKQLLGGQVIGEEGVDKRIDV
1gv4A           ----------------------------------------------------------------------
3gd4B           ----------------------------------------------------------------------
3gd4A           ----------------------------------------------------------------------
3gd3D           ----------------------------------------------------------------------
3gd3C           ----------------------------------------------------------------------
3gd3B           ----------------------------------------------------------------------
3gd3A           ----------------------------------------------------------------------
3f8pD           ----------------------------------------------------------------------
3ef6A           ----------------------------------------------------------------------
1xhcA           ----------------------------------------------------------------------
1yqzA           ----------------------------------------------------------------------
1q1wB           ----------------------------------------------------------------------
1q1wA           ----------------------------------------------------------------------
1q1rA           ----------------------------------------------------------------------
3f8rD           ----------------------------------------------------------------------
3f8dD           ----------------------------------------------------------------------
3f8rB           ----------------------------------------------------------------------
3f8rA           ----------------------------------------------------------------------
3f8pC           ----------------------------------------------------------------------
3f8pB           ----------------------------------------------------------------------
3f8pA           ----------------------------------------------------------------------
3f8dC           ----------------------------------------------------------------------
3f8dB           ----------------------------------------------------------------------
3f8dA           ----------------------------------------------------------------------
1hyuA           ----------------------------------------------------------------------
1cl0A           ----------------------------------------------------------------------
1tdfA           ----------------------------------------------------------------------
1f6mA           ----------------------------------------------------------------------
1fl2A           ----------------------------------------------------------------------
2q7vB           ----------------------------------------------------------------------
2q7vA           ----------------------------------------------------------------------
2yvjA           ----------------------------------------------------------------------
2gr3A           ----------------------------------------------------------------------
2gqwA           ----------------------------------------------------------------------
1d7yA           ----------------------------------------------------------------------
1vdcA           ----------------------------------------------------------------------
3fg2P           ----------------------------------------------------------------------
2i0zA           ----------------------------------------------------------------------
2vhyB           ----------------------------------------------------------------------
2vhyA           ----------------------------------------------------------------------
2vhxD           ----------------------------------------------------------------------
2vhxC           ----------------------------------------------------------------------
2vhxB           ----------------------------------------------------------------------
2vhxA           ----------------------------------------------------------------------
2vhwE           ----------------------------------------------------------------------
2vhwB           ----------------------------------------------------------------------
2vhwA           ----------------------------------------------------------------------
2vhvA           ----------------------------------------------------------------------
3d8xA           ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           SLAVQQRLTVDDVAHTFAVYPSLSGSVTEAARSLMQGxxx
1xdiA           AVAVQNRITVNELAQTLAVYPSLSGSITEAARRLM-----
1ebdA           GLAIEAGMTAEDIALTIHAHPTLGEIAMEAA---------
1zy8A           ALALEYGASCEDIARVCHAHPTLSEAFREA----------
2yquA           XXXXXXXXXXXDLGRAPHAHPSLSEILKEAA---------
2eq7A           XXXXXXXXXXXDLGRAPHAHPSLSEILKEAA---------
1zmdE           ALALEYGASCEDIARVCHAHPTLSEAFREA----------
1zmcD           ALALEYGASCEDIARVCHAHPTLSEAFREA----------
1zmcB           ALALEYGASCEDIARVCHAHPTLSEAFREA----------
1zmcA           ALALEYGASCEDIARVCHAHPTLSEAFREA----------
3ladA           AIAMEFGTSAEDL---------------------------
2f5zI           ALALEYGASCEDIARVCHAHPTLSEAFREA----------
2eq6A           XXXXXXXXTLTDLALTVHPHPTLSESLMEAAEA-------
1lpfA           AIGMEFGTSAEDLGMMVFSHPTLSEALHEAA---------
1dxlA           AIALQYDASSEDIARVCHAHPTMSEAIKEAA---------
1jehA           GLALEYGASAEDVARVCHAHPTLSEAFKEA----------
1lvlA           AQSLEMGACLEDVAGTIHAHPTLGEAVQEAA---------
1zx9A           ALAIRNRMTVQELADQLFPYLTMVEGLKLAAQT-------
1zk7A           ALAIRNRMTVQELADQLFPYLTMVEGLKLAAQT-------
2a8xA           TLAQRWDLTASELARNVHTHPT------------------
2r9zB           AVAVKMGATKADFDNTVAIHP-------------------
2r9zA           AVAVKMGATKADFDNTVAIHP-------------------
2rabB           AVAVKMGATKADFDNTVAIHP-------------------
2rabA           AVAVKMGATKADFDNTVAIHP-------------------
1ojtA           CLAIEMGCDAADIGKTIHPHPTLGESIGMAA---------
1bhyA           YLAIEMGCDAADIGKTIHPHPTLGESIGMAA---------
2qaeA           CLAMEYGASSEDVGRTCHAHPTMSEALKEACMAL------
2grtA           AVAVKMGATKADFDNTVAIHPTSS----------------
1grtA           AVAVKMGATKADFDNTVAIHPTSS----------------
2w0hB           GICMKMGAKISDFHSTIGVHPT------------------
2w0hA           GICMKMGAKISDFHSTIGVHPT------------------
2jk6A           GICMKMGAKISDFHSTIGVHPT------------------
2ve2B           GVCLRLNAKISDFYNTIGVHPT------------------
2ve2A           GVCLRLNAKISDFYNTIGVHPT------------------
1grbA           AVAVKMGATKADFDNTVAIHPTSS----------------
3dk9A           AVAVKMGATKADFDNTVAIHPTSS----------------
1gesB           AVALKMGATKKDFDNTVAIHPT------------------
1gesA           AVALKMGATKKDFDNTVAIHPT------------------
1grgA           AVAVKMGATKADFDNTVAIHPTSS----------------
2tprA           AICLKMGAKISDVYNTIGVHPT------------------
1gxfA           GICLKLNAKISDFYNTIGVHPT------------------
1fecB           AICLKMGAKISDFYNTIGVHPT------------------
1fecA           AICLKMGAKISDFYNTIGVHPT------------------
1feaB           AICLKMGAKISDFYNTIGVHPT------------------
1feaA           AICLKMGAKISDFYNTIGVHPT------------------
1bzlA           GICLKLNAKISDFYNTIGVHPT------------------
1aogB           GICLKLNAKISDFYNTIGVHPT------------------
1aogA           GICLKLNAKISDFYNTIGVHPT------------------
1ndaA           GICLKLNAKISDFYNTIGVHPT------------------
1tytB           AICLKMGAKISDFYNTIGVHPT------------------
1tytA           AICLKMGAKISDFYNTIGVHPT------------------
1typB           AICLKMGAKISDFYNTIGVHPT------------------
1typA           AICLKMGAKISDFYNTIGVHPT------------------
1gerB           AVALKMGATKKDFDNTVAIHPT------------------
1gerA           AVALKMGATKKDFDNTVAIHPT------------------
1dncA           AVAVKMGATKADFDNTVAIHPTSS----------------
1gsnA           AVAVKMGATKADFDNTVAIHPTSS----------------
1zkqA           ALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSG---
1zdlA           ALGIKCGASYAQVMQTVGIHPTCSEEVVKLHISKRSG---
2nvkX           AAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSG---
3dh9A           AAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSG---
3dghA           AAALKSGLTINTLINTVGIHPTTAEEFTRLAITKRSG---
3dghB           AAALKSGLTINTLINTVGIHPTTAEEFTRLA---------
2v6oA           AVAIKMGATKADFDRTIGIHPTCSETFT------------
3h4kA           AVAIKMGATKADFDRTIGIHPTCSETFT------------
2hqmA           GVAIKMGATKADFDNCVAIHPT------------------
1onfA           AVALKMNATKKDFDETIPIHPT------------------
3eanF           AAALKCGLTKQQLDSTIGIHP-------------------
3eanD           AAALKCGLTKQQLDSTIGIHP-------------------
3eanC           AAALKCGLTKQQLDSTIGIHP-------------------
3eanA           AAALKCGLTKQQLDSTIGIHP-------------------
1h6vE           AAALKCGLTKQQLDSTIGIHP-------------------
1h6vC           AAALKCGLTKQQLDSTIGIHP-------------------
1h6vB           AAALKCGLTKQQLDSTIGIHP-------------------
1h6vA           AAALKCGLTKQQLDSTIGIHP-------------------
2zzcA           AAALKCGLTKKQLDSTIGIHP-------------------
2zzbC           AAALKCGLTKKQLDSTIGIHP-------------------
2zz0B           AAALKCGLTKKQLDSTIGIHP-------------------
2j3nF           AAALKCGLTKKQLDSTIGIHP-------------------
2j3nD           AAALKCGLTKKQLDSTIGIHP-------------------
2j3nC           AAALKCGLTKKQLDSTIGIHP-------------------
2j3nB           AAALKCGLTKKQLDSTIGIHP-------------------
2j3nA           AAALKCGLTKKQLDSTIGIHP-------------------
2cfyA           AAALKCGLTKKQLDSTIGIHP-------------------
3ic9C           ----------------------------------------
3ic9A           ----------------------------------------
3cgcA           AMALFNKMSIEDVDLSYAPYNSVWDPIQQAAR--------
2cduB           SVCIQNKNTIDDLA--------------------------
2cduA           SVCIQNKNTIDDLA--------------------------
1joaA           SLAIQAKMTIEDLAY-------------------------
1f8wA           SLAIQAKMTIEDLAY-------------------------
2v3aA           ----------------------------------------
1nhsA           SLAIQAKMTIEDLAY-------------------------
3iwaA           ATMLASKPTVEDISNAEVVMDNVAGNVAD-----------
1nhqA           SLAIQAKMTIEDLAY-------------------------
1nhrA           SLAIQAKMTIEDLAY-------------------------
1nhpA           SLAIQAKMTIEDLAY-------------------------
1mo9A           NVLIKQGLTVDEL---------------------------
2bc1A           SLAIQEGVTIEKLALT------------------------
2bc0A           SLAIQEGVTIEKLALT------------------------
3ctyB           ----------------------------------------
3ctyA           ----------------------------------------
1m6iA           ----------------------------------------
3cgbA           IAALFNKSDLEDVDLSYAPYNSVWDPIQQAAR--------
1gv4A           ----------------------------------------
3gd4B           ----------------------------------------
3gd4A           ----------------------------------------
3gd3D           ----------------------------------------
3gd3C           ----------------------------------------
3gd3B           ----------------------------------------
3gd3A           ----------------------------------------
3f8pD           ----------------------------------------
3ef6A           ----------------------------------------
1xhcA           ----------------------------------------
1yqzA           ----------------------------------------
1q1wB           ----------------------------------------
1q1wA           ----------------------------------------
1q1rA           ----------------------------------------
3f8rD           ----------------------------------------
3f8dD           ----------------------------------------
3f8rB           ----------------------------------------
3f8rA           ----------------------------------------
3f8pC           ----------------------------------------
3f8pB           ----------------------------------------
3f8pA           ----------------------------------------
3f8dC           ----------------------------------------
3f8dB           ----------------------------------------
3f8dA           ----------------------------------------
1hyuA           ----------------------------------------
1cl0A           ----------------------------------------
1tdfA           ----------------------------------------
1f6mA           ----------------------------------------
1fl2A           ----------------------------------------
2q7vB           ----------------------------------------
2q7vA           ----------------------------------------
2yvjA           ----------------------------------------
2gr3A           ----------------------------------------
2gqwA           ----------------------------------------
1d7yA           ----------------------------------------
1vdcA           ----------------------------------------
3fg2P           ----------------------------------------
2i0zA           ----------------------------------------
2vhyB           ----------------------------------------
2vhyA           ----------------------------------------
2vhxD           ----------------------------------------
2vhxC           ----------------------------------------
2vhxB           ----------------------------------------
2vhxA           ----------------------------------------
2vhwE           ----------------------------------------
2vhwB           ----------------------------------------
2vhwA           ----------------------------------------
2vhvA           ----------------------------------------
3d8xA           ----------------------------------------