[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56646.1

[Show Plain Result]

#ERROR : Can't open dsspfile "3bbnI.bssp"
#ERROR : Can't open dsspfile "2zm6I.bssp"
#ERROR : Can't open dsspfile "1vs5I.bssp"
#ERROR : Can't open dsspfile "2j00I.bssp"
#ERROR : Can't open dsspfile "2gy9I.bssp"
#ERROR : Can't open dsspfile "2uuaI.bssp"

## Summary of PDB Search
:169
    2e-17  39%  3bbnI  [x.x.x] RIBOSOMAL PROTEIN S9
    3e-15  35%  2zm6I  [x.x.x] 30S RIBOSOMAL PROTEIN S9
    3e-15  34%  1vs5I  [x.x.x] 30S RIBOSOMAL PROTEIN S9
    3e-15  35%  2j00I  [d.14.1 (1fjgI)] 30S RIBOSOMAL PROTEIN S9
    3e-15  34%  2gy9I  [x.x.x] 30S RIBOSOMAL SUBUNIT PROTEIN S9
    4e-15  35%  2uuaI  [x.x.x] 30S RIBOSOMAL PROTEIN S9
:169

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGTGXXXXXXXXXXXXPGTGEWKING
3bbnI           --------------------------------------------IGTGRRKCAIARVVLQEGTGKFIINY
2zm6I           ---------------------------------------------GTGRRKEAVARVFLRPGNGKVTVNG
1vs5I           ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
2j00I           ---------------------------------------------GTGRRKEAVARVFLRPGNGKVTVNG
2gy9I           ---------------------------------------------GTGRRKSSAARVFIKPGNGKIVINQ
2uuaI           ---------------------------------------------GTGRRKEAVARVFLRPGNGKVTVNG


                         .         .         *         .         .         .         .:140
query           KSLEEYFPNKVHQQLIKEPLATLGFEGAYDVFARLNGGGTSGQXXXXXXXXXXXXXXMDPEHNRPPLKKA
3bbnI           RDAKEYLQNPLWLQYVKTPLATLGYETNYDVFVKAHGGGLSGQAQAISLGVARALLKVSASH-RAPLKQE
2zm6I           QDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDY-RAKLKPL
1vs5I           RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
2j00I           QDFNEYFQGLVRAVAALEPLRAVDALGRFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDY-RAKLKPL
2gy9I           RSLEQYFGRETARMVVRQPLELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYD-ESLRSELRKA
2uuaI           QDFNEYFQGLVRAVAALEPLRAVDALGHFDAYITVRGGGKSGQIDAIKLGIARALVQYNPDY-RAKLKPL


                         +         .         .         .         .         *         .:210
query           GFLTRDARKVEXXXXXXXXXXXXPQYSKR
3bbnI           GLLTRDSRIVERKKPGLKKARKAPQFSKR
2zm6I           GFLTRDARVVERKKYGKHKARRAPQYSKR
1vs5I           GFVTRDARQVERKKVGLRKARRRPQFSKR
2j00I           GFLTRDARVVERKKYGKHKARRAPQYSKR
2gy9I           GFVTRDARQVERKKVGLRKARRRPQFSKR
2uuaI           GFLTRDARVVERKKYGKHKARRAPQYSKR