[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:PDB for tfus0:AAZ56815.1

[Show Plain Result]

#ERROR : Can't open dsspfile "1xxhB.bssp"
#ERROR : Can't open dsspfile "1njgA.bssp"
#ERROR : Can't open dsspfile "1njfA.bssp"
#ERROR : Can't open dsspfile "1jr3B.bssp"
#ERROR : Can't open dsspfile "1jr3A.bssp"
#ERROR : Can't open dsspfile "3gliG.bssp"
#ERROR : Can't open dsspfile "3gliB.bssp"
#ERROR : Can't open dsspfile "3glgG.bssp"
#ERROR : Can't open dsspfile "3glgD.bssp"
#ERROR : Can't open dsspfile "3glgC.bssp"
#ERROR : Can't open dsspfile "3glgB.bssp"
#ERROR : Can't open dsspfile "3glfG.bssp"
#ERROR : Can't open dsspfile "3glfD.bssp"
#ERROR : Can't open dsspfile "3glhD.bssp"
#ERROR : Can't open dsspfile "3glhB.bssp"
#ERROR : Can't open dsspfile "3glhE.bssp"
#ERROR : Can't open dsspfile "1jr3E.bssp"
#ERROR : Can't open dsspfile "1a5tA.bssp"
#ERROR : Can't open dsspfile "1xxhE.bssp"
#ERROR : Can't open dsspfile "2gnoA.bssp"
#ERROR : Can't open dsspfile "1sxjC.bssp"

## Summary of PDB Search
:390
    3e-15  33%  1xxhB  [c.37.1 - a.80.1] DNA POLYMERASE III SUBUNIT GAMMA
    3e-15  33%  1njgA  [c.37.1] DNA POLYMERASE III SUBUNIT GAMMA
    3e-15  33%  1njfA  [c.37.1] DNA POLYMERASE III SUBUNIT GAMMA
    3e-15  33%  1jr3B  [c.37.1 - a.80.1] DNA POLYMERASE III SUBUNIT GAMMA
    3e-15  33%  1jr3A  [c.37.1 - a.80.1] DNA POLYMERASE III SUBUNIT GAMMA
    3e-15  33%  3gliG  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    3e-15  33%  3gliB  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    3e-15  33%  3glgG  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    3e-15  33%  3glgD  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    3e-15  33%  3glgC  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    3e-15  33%  3glgB  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    3e-15  33%  3glfG  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    3e-15  33%  3glfD  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    1e-14  33%  3glhD  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    1e-14  33%  3glhB  [x.x.x] DNA POLYMERASE III SUBUNIT TAU
    1e-10  32%  3glhE  [x.x.x] DNA POLYMERASE III SUBUNIT DELTA'
    3e-10  33%  1jr3E  [c.37.1 - a.80.1] DNA POLYMERASE III, DELTA' SUBUNIT
    3e-10  33%  1a5tA  [x.x.x] DELTA PRIME
    1e-09  34%  1xxhE  [c.37.1 - a.80.1] DNA POLYMERASE III, DELTA PRIME SUBUNIT
    1e-08  38%  2gnoA  [x.x.x] DNA POLYMERASE III, GAMMA SUBUNIT-RELATED
    6e-05  31%  1sxjC  [c.37.1 - a.80.1] ACTIVATOR 1 40 KDA SUBUNIT
:390

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHAWLFTGPPXXXXXXXXXXXXXXLQCTHGGCGE
1xxhB           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
1njgA           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
1njfA           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
1jr3B           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
1jr3A           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3gliG           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3gliB           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3glgG           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3glgD           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3glgC           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3glgB           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3glfG           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3glfD           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3glhD           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3glhB           -------------------------------------HAYLFSGTRGVGKTSIARLLAKGLNCETGPCGV
3glhE           ----------------------------------------------------------------HKSCGH
1jr3E           ----------------------------------------------------------------HKSCGH
1a5tA           ----------------------------------------------------------------HKSCGH
1xxhE           ----------------------------------------------------------------HKSCGH
2gnoA           ----------------------------------------------------------------------
1sxjC           ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           CASCHQVLAGTHPDVLYVRPSGLSFGVEQTRELVVRAASSPTGGRFRVVLFEDADRATEAASNALLKAIE
1xxhB           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
1njgA           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
1njfA           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
1jr3B           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
1jr3A           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3gliG           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3gliB           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3glgG           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3glgD           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3glgC           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3glgB           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3glfG           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3glfD           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3glhD           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3glhB           CDNCREIEQGRFVDLIEIDAASRT-KVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLE
3glhE           CRGCQLMQAGTHPDYYTLAPEKNTLGVDAVREVTEKLNEHARLGGAKVVWVXXXXXXXXXXXXXXXXXXE
1jr3E           CRGCQLMQAGTHPDYYTLAPGKNTLGVDAVREVTEKLNEHARLGGAKVVWVXXXXXXXXXXXXXXXXXXE
1a5tA           CRGCQLMQAGTHPDYYTLAPGKNTLGVDAVREVTEKLNEHARLGGAKVVWVXXXXXXXXXXXXXXXXXXE
1xxhE           CRGC-QLQAGTHPDYYTLAPEKNTLGVDAVREVTEKLNEHARLGGAKVVWVXXXXXXXXXXXXXXXXXXE
2gnoA           -------------DVLEIDPEGENIGIDDIRTIKDFLNYSPELYTRKYVIVHDCER-TQQAANAFLKALE
1sxjC           ---------------------------------------------FKLIILDEADAMTNAAQNALRRVIE


                         +         .         .         .         .         *         .:210
query           EPAPRTVWLLCTPTAHDLLVTIRSRCRLVNLRTPSTEAIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xxhB           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
1njgA           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
1njfA           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
1jr3B           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
1jr3A           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
3gliG           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
3gliB           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
3glgG           EPPEHVKFLLATADPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
3glgD           EPPEHVKFLLATADPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
3glgC           EPPEHVKFLLATADPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
3glgB           EPPEHVKFLLATADPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
3glfG           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
3glfD           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQI-------------------------------
3glhD           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------------------------------
3glhB           EPPEHVKFLLATTDPQKLPVTILSRCLQFHLK--------------------------------------
3glhE           EPPAETWFFLATREPERLLATLRSRCRLHYLPPPEQYAV-------------------------------
1jr3E           EPPAETWFFLATREPERLLATLRSRCRLHYLAPP------------------------------------
1a5tA           EPPAETWFFLATREPERLLATLRSRCRLHYLAPP------------------------------------
1xxhE           EPPAETWFFLATREPERLLATLRSRCRLHYLAPP------------------------------------
2gnoA           EPPEYAVIVLNTRRWHYLLPTIKSRVFRVVVNVP------------------------------------
1sxjC           RYTKNTRFCVLANYAHKLTPALLSQCTRFRFQPLPQEAI-------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xxhB           ----------------------------------------------------------------------
1njgA           ----------------------------------------------------------------------
1njfA           ----------------------------------------------------------------------
1jr3B           ----------------------------------------------------------------------
1jr3A           ----------------------------------------------------------------------
3gliG           ----------------------------------------------------------------------
3gliB           ----------------------------------------------------------------------
3glgG           ----------------------------------------------------------------------
3glgD           ----------------------------------------------------------------------
3glgC           ----------------------------------------------------------------------
3glgB           ----------------------------------------------------------------------
3glfG           ----------------------------------------------------------------------
3glfD           ----------------------------------------------------------------------
3glhD           ----------------------------------------------------------------------
3glhB           ----------------------------------------------------------------------
3glhE           ----------------------------------------------------------------------
1jr3E           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
1xxhE           ----------------------------------------------------------------------
2gnoA           ----------------------------------------------------------------------
1sxjC           ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xxhB           ----------------------------------------------------------------------
1njgA           ----------------------------------------------------------------------
1njfA           ----------------------------------------------------------------------
1jr3B           ----------------------------------------------------------------------
1jr3A           ----------------------------------------------------------------------
3gliG           ----------------------------------------------------------------------
3gliB           ----------------------------------------------------------------------
3glgG           ----------------------------------------------------------------------
3glgD           ----------------------------------------------------------------------
3glgC           ----------------------------------------------------------------------
3glgB           ----------------------------------------------------------------------
3glfG           ----------------------------------------------------------------------
3glfD           ----------------------------------------------------------------------
3glhD           ----------------------------------------------------------------------
3glhB           ----------------------------------------------------------------------
3glhE           ----------------------------------------------------------------------
1jr3E           ----------------------------------------------------------------------
1a5tA           ----------------------------------------------------------------------
1xxhE           ----------------------------------------------------------------------
2gnoA           ----------------------------------------------------------------------
1sxjC           ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
1xxhB           ----------------------------------------
1njgA           ----------------------------------------
1njfA           ----------------------------------------
1jr3B           ----------------------------------------
1jr3A           ----------------------------------------
3gliG           ----------------------------------------
3gliB           ----------------------------------------
3glgG           ----------------------------------------
3glgD           ----------------------------------------
3glgC           ----------------------------------------
3glgB           ----------------------------------------
3glfG           ----------------------------------------
3glfD           ----------------------------------------
3glhD           ----------------------------------------
3glhB           ----------------------------------------
3glhE           ----------------------------------------
1jr3E           ----------------------------------------
1a5tA           ----------------------------------------
1xxhE           ----------------------------------------
2gnoA           ----------------------------------------
1sxjC           ----------------------------------------