[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54134.1

[Show Plain Result]


## Summary of Sequence Search
    1::267
    8::257     3e-57  52%  259 aa  Y2770_PSEAE RecName: Full=Uncharacterized isomerase PA2770;        
    7::263     1e-51  45%  265 aa  Y283_BACHD RecName: Full=Uncharacterized isomerase BH0283;       
    5::259     3e-48  49%  261 aa  Y3578_PSEAE RecName: Full=Uncharacterized isomerase PA3578;        
    6::269     1e-42  47%  275 aa  YX21_CAUCR RecName: Full=Uncharacterized isomerase CC_3221;        
    7::286     1e-39  43%  288 aa  PBLD_RAT RecName: Full=Phenazine biosynthesis-like
    7::286     5e-38  42%  288 aa  PBLD_PONAB RecName: Full=Phenazine biosynthesis-like
    7::286     6e-38  43%  288 aa  PBLD_HUMAN RecName: Full=Phenazine biosynthesis-like
    7::286     8e-38  41%  288 aa  PBLD_BOVIN RecName: Full=Phenazine biosynthesis-like
   18::286     2e-36  44%  288 aa  PBLD1_MOUSE RecName: Full=Phenazine biosynthesis-like
   18::286     2e-36  42%  288 aa  PBLD2_MOUSE RecName: Full=Phenazine biosynthesis-like
   28::259     1e-17  28%  279 aa  Y3195_VIBCH RecName: Full=Uncharacterized isomerase VC_A0395;      
    8::286     2e-16  32%  297 aa  YDDE_SALTY RecName: Full=Uncharacterized isomerase yddE;       
    8::286     4e-16  32%  297 aa  YDDE_ECOLI RecName: Full=Uncharacterized isomerase yddE;       
    8::286     9e-16  32%  297 aa  YDDE_ECO57 RecName: Full=Uncharacterized isomerase yddE;       
    5::300     1e-15  34%  306 aa  Y1019_SYNY3 RecName: Full=Uncharacterized isomerase slr1019;       
   10::299     6e-15  33%  302 aa  Y3446_CLOAB RecName: Full=Uncharacterized isomerase CA_C3446;      
    1::224     1e-13  33%  278 aa  PHZF_PSEAE RecName: Full=Phenazine/pyocyanine biosynthesis protein
    1::276     3e-12  30%  278 aa  PHZF_PSEFL RecName: Full=Phenazine biosynthesis protein phzF;      
   15::238     3e-12  32%  308 aa  Y1330_DEIRA RecName: Full=Uncharacterized isomerase DR_1330;       
    1::276     8e-12  32%  278 aa  PHZF_PSECL RecName: Full=Phenazine biosynthesis protein phzF;      
    7::293     2e-11  28%  294 aa  YHI9_YEAST RecName: Full=Uncharacterized isomerase YHR029C;        
   10::283     1e-10  29%  293 aa  YFHB_BACSU RecName: Full=Uncharacterized isomerase yfhB;       
    6::239     4e-10  32%  296 aa  AES1_SCHPO RecName: Full=Antisense-enhancing sequence 1;       
   10::294     5e-09  25%  295 aa  Y1950_BACHD RecName: Full=Uncharacterized isomerase BH1950;        
    7::73      2e-08  40%  289 aa  Y1503_PASMU RecName: Full=Uncharacterized isomerase PM1503;      
   10::72      7e-07  41%  302 aa  Y1393_RHILO RecName: Full=Uncharacterized isomerase mll1393;     
    1::267

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MNRFHVVDAFTDQPFHGNPAAVLVLDSPYDDAWAQRVAAEFNLSETAFVRPLAGADADYELRWFTPTTEV
Y2770_PSEAE     ------VDAFADSPFQGNPAAVCPLDAWLDDERLQAIAEENNLSETAFV---VGRDGDYRLRWFTPQVEV
Y283_BACHD      ----YVVDAFTNQAFKGNPAAVCVLPTSRDDIWMQHVASEMNLSETAFLHPYQDG---YSLRWFTPNTEV
Y3578_PSEAE     ---FHQVDAFSSRPFSGNPAVVYRLDAWLADELMQMIATEHNLSETAFVVREGEA---WRIRWFTPSVEV
YX21_CAUCR      ------IDAFATGPFRGNPACVL---EPFDDAWMQALAAENNQAETAYLLKTADPDR-FGLRWFTPTLEA
PBLD_RAT        -----IADAFTVTAFHGNPAAVCLLESILQEDAHQQIAREMNLSETAFIRKLQPTDSFFGLRWFTPVSEV
PBLD_PONAB      -----IADAFTARAFRGDPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDSCFGLRWFTPASEV
PBLD_HUMAN      -----IADAFTARAFRGNPAAVCLLENELDEDMHQKIAREMNLSETAFIRKLHPTDSCFGLRWFTPASEV
PBLD_BOVIN      -----IADAFTTKAFRGNPAAVCLLENKLDEDLHQKIAKEMNLSETAFIRKLHPNDSCFGLRWFTPQNEV
PBLD1_MOUSE     ----------------GNPAAVCLLERTLEEDAHQQIAREMNLSETAFIRKLQPTDSRFGLRWFTPVSEV
PBLD2_MOUSE     ----------------GNPAAVCLLERTLDEDAHQDIAREMNLSETAFVRKLQPTDSRFGLRWFTPEAEF
Y3195_VIBCH     --KIDIYDVFIGKSAFGNPCGVLELNGWLSDSELHQITREVGQPVTSFITHV---DGRFHIRWFALDGEI
YDDE_SALTY      ------VDAFTGDPFRGNSAGVVLHADTLSDAQMQLIARELRHSETAFL--LKSEESDVRIRYFTPTVEV
YDDE_ECOLI      ------VDAFTSQPFRGNSAGVVFPADNLSEAQMQLIARELGHSETAFL--LHSDDSDVRIRYFTPTVEV
YDDE_ECO57      ------VDAFTSQPFRGNSAGVVFPADNLSEAQMQLIARELGHSETAFL--LHSDDSDVRIRYFTPTVEV
Y1019_SYNY3     ---FYTLDVFTDQLFGGNPLAVFPDAEGLTDGQMQKIAAEINYSETVFVLPPVTETGNFRLRIFTPKREL
Y3446_CLOAB     ------IDSFTKEKFTGNPAGVITNADGLTDYEMQKIARELNNSETAFIFSSKDERYDAWVRFFTPTSEV
PHZF_PSEAE      MHRYVVIDAFASEPLQGNPVAVFFDCDDLSGERMQRMAREMNLSESTFVRP--QQDGDARIRIFTPVNEL
PHZF_PSEFL      MHNYVIIDAFASVPLEGNPVAVFFDADDLPPAQMQRIAREMNLSESTFVKPRNGGDA--LIRIFTPVNEL
Y1330_DEIRA     MTRYAEVAAFTTVPGQGNRAGVVLDAGELTGEQMQRLAAFLEAPETVFVTRL--SDGLGRVRYFTPTQEV
PHZF_PSECL      MHHYVIIDAFASAPLEGNPVTVFFDADDLSATQMQRIAREMNLSETTFVKPRNCGDA--LIRIFTPVNEL
YHI9_YEAST      ---FKQVDVFTEKPFMGNPVAVIIDENEVSQEELQAIANWTNLSETTFLFKPSDKKYDYKLRIFTPRSEL
YFHB_BACSU      -------EAFTSSPGKGNPAGVVLQGDDYTEDEMQIIAERAGYSETSFIR--KSESADLELRYFTPGHEM
AES1_SCHPO      ---FKQIDVFSNKGFRGNPVAVFFDADNLSQKEMQQIAKWTNLSETTFVQKPTIDKADYRLRIFTPECEL
Y1950_BACHD     -------EAFSTVPSKGNPAGIVLDGKGLTDSDRQKIAKEVGFNETAF--PLPSERADVNIRFFTPGHEI
Y1503_PASMU     ---YHLVNVFAETYFGGNPLAVFPQADGLTDQQMQLIARQFNLSETVFVHQTTESSAVRKLRIFTPDYEL
Y1393_RHILO     -------DVFTTERLAGNPLAVVLDCKGLDTIAMQAIAREFNLSETVFVLPPDNPKHKNRIRIFTPDYEM


                         .         .         *         .         .         .         .:140
query           DLCXXXXXXXXXXXXXXXXXXPFRFASRSGVLTVTARDGLLWLDFPANPPYAKDVPDGLVAALGGEPVWA
Y2770_PSEAE     DLCGHATLATAWVLIHKLDDASLRFATRSGELSVRREGDSLAMDFPAKRPEPCATPDGLLEALGIAE--A
Y283_BACHD      DLCGHATLASAHILWELDHISPITFYTKSGILTASKRGEWIELDFPSEQPKQENVPNELIDGLGIQPLYV
Y3578_PSEAE     ALCGHATLAAAHVLFEVYDEPGERFISRSGALRVNREDERLVLDFPAQYPSEVGSTVELEQALGLPPVDV
YX21_CAUCR      PLCGHATLAAAHVLFEELGVDVLSFETLSGVLTVRRADDQLEMDFPADPPRRTEIPEGLAEALGVRPVWA
PBLD_RAT        PLCGHATMASAAVLFHKIKNVTLTFVTLSGELKARAEDGIV-LDFPLYPTFPQDVKDLIKAAIGDTTVQV
PBLD_PONAB      PLCGHATLASAAVLFHKIKNMTLTFVTLSGELRARAEDGII-LDFPLYPAHPQDVEDLIKTAIGNTLVQI
PBLD_HUMAN      PLCGHATLASAAVLFHKIKNMTLTFVTLSGELRARAEDGIV-LDLPLYPAHPQDVEDLIKTAIGNQKLLV
PBLD_BOVIN      PLCATLASAAVLFHKIKNVHSTLTFVTMSGELKARKEEDGIVLDYPAHPQKLHEVEDLIKTAIGDTLVQV
PBLD1_MOUSE     PLCGHATLASAAVLFHKIQNRTLTFVTMSGELKARAEDGIV-LDFPVYPTFPQDVEDLIKAAIGDTLVQV
PBLD2_MOUSE     PLCGHATLASAAVLFQKRKNTTLTFVTMSGELKARREEDGIVLDFPVYPTFPQDVEDLIKAAIGDTLVQI
Y3195_VIBCH     NLCGHGSLGAGAAILSKYQLENVVFNSKYGEVVISKRDDQYSLVLPSWEAKPCAVPVE-ISDLATDAI--
YDDE_SALTY      PICAAHYVRATVLGLGNTTVWQTSLAGRHRVIHAEHNDYRITLEQSFEPPLVGEIRAAIITALNGAPIQV
YDDE_ECOLI      PICGHATVAAHYVRAKVLGLGNCTITSLAGKHRVTIEDYRISLEQGTEPPLEGETRAAIINALPGLPIQV
YDDE_ECO57      PICAAHYVRAKVLGLGNCTVWQTSLAGKHRVTIEKHHDGYLEQGTPGEPPLEGETRAAIINALPGLPIQV
Y1019_SYNY3     DFAGHPTIGTTYLLGLLQPPSPWQLEEPVGLVPVTVQTELTVAQLPQTKDSAPSCEDALLLGLSIDQLQQ
Y3446_CLOAB     PICGHATIAAHYARAIENNLETSRVYHKTGA-------GILPVDIKENDDYKIIMTQGKISVIDGEKVST
PHZF_PSEAE      PFAGHPLLGTAIALGAETDKDRLFLETRMGTVALERQDGSMQQPIPTWEHFSR--PAELLAALGLKPIEV
PHZF_PSEFL      PFAGHPLLGTAIALGAHTDNHRLYLETQMGTIALERQNGSVSMDQPIPTWTALGRDAELLKALGISPIEI
Y1330_DEIRA     DFCATVALGRVLAQAGRWRGEALELETLAGVLDAGGGECRVWMHQPATRAVGRGWHRELAEALGGLPLAA
PHZF_PSECL      PFAGAHTDNHRLFLETQMGTIAFELERQNGSVVAASMD----QPIPTWTALGRDVE--LLKALGISPIEI
YHI9_YEAST      PFAGHPTIGSCKAFLEFTKNTTATSECKIGAVPITINEGL--ISFKAPMADYESISSEMIAAIGIKPPAL
YFHB_BACSU      NLCTVASLYALCEKGMLESGKTYSIQTKAGILPVSEKDGRIHITLQASPQFKPFTGDKLADALGDLPIVF
AES1_SCHPO      SFAGHPTIGSCFAVVESGYCTPKNCECLAGLVELTEKDEDTWISFKL--PYYKILQTSETAALGSPPVL-
Y1950_BACHD     NLCTMATIYALKTKGLLPDRDEITIETKAGILPIRLSDRSMMITMKQAAPQEKDLHEELPVVYGSTGTWT
Y1503_PASMU     ----------------------------------------------------------------------
Y1393_RHILO     ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           GFSDVNDYFVVYPDEATVRALAPDLAEVARCTVRGVTVTAPADPGQPYDFVSRLFAPAIGIPEDPVTGSA
Y2770_PSEAE     EVLKTDDYLVVVDDEKTIAALAPDFARLKGLPCRGVAVTARS---QRFDFVSRWFGPNVGVNEDPVTGSA
Y283_BACHD      GRNRF-DYLIEIDSEQRLKELNPNFSLLEQIDTRGIIVTSKSTSTE-YDFISRCFFPAVGVNEDPVTGSA
Y3578_PSEAE     -LGSTDKLLVLLESEEAVRACRPDFAALARLPWRGVIVTAR---GLQKDFVSRFFAPAMGVDEDPVTGSA
YX21_CAUCR      GAYLV----AVVDDETTVRQLRPDLGALATGGAGQTVVVAQADAGADYAVVSRFFAPGFGIPEDPATGSA
PBLD_RAT        RLSDSYDRSFLESLKVNTEPL-PGIEKTGK--VKGLILTVKGESGTPYDFYSRYFAPWVGVPEDPVTGSA
PBLD_PONAB      RLSDVYDRSFL----ENLKVNTENLLQVENTKVKGLILTLKGEPGQAFDFYSRYFAPWVAVAEDPVTGSA
PBLD_HUMAN      RLSDVNRSFL-----ENLKVNTENLLQVENTKVKGLILTLKGEPGQAFDFYSRYFAPWVGVAEDPVTGSA
PBLD_BOVIN      RYSPDTKKLLVRLSDTYNRSFTENLLQVETTKVKGLILTLKGEPGQAFDFYSRYFAPWYGVAEDPVTGSA
PBLD1_MOUSE     RLSDSYDRSFLESLKVNTEPL-PAIEKTGK--VRGLILTVKGEPGAPYDFYSRYFAPWVGIAEDPVTGSA
PBLD2_MOUSE     RYSPDTKNLLVRLSDSYDRSFLESLAIEKTGKVRGLILTVKGEPGGQYDFYSRCFAPWVGVAEDPVTGST
Y3195_VIBCH     DVFSTRDLVLVLPSVEAVMNFQPDDDRLREINEYHALIVTAANGNSGY--VLRYFAPKIGISEDLATGSA
YDDE_SALTY      ASTGHAKVMILLKPDVDIDALSPNLAALTAISQQGCNGFFPFQPGK-NETDGRMFSPAIGIVEDPVTGNA
YDDE_ECOLI      ATTGHSKVMIPLKPEVDIDALSPDLNALTAISKKGCNGFFPFQPGK-NETDGRMFSPAIGIVEDPVTGNA
YDDE_ECO57      ATTGHSKVMIPLKPEVDIDALSPDLNALTAISKQGCNGFFPFQPGK-NETDGRMFSPAIGIVEDPVTGNA
Y1019_SYNY3     GEYEPQAYFLFIPEEALNRLLAGQWADCVYC-------LAPGDPSLGLSIHGRMFAPGLGIAEDPATGSG
Y3446_CLOAB     GHSKV---MIGIKSLKTLNKLQPNLSKIIKC--NGYYVFAVTSEDSDILIHGRMFAPAIGINEDPVTGNA
PHZF_PSEAE      YRNGPRHVFVGLESVAALSALHPD--HRALCDFPDLAVNCFAGAGRHWR--SRMFSPAYGVVEDAATGSA
PHZF_PSEFL      YHNGPRHVFVGLPSIDALSALHPD--HRALSNFHDMAINCFAGAGRRWR--SRMFSPAYGVVEDAATGSA
Y1330_DEIRA     ASTGLWSVFLPLLDASLLEGLEPDLPRIAELSREGVVSVYAYAPVGVNRFAARDFAPLVGIPEDPVT---
PHZF_PSECL      YHNGPRHVFVGLPSIAALSALHPD--HRALSSFHDMAINCFAGAGRRWR--SRMFSPAYGVVEDAATGSA
YHI9_YEAST      LHTGPEWIVALVEDAETCFNANPNFAMLAHQTKQGIILAGPKEAAIKNSYEMRAFAPVINVYEDPVCGSG
YFHB_BACSU      GSTGIWTAIVPLKSLEASKKMVPDNKQFPE-----VLVDLPKASVHPFTFETHFSSPYSGTIEDPVTGTA
AES1_SCHPO      -IDDGPKWLVILPNATDVLNLVPKFQSLSQVCKNNIGVTVFGELGKD-SFESRSFAPLIHVNEDPACGSG
Y1950_BACHD     LLIPIKKLDAFKRMQPNNQHFPHILQEMPRASVHPFCLET---YDQEADMHARHFSPYSGTVEDPVTGTA
Y1503_PASMU     ----------------------------------------------------------------------
Y1393_RHILO     ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           HTALGPYWAQRLGRTRLDAVQCSARGGRLVVELPADAPDRVLIGGTAVTVSEGTLRx
Y2770_PSEAE     HTSLAPYWAQRLGKTRLSAEQGGARKGRLECDVRG---ERVVISGKAALYMSGTL--
Y283_BACHD      HCCLGPYWQEKLNKNEFLAYQASKRGGMLKIKL---QHDRVFLLGQAVTVLRSEL--
Y3578_PSEAE     HCSLIPYWAQRLNKLSLTAQQCSARGGELWCRLEG---ERVSIAGHAVLVASGRIR-
YX21_CAUCR      HCILMPLFGDKLGAGRLKFHQAPGRGGDLECE---NRGARVLLRGRGFTVMESQLR-
PBLD_RAT        HTVLSSYWSQQLGKKEMRAFQCSCRGGELDISLRPDG--RVDMKGGAAVVLEGML--
PBLD_PONAB      HAVLSSYWSQHLGKKEMHAFQCSRRGGELGISLRPDG--RVDITGSAAVVLEGTL--
PBLD_HUMAN      HAVLSSYWSQHLGKKEMHAFQCSHRGGELGISLRPDG--RVDIRGGAAVVLEGTL--
PBLD_BOVIN      HTVLSSYWSEQLGKKDLHAFQCSNRGGELTISLRSDG--RVDIKGGAALVLEGTL--
PBLD1_MOUSE     HTVLSSYWSQQLRKKEMRAFQCSRRGGELDISLRPDG--RVDIKGGAVIVLEGTL--
PBLD2_MOUSE     HTLLGPYWSEELGKKEMRAFQCSRRGGELDINLRPDG--RVDIKGGAVIVLEGTL--
Y3195_VIBCH     QCSLAPYWFKKLGSDALNARQLSMSGGYFEVE-------------------------
YDDE_SALTY      NGPMGA-WLVHHGLMAHDTLQIQGHQGRVTVTIRDNQPENVTISGQAV---------
YDDE_ECOLI      NGPMGAWLVHNVLRVKGHQGRALGRDGEVTVTIRDNQPEKVTISGTAV---------
YDDE_ECO57      NGPMGAWLVHNVLRVKGHQGRALGRDGEVTVTIRDNQPEKVTISGAAV---------
Y1019_SYNY3     VAALGGYLDDRLGSHHWQIEQGKALGRQLTVVKDGQGIRAVKVAGRSVLVSEG----
Y3446_CLOAB     NGPLGAYYDNSIFKFKAKQGEAIGRQGIIEVEVRVDEPVEVKISGNAVVVFKSEL--
PHZF_PSEAE      AGPLAIHLAR-----------------------------------------------
PHZF_PSEFL      AGPLAIHLAREIGRPSLMFAKAEGRAEQLT---------RVEVSGNGVTFGRGTI--
Y1330_DEIRA     ---------------------------------------------------------
PHZF_PSECL      AGPLAIHLAREIGRPSLMFARAEGR---------ADQLTRVEVSGNGVTFGRGTI--
YHI9_YEAST      SVALARYLQEVYKFEKTTDITIS-EGGRLSIKKEADNSTSYYIAGHATTVIDGKIK-
YFHB_BACSU      SGVMGAYMGQEIGKDGKVEIEMNEAGGHVKVNMTGTA--------------------
AES1_SCHPO      AGAVGVY--------------------------------------------------
Y1950_BACHD     SGVMGAYYHKYIESSPVEQGHEIGKDGRIAVTVTEQTDDVMIISGNAVLIREFEVR-
Y1503_PASMU     ---------------------------------------------------------
Y1393_RHILO     ---------------------------------------------------------