[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54138.1

[Show Plain Result]


## Summary of Sequence Search
    1::777
    2::724       0.0  59%  773 aa  YHGF_ECOLI RecName: Full=Protein yhgF;
    2::723       0.0  54%  762 aa  Y568_HAEIN RecName: Full=Uncharacterized protein HI0568;
   22::742       0.0  57%  791 aa  TEX_BORPE RecName: Full=Protein tex;
    2::713       0.0  56%  757 aa  YHGF_NEIMB RecName: Full=Uncharacterized protein NMB0075;
    2::713       0.0  56%  757 aa  YHGF_NEIMA RecName: Full=Uncharacterized protein NMA0194;
    2::476     e-132  55%  476 aa  YHGF_NEIGO RecName: Full=Uncharacterized protein in region E;Flags:
  210::928     8e-75  34%  995 aa  SRBD1_PONAB RecName: Full=S1 RNA-binding domain-containing protein
  210::928     1e-74  34%  995 aa  SRBD1_HUMAN RecName: Full=S1 RNA-binding domain-containing protein
  205::948     1e-72  34% 1015 aa  SRBD1_MOUSE RecName: Full=S1 RNA-binding domain-containing protein
  828::1096    5e-18  32% 1402 aa  SPT6_NEUCR RecName: Full=Transcription elongation factor
  583::1143    3e-17  29% 1726 aa  SPT6H_MOUSE RecName: Full=Transcription elongation factor SPT6;
  833::1016    7e-16  37% 1408 aa  SPT6_GIBZE RecName: Full=Transcription elongation factor
  902::1143    4e-15  37% 1726 aa  SPT6H_HUMAN RecName: Full=Transcription elongation factor SPT6;      
  901::1164    3e-14  34% 1726 aa  SPT6H_DANRE RecName: Full=Transcription elongation factor
  860::1116    5e-13  36% 1422 aa  SPT6_ASPOR RecName: Full=Transcription elongation factor
  515::1115    5e-13  25% 1420 aa  SPT6_ASPFU RecName: Full=Transcription elongation factor
  870::1037    1e-12  36% 1521 aa  SPT6H_CAEBR RecName: Full=Suppressor of Ty 6 homolog;AltName:
  850::1106    1e-11  35% 1413 aa  SPT6_EMENI RecName: Full=Transcription elongation factor
  908::1154    3e-11  33% 1831 aa  SPT6H_DROME RecName: Full=Transcription elongation factor SPT6;
  864::1031    8e-11  33% 1449 aa  SPT6_CANGA RecName: Full=Transcription elongation factor
  482::951     4e-10  22% 1365 aa  SPT6_SCHPO RecName: Full=Transcription elongation factor
  865::1032    2e-09  31% 1451 aa  SPT6_YEAST RecName: Full=Transcription elongation factor
  860::1080    5e-09  24% 1506 aa  SPT6_CRYNE RecName: Full=Transcription elongation factor
  828::988     1e-08  32% 1401 aa  SPT6_CANAL RecName: Full=Transcription elongation factor
  840::1007    7e-08  30% 1432 aa  SPT6_ASHGO RecName: Full=Transcription elongation factor
  845::1009    2e-07  27% 1439 aa  SPT6_DEBHA RecName: Full=Transcription elongation factor
  144::197     3e-07  41%  205 aa  COMEA_BACSU RecName: Full=ComE operon protein 1;
  891::1038    6e-07  31% 1521 aa  SPT6H_CAEEL RecName: Full=Suppressor of Ty 6 homolog;AltName:
  126::180     1e-06  38%  550 aa  EEPD1_DANRE RecName: Full=Endonuclease/exonuclease/phosphatase
  965::1132    3e-06  30% 1723 aa  SPT6_USTMA RecName: Full=Transcription elongation factor
   62::116     2e-05  41%  123 aa  YBAV_SHIFL RecName: Full=Uncharacterized protein ybaV;Flags:
   62::116     2e-05  41%  123 aa  YBAV_ECOLI RecName: Full=Uncharacterized protein ybaV;Flags:
  125::183     3e-04  29%  556 aa  EEPD1_XENLA RecName: Full=Endonuclease/exonuclease/phosphatase
   14::93      8e-04  32%  569 aa  EEPD1_RAT RecName: Full=Endonuclease/exonuclease/phosphatase family
   14::93      8e-04  32%  569 aa  EEPD1_HUMAN RecName: Full=Endonuclease/exonuclease/phosphatase
   14::93      8e-04  32%  571 aa  EEPD1_BOVIN RecName: Full=Endonuclease/exonuclease/phosphatase
  124::185     0.001  45%  763 aa  THIED_CORGL RecName: Full=Multifunctional protein thiED;Includes:
  865::1032    0.001  25% 1460 aa  SPT6_KLULA RecName: Full=Transcription elongation factor
    1::777

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MTTSIHQRIAEELGVRERQVRAAVELLDDGATVPFIARYRKEVTEMLDDAQLRAIXXXXXXXXXXXXXXT
YHGF_ECOLI      MNDSFCRIIAGEIQARPEQVDAAVRLLDEGNTVPFIARYRKEITGGLDDTQLRNXXXXXXXXXXXXXXXQ
Y568_HAEIN      LNQQISQIIAAELTVQPQQIFAAIQLLDDGNTIPFIARYRKEATGGLDDTQLRHFETRLIYLRELEDRRQ
TEX_BORPE       -------QLATEIGARASQVASAVELLDDGATVPFIARYRKEATGGLDDGALRTXXXXXXXXXXXXXXXG
YHGF_NEIMB      ---NITQILSQELSATAAQITAAVELLDDGATVPFIARYRKEATGGLDDTQXXXXXXXXXXXXXXXXXKA
YHGF_NEIMA      ---NITQILSQELSATAAQITAAVELLDDGATVPFIARYRKEATGGLDDTQXXXXXXXXXXXXXXXXXKA
YHGF_NEIGO      ---NITRILSQELSATTVQINAAIELLDDGATVPFIARYRKEATGGLDDTXXXXXXXXXXXXXXXXXXKA
SRBD1_PONAB     MNWDIVQVLSERTNIEPWVCTNTIRLFNDDNTIPFIIRYRKELINNLDADSLREVQQTLEELRAVAKKVH
SRBD1_HUMAN     MNWDMVQVLSERTNIEPWVCANIIRLFNDDNTIPFIIRYRKELINNLDADSLREVQQTLEELRAVAKKVH
SRBD1_MOUSE     MNWDVVQVLSERTNIEPWVCANIIRLFNDDNTIPFIVRYRKELINNLDADFLREVRQTLDELRDVAKKVH
SPT6_NEUCR      ----------------------------------------------------------------------
SPT6H_MOUSE     ----------------------------------------------------------------------
SPT6_GIBZE      ----------------------------------------------------------------------
SPT6H_HUMAN     ----------------------------------------------------------------------
SPT6H_DANRE     ----------------------------------------------------------------------
SPT6_ASPOR      ----------------------------------------------------------------------
SPT6_ASPFU      ----------------------------------------------------------------------
SPT6H_CAEBR     ----------------------------------------------------------------------
SPT6_EMENI      ----------------------------------------------------------------------
SPT6H_DROME     ----------------------------------------------------------------------
SPT6_CANGA      ----------------------------------------------------------------------
SPT6_SCHPO      ----------------------------------------------------------------------
SPT6_YEAST      ----------------------------------------------------------------------
SPT6_CRYNE      ----------------------------------------------------------------------
SPT6_CANAL      ----------------------------------------------------------------------
SPT6_ASHGO      ----------------------------------------------------------------------
SPT6_DEBHA      ----------------------------------------------------------------------
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     ----------------------------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      ----------------------------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
THIED_CORGL     ----------------------------------------------------------------------
SPT6_KLULA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           VILESIKAQGKLTPELEAAIMAADSKARLEDIYLPYKPKRRTKAQIAREAGLEPLADALLNDPSRDPHDQ
YHGF_ECOLI      AILKSISEQGKLTDDLAKAINATLSKTELEDLYLPYKPKRRTRGQIAIEAGLEPLADLLWSDPSHTPEVA
Y568_HAEIN      TILKSIEEQGKLTDELRDKIHATQSKTELEDLYLPYKPKRRTKGQIAIEAGLEPLANLLWNEPKNDPEST
TEX_BORPE       AILESITQQGKLTPELQQEIATAETKQRLEDLYAPYKPKRRTRAQIAREAGLEXXXXXXXXXXXXXXXXX
YHGF_NEIMB      VVLKSIEEQGKLSDDLRAQIEAADNKTALEDLYLPYKPKRRTKAQIAREHGLQPLADVLLAEQSQDVEAA
YHGF_NEIMA      VVLKSIEEQGKLSDDLRAQIEAADNKTALEDLYLPYKPKRRTKAQIAREHGLQPLADVLLAEQSQDVEAA
YHGF_NEIGO      VVLKSIEEQGKLSDDLRAQIEAADNKTALEDLYLPYKPKRRTKAQIAHEHGLQPLADVLLAEQPQDVEAA
SRBD1_PONAB     STIQKIKKEGKMSECLLKAMLNCKTFEELEHVSAPYKTSKGTKAQXXXXXXXXXXXXXXXXKPGEL---S
SRBD1_HUMAN     STIQKIKKEGKMSECLLKAMLNCKTFEELEHVSAPYKTSKGTKAQXXXXXXXXXXXXXXXXKPGEL---S
SRBD1_MOUSE     SRIQKIKKEGKMSECLLQALLNCKTFEELEHVSAPYKMSKGTKAQRAKQLGLEGAAWTLLENPGQL---N
SPT6_NEUCR      ----------------------------------------------------------------------
SPT6H_MOUSE     ----------------------------------------------------------------------
SPT6_GIBZE      ----------------------------------------------------------------------
SPT6H_HUMAN     ----------------------------------------------------------------------
SPT6H_DANRE     ----------------------------------------------------------------------
SPT6_ASPOR      ----------------------------------------------------------------------
SPT6_ASPFU      -------------------------------------------------------------DPAERPEEM
SPT6H_CAEBR     ----------------------------------------------------------------------
SPT6_EMENI      ----------------------------------------------------------------------
SPT6H_DROME     ----------------------------------------------------------------------
SPT6_CANGA      ----------------------------------------------------------------------
SPT6_SCHPO      -----------------------------------------------------------VEDNTLSPEEL
SPT6_YEAST      ----------------------------------------------------------------------
SPT6_CRYNE      ----------------------------------------------------------------------
SPT6_CANAL      ----------------------------------------------------------------------
SPT6_ASHGO      ----------------------------------------------------------------------
SPT6_DEBHA      ----------------------------------------------------------------------
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     ----------------------------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      ----------------------------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
THIED_CORGL     ----------------------------------------------------------------------
SPT6_KLULA      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           AAAYVDADKGVADTAAALEGARAILVERFTEDADLIGELRERMWQRGRLVSRVREGKEEVGVKFADYFDF
YHGF_ECOLI      AAQYVYADKGVADTKAALDGARYILMERFAEDAALLAKVRDYLWKNAHLVSTVVSGKEEEGAKFRDYFDH
Y568_HAEIN      ALSFVDAEKGVADSKAALDGARIILMERFAEDAGLLAKVRDYLAKNAVIVSKVIEGKETEGAKFQDYFDH
TEX_BORPE       XXQYLNPEASINDAKAALDGARDILAERHAENADLLADIREHLWSTGLLYSKMVEGKETDGANFRDWFDF
YHGF_NEIMB      AQGYLN--ENVPDAKAALDGARAILMEQFAEDAELIGTLRDKLWNEAEIHAQVVEGKETEGEKFSDYFDH
YHGF_NEIMA      AQGYLN--ENVPDAKAALDGARAILMEQFAEDAELIGTLRDKLWNEAEIHAQVVGGKETEGEKFSDYFDH
YHGF_NEIGO      AQGYLN--ENIPDAKAALDGARAILMEQFAEDAELIGTLRDKLWNEAEIHTQVVEGKETEGEKFSDYFDR
SRBD1_PONAB     LLSYIRPDKGLSTLQDIEIGAQHILADMIAKDKGTLDFIRNLCQNRHVCISLAKVSSKKVNEKDVDKFLL
SRBD1_HUMAN     LLSYIRPDKGLSTLQDIEIGVQHILADMIAKDKDTLDFIRNLCQKRHVCISLAKVSSKKVNEKDVDKFLL
SRBD1_MOUSE     LLSYIKPDKGLSELNDIETGVQHILADMIAKDKDTLDFIRGLCKHRYICIQSXXXXXXXXXXXFQLYQNF
SPT6_NEUCR      ----------------------------------------------------------------------
SPT6H_MOUSE     ---------------AVLEGARYMVALQIAREPLVRQVLRQTFQERAKLITPTKKGRKDV-----DEAHY
SPT6_GIBZE      ----------------------------------------------------------------------
SPT6H_HUMAN     ----------------------------------------------------------------------
SPT6H_DANRE     ----------------------------------------------------------------------
SPT6_ASPOR      ----------------------------------------------------------------------
SPT6_ASPFU      ADSFIDND--FSNASHVLKAAKALFAEEIVMSPKMRKVIRQAYYMNGAVCFRTEKGLRRIDEQHP-YYEF
SPT6H_CAEBR     ----------------------------------------------------------------------
SPT6_EMENI      ----------------------------------------------------------------------
SPT6H_DROME     ----------------------------------------------------------------------
SPT6_CANGA      ----------------------------------------------------------------------
SPT6_SCHPO      SRTYVTNE--LSSPEQVLQKARRVLAEEIIHDPQFRKSFRDKLYNAGVVVLATQKGVRKIGSEHP-YYEF
SPT6_YEAST      ----------------------------------------------------------------------
SPT6_CRYNE      ----------------------------------------------------------------------
SPT6_CANAL      ----------------------------------------------------------------------
SPT6_ASHGO      ----------------------------------------------------------------------
SPT6_DEBHA      ----------------------------------------------------------------------
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     ----------------------------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      ----------------------------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
THIED_CORGL     ----------------------------------------------------------------------
SPT6_KLULA      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AEAFTTLPSHRVLALFRGEKEEVLDLTLXXXXXXXXXXXXSSYEVRIAQHFGIADQGRPGDRWLLDTVRW
YHGF_ECOLI      HEPLSTVPSHRALAMFRGRNEGVLQLSLNADPQFDEPPKESYCEQIIMDHLGLRLNNAPADSWRKGVVSW
Y568_HAEIN      QELLKNVPSHRALAMFRGRNEGILQLSLNADPDAEEGSRQSYCEEIIRDYLDVRFTGQPADKWREQVIAW
TEX_BORPE       NEPLRTLPSHRILALMRGRQQGVLELRVGLEADLEAETPHPCV-VRIASFLKLGNDATPRARWLGEVCRW
YHGF_NEIMB      REPVRTMPSHRALAVLRGRNEGVLNIALKYQPDDTPITRQSEYEQIIACRFKVSD----GHKWLRDTVRL
YHGF_NEIMA      REPIRAMPSHRALAVLRGRNEGVLNIALKYQPDDTPITQQSEYEQIIARRFKVSD----GHKWLRDTVRL
YHGF_NEIGO      REPVRAMPSHRALAVLRGRNEGVLNIALKYQPDDTPITQQSEYEQIIARRFKVSD----GHKWLRDTVRL
SRBD1_PONAB     YQHFSNIHHHQILAINRGENLKVLTVKVNISDGVKDEFC----------RWCIQNRWRPRSKILRNSLND
SRBD1_HUMAN     YQHFSNIHHHQILAINRGENLKVLTVKVNISDGVKDEFC----------RWCIQNRWRPRSKILYNSLND
SRBD1_MOUSE     SCNIRTIHHHQILAINRGENLKILTVKVNISDGVKNEFCRWCIQNRWRPR-GFA---RPELMKILNSLDD
SPT6_NEUCR      ----------------------------------------------------------------------
SPT6H_MOUSE     AYSFKYLKNKPVIGLAEDEGLLTIDISIDMKGVEGYGNDQTYFE-EIKQFYEFSHQVQEWNRQRTMAIER
SPT6_GIBZE      ----------------------------------------------------------------------
SPT6H_HUMAN     ----------------------------------------------------------------------
SPT6H_DANRE     ----------------------------------------------------------------------
SPT6_ASPOR      ----------------------------------------------------------------------
SPT6_ASPFU      KYLRNQQLSELYLRMLKAEEEGLVEVKVRFENFDHFRQRLYP-DIESDNYSEIADAWNRTRREVLDMALG
SPT6H_CAEBR     ----------------------------------------------------------------------
SPT6_EMENI      ----------------------------------------------------------------------
SPT6H_DROME     ----------------------------------------------------------------------
SPT6_CANGA      ----------------------------------------------------------------------
SPT6_SCHPO      KYSFELEPI-LFLKMLKAEEEGLIQLSIEFEDPDDVFKGL--LELFVSDNFSENAMQWNAQRELVDAIRE
SPT6_YEAST      ----------------------------------------------------------------------
SPT6_CRYNE      ----------------------------------------------------------------------
SPT6_CANAL      ----------------------------------------------------------------------
SPT6_ASHGO      ----------------------------------------------------------------------
SPT6_DEBHA      ----------------------------------------------------------------------
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     ----------------------------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      ----------------------------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
THIED_CORGL     ----------------------------------------------------------------------
SPT6_KLULA      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AWRTRILVRLDIDLRSRLWQEAEDEAVRVFAANLRDLLLAAPAGTRPTIGLDPGLRTGVKVAVVDGTGKV
YHGF_ECOLI      TWRIKVLMHLETELMGTVRERAEDEAINVFARNLHDLLMAAPAGLRATMGLDPGLRTGVKVAVVDATGKL
Y568_HAEIN      TWKIKVSLHLETELMASLREKAEEEAIDVFARNLTALLMAAPAGAKSTMGLDPGLRTGVKVAMVDNTGKL
TEX_BORPE       TWRVKLLTAFESELFGRLRESAEAEAIRVFAANLKDLLLAAPAGPKTVLGLDPGIRTGCKVAVIDRTGKV
YHGF_NEIMB      TWRAKIFLSLELEALGRLKEAADTDAITVFARNLKDLLLVAPAGRLTTLGLDPGYRNGVKCAVVDDTGKL
YHGF_NEIMA      TWRAKIFLSLELEALNRLKEAADTDAITVFARNLKDLLLAAPAGRLTTLGLDPGYRNGVKCAVVDDTGKL
YHGF_NEIGO      TWRAKIFLSLELEALNRLKEAADTDAITVFARNLKDLLLAAPAGRLTTLGLDPGYRNGVKCAVVDDTGKL
SRBD1_PONAB     SFKRLIYPLLCREFRAKLTSDAEKESVMMFGRNLRQLLLTSPVPGRTLMGVDPGYKHGCKLAIISPTSQI
SRBD1_HUMAN     SFKRLIYPLLCREFRAKLTSDAEKESVMMFGRNLRQLLLTSPVPGRTLMGVDPGYKHGCKLAIISPTSQI
SRBD1_MOUSE     SFKRLIVPLLCREFRAKLTSDAEKQSVMMFGQNLRQLLLTSPVPGRTLMGVDPGYKHGCKLAIISPTSQI
SPT6_NEUCR      ----------------------------------------------------------------------
SPT6H_MOUSE     ALQQFLYVQMAKELKNKLLAEARESVVKACSRKLYNWLRVAPYRPDQQVEMDENQGKGIRVALVNGEGEV
SPT6_GIBZE      ----------------------------------------------------------------------
SPT6H_HUMAN     ----------------------------------------------------------------------
SPT6H_DANRE     ----------------------------------------------------------------------
SPT6_ASPOR      ----------------------------------------------------------------------
SPT6_ASPFU      KLERLINRSVKENIRQECENHVAKECREAFSQRLDQAVLAMSTGTG-IVGRDP-----IHWAYVEEDGRV
SPT6H_CAEBR     ----------------------------------------------------------------------
SPT6_EMENI      ----------------------------------------------------------------------
SPT6H_DROME     ----------------------------------------------------------------------
SPT6_CANGA      ----------------------------------------------------------------------
SPT6_SCHPO      TLRSRYLDELGMRCRNQLFSRLDQAPYEPSTKNF-------DRGTIPSVSNGKGESSDAIICVVDDVGEP
SPT6_YEAST      ----------------------------------------------------------------------
SPT6_CRYNE      ----------------------------------------------------------------------
SPT6_CANAL      ----------------------------------------------------------------------
SPT6_ASHGO      ----------------------------------------------------------------------
SPT6_DEBHA      ----------------------------------------------------------------------
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     ----------------------------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      ----------------------------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
THIED_CORGL     --------------------------------------------------------TGVALPDVIGIGPV
SPT6_KLULA      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           VDTATIYPHEPQKRWDESIAVLAALAQKHRVELVAIGNGTASRETDRLAADLIKRHPELKLTKVMXXXXX
YHGF_ECOLI      VATDTIYPHTGQAA--KAAMTVAALCEKHNVELVAIGNGTASRETERFYLDVQKQFPKVTAQKVIVSEAG
Y568_HAEIN      LDTTTIYPHTGREA--EAQVAIFSLIRKHNVELIAIGNGTASRETERFAKDVIKEIKENKPQTVVVSEAG
TEX_BORPE       VDTATVYPFEPRRDREGTIKTLAALAARHKVELIAIGNGTASRESEKLVGDMMARFPDLALTRVVVSEAG
YHGF_NEIMB      LDTVIVYLHQE----NNMLATLSRLIKQHGVKLIAIGNGTASRETDKIAGELVRGMPEMGLHKIVVSEAG
YHGF_NEIMA      LDTVIVYLHQE----NNMLATLSRLIKQHGVKLIAIGNGTASRETDKIAGELVREMSKMGLHKIVVSEAG
YHGF_NEIGO      LDTVIVYLHQE----NNMLATLSRLIKQHGVKLIAIGNGTASRETDKIAGELVRGMPESSLHKIVVSEAG
SRBD1_PONAB     LHTDVVYLHCGQGREAEKIKMLLL---NFNCSTVVIGNGTACRETEAYFADLIMKNAPLDVVYCIVSEAG
SRBD1_HUMAN     LHTDVVYLHCGQGREAEKIKTLLL---NFNCSTVVIGNGTACRETEAYFADLIMKNAPLDVVYCIVSEAG
SRBD1_MOUSE     LHTDVVYLHCGQGREAEKIK---RLLLHFNCRTVVIGNGTACRETEAYFADLIMKNAPLDVVYCIVSEAG
SPT6_NEUCR      ----------------------------------------------------------------------
SPT6H_MOUSE     TDFLRL-PHFTKRRWREEIETLKKFLVNKKPHVVTIAG--ENRDAQMLTEDVKRIVHELQLSSILVDNEL
SPT6_GIBZE      ----------------------------------------------------------------------
SPT6H_HUMAN     ----------------------------------------------------------------------
SPT6H_DANRE     ----------------------------------------------------------------------
SPT6_ASPOR      ----------------------------------------------------------------------
SPT6_ASPFU      LENGSIGDRDRSIPDGKDVEALIELLERRRPDVIGVGMSPETRKLYKLLTELVERDEEISLEVVIVNDEV
SPT6H_CAEBR     ----------------------------------------------------------------------
SPT6_EMENI      ----------------------------------------------------------------------
SPT6H_DROME     ----------------------------------------------------------------------
SPT6_CANGA      ----------------------------------------------------------------------
SPT6_SCHPO      TDSLKL----ADLRDLANQAMFAEFVEKVKPDVIGVGMSVSAHKIRQHVQDSLTSHEPVDL--IMVNDEV
SPT6_YEAST      ----------------------------------------------------------------------
SPT6_CRYNE      ----------------------------------------------------------------------
SPT6_CANAL      ----------------------------------------------------------------------
SPT6_ASHGO      ----------------------------------------------------------------------
SPT6_DEBHA      ----------------------------------------------------------------------
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     ----------------------------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      ----------------------------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
THIED_CORGL     ASTAT-KPDAAPALGVEGIAEIAAVAQDHGIASVAIG-GVGLRNAAELAA--------------------
SPT6_KLULA      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           XXXXXXXXXXXQELPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSEVKLSRSLDAVVED
YHGF_ECOLI      ASVYSASELAAQEFPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSQTQLARKLDAVVED
Y568_HAEIN      ASVYSASEFAANEFPNLDVSLRGAVSIARRLQDPLAELVKIEPKAIGVGQYQHDVNQTQLARKLDAVVED
TEX_BORPE       ASVYSASETAALEFPDLDVTLRGAVSIARRLQDPLAELVKIDPKAIGVGQYQHDVNQRELARSLDAVVED
YHGF_NEIMB      ASIYSASELAAREFPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVNQNQLAKSLDAVVED
YHGF_NEIMA      ASIYSASELAAREFPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVNQSQLAKSLDAVVED
YHGF_NEIGO      ASIYSASELAAREFPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVNQSRLAKSLDAVV--
SRBD1_PONAB     ASIYSVSPEANKEMPGLDPNLRSAVSIARRVQDPLAELVKIEPKHIGVGMYQHDVSQTLLKATLDSVVEE
SRBD1_HUMAN     ASIYSVSPEANKEMPGLDPNLRSAVSIARRVQDPLAELVKIEPKHIGVGMYQHDVSQTLLKATLDSVVEE
SRBD1_MOUSE     ASIYSVSPEANKEMPGLDPNLRSAVSIARRVQDPLAELVKFDPKHIGVGMYQHDVSQTLLKATLDSVVEE
SPT6_NEUCR      --------------PSLNPMTRYCIALARYMQNPMKEYAALDVTSLQIHPYQQYLPQAKLLKHLETAMVD
SPT6H_MOUSE     AILYMNSKKSEAEFRDYPPVLRQAVSLARRIQDPLIEFAQVDILCLKFHPLQEHVVKEELLNALYCEFIN
SPT6_GIBZE      ------------EHPSLNPITRYCVALARYMQNPMKEYAALDVSSLSYHPCQNLLPADKLAKYLDSAMVD
SPT6H_HUMAN     ------------EFRDYPPVLRQAVSLARRIQDPLIEFAQVDILCLKFHPLQEHVVKEELLNALYCEFIN
SPT6H_DANRE     --------------------LRQAVSVARKIQDPLVEFAQVDILCLKLHPLQEHVVKEELLSALYCEFIN
SPT6_ASPOR      ------------------------VALAKYLQSPLKEYASLDIVSIQFKPGQQLVTQELLLKQLETALVD
SPT6_ASPFU      ARLYQHSERAKKDHPSFGPLTHYCVALAKYLQSPLKEYASLDIVSIQFKRGQQLVAQELLLKQLETALVD
SPT6H_CAEBR     ------------ENPDHPPTLRQAVSLARQLLDPIPEYAHLDIFCLSLHPLQRDIDQEILAQLLNHELVN
SPT6_EMENI      ------------------------VGLAKYLQSPLKEYASLDIVSIQFKPGQQLVAQELLLKQLETALVD
SPT6H_DROME     -----------KEYPPL---LKQAASLARKMQDPLVELCDADDEILCLRYHQERVPREQLLEQLSLQFIN
SPT6_CANGA      -----------QEFPNKPPYVKYCIALARYMHSPLMEYANLSPKSLSIHPFQSFLSPEYLNRAIETAFVD
SPT6_SCHPO      ARLYQNSTRAVDEFPTLPTISCYCVALARYVQNPLFEYAAMDLMSLSFDPWQHLLPPDVLWKYLETALVD
SPT6_YEAST      -----------QEFPNKPPLVKYCIALARYMHSPLLEYANLEVRSLSIHPHQNLLSSEQLSWALETAFVD
SPT6_CRYNE      -----------KEHPNLPLNGRYALGLARYAQNPLNAYCKLGKHIASVTFMEHHIPQEKLLYHLERGLVN
SPT6_CANAL      -----------KEFPDKPTLVKYAISLGRYLQDPLLEYITLDILSLTFHEHQKLISNDLVKEVVESAFVD
SPT6_ASHGO      -----------QEFPNKPTLVKYCIALARYIHSPLLEYTNLSEESLLIHPHQSLLPRHIFKRALETSFVD
SPT6_DEBHA      ------------EFSDKPTLAKYCVGLARYVQSPLLEYLSLGEGILSLTFFEHQISTDLVMEAIESAYVD
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     --------------------------------DPIPEYAHLDIFCLSLHPLQRDIDQEQLALVLSHELVN
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      -----------EEFPELSELGRYCLALARYAQSPVNEFAALDLTAVILDPNQRLLPQDRLRLHFERCIGA
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       -----------------------------------------------------DPSDLSHSRKFSAACNF
EEPD1_HUMAN     -----------------------------------------------------DPSDLSHSRKFSAACNF
EEPD1_BOVIN     -----------------------------------------------------DPSDLSHSRKFSAACNF
THIED_CORGL     ----------------------------------------------------------------------
SPT6_KLULA      -----------QEFPSKPTLVKYCIALGRYIHSPLLEYANLEXXXXXXXXXXXXXTRELFLQALETSFVD


                         *         .         .         .         .         +         .:560
query           CVNAVGVDVNTASVPLLSRVSGITASLAQNIVAYRDANGPFRTRAQLREVPRLGPKAFEQCAGFLRIPDG
YHGF_ECOLI      CVNAVGVDLNTASVPLLTRVAGLTRMMAQNIVAWRDENGQFQNRQQLLKVSRLGPKAFEQCAGFLRINHG
Y568_HAEIN      CVNAVGVDLNTASAPLLARVAGMTKTLAQNIVEYRDENGRFESRSELKKVPRLGPKAFEQCAGFMRIANG
TEX_BORPE       CVNAVGVDVNTASAALLARVSGLNTLLAKNIVAWRDENGAFPTRDMLRKVPRFGEKAFEQAAGFLRIPNG
YHGF_NEIMB      CVNAVGVDVNTASAPLLARISGLNQTLAQNIVAYRDENGAFDSRKKLLKVPRLGEKTFEQAAGFLRINGG
YHGF_NEIMA      CVNAVGVDVNTASAPLLARISGLNQTLAQNIVAYRDENGAFDSRKKLLKVPRLGEKTFEQAAGFLRINGG
YHGF_NEIGO      ----------------------------------------------------------------------
SRBD1_PONAB     CVSFVGVDINICSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFIRINQD
SRBD1_HUMAN     CVSFVGVDINICSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFIRINQD
SRBD1_MOUSE     CVSFVGVDINICSEVLLRHIAGLNANRAKNIIEWREKNGPFINREQLKKVKGLGPKSFQQCAGFVRINQD
SPT6_NEUCR      MVNLVGVDINVATAHLLPYVAGLGPRKAQLLIKGINKNGGVVTSPERHKLPVLGPRVWNNCASFLFIEPE
SPT6H_MOUSE     RVNEVGVDVNRASQALIQYVCGLGPRKGTHLLILKQNNTRLESRTQLVTMCHMGPKVFMNCAGFLKIDTG
SPT6_GIBZE      MVNLCGVDINTYTANLLPYVSGLGPRKATSVIKAINANGAVGTRDELGKLPVVGPRVWNNCASFLFIEPS
SPT6H_HUMAN     RVNEVGVDVNRASQALIQYVCGLGPRKGTHLLILKQNNTRLESRTQLVTMCHMGPKVFMNCAGFLKIDTG
SPT6H_DANRE     RVNEVGVDVNRATQSLVQYICGLGPRKGSHLLILKQNNTRLENRTQLVTMCHMGPKVFINCAGFIKIDTG
SPT6_ASPOR      MVNLVGVDINEA----------VTDSSTANLLPYVCGLGPRKAAHLLKQYPAMGVKVWNNCASFLYIPDA
SPT6_ASPFU      MVNLVGVDINEA----------VTDPATANLLPYVCGLGPRKAAHLLKQYPAMGVKVWNNCASFLFIPDA
SPT6H_CAEBR     RVNEEGVDINKCATNMLQFTCGLGPRKATSLLKSIKANDNLESRSKLVVGCKLGPKVFMNCAGFIRISDK
SPT6_EMENI      MVNLVGVDINEATANLLPYVCGLGPRKAAHLLKIVNTGGVVNSRFSLLGVPAMGVKVWNNSASFLYIDDA
SPT6H_DROME     RTSEVGLDINSRTINLLQYICGLGPRKGQALLKLKQSNQRLENRTQLVTVCHLGPRVFINCSGFIKIDTG
SPT6_CANGA      IVNLVGVEVNKATASVLRFVSGFGKRKAIDFLSLQRLNEPLLARQQLITHNILHKVIFMNSAGFLYISWS
SPT6_SCHPO      ISSLVGIDINEAEANILPYIAGLGPRKADYVLKKIAAGGRIDNRSDLISKQIMSRKVFINCSSFFIIPND
SPT6_YEAST      IVNLVSVEVNKATASALKYISGFGKRKAIDFLSLQRLNEPLLARQQLITHNILHKTIFMNSAGFLYISWN
SPT6_CRYNE      SVCFMGIEINSCVADMLPYIAGLGPRKADAVIYGIQKHGALINRMAFTDLGLFGPTIFENTAGFLTIQEQ
SPT6_CANAL      LVNAVGVDINSRLAQTLKYVGGLASGMLRNIA--QKLGSVLTTRSQLIEYELTTRTIFINCSAALKISLN
SPT6_ASHGO      IVNLVGVEVNKANAKALQYIAGLGKRKAIDFLSLQRLNEPLLARQQLITHDILHKTIFMNSAGFLYISWN
SPT6_DEBHA      IINMVGVEINEAIAQLLPYVAGLGPRKASGLLRNINSGSTLANRSDLIENELSTANIFINCSSFLNIPYD
COMEA_BACSU     ------VNINTATLEELQGISGVGPSKAEAIIAYREENGRFQTIEDITKVSGIGEKSFEK----------
SPT6H_CAEEL     KVNEEGVDINKCATNMLQFTCGLGPRKATDLLKSIKANDNLESRSKLVVGCKLGPKVFMNCAGFIKIDTI
EEPD1_DANRE     -----GVNINTATPPQLMSVRGITEKIAKNIVEFRSVHGPFKSIEDLVKVANINSSLLDR----------
SPT6_USTMA      VVNENGVEINQAMTSMLPFVAGLGPRKAHALVISTKLEGTLINRTLLISRNILTFQVFQNCASFLRIEDV
YBAV_SHIFL      ------VSINNASAEELARMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVER----------
YBAV_ECOLI      ------VSINNASAEELARMNGVGLKKAQAIVSYREEYGPFKTVEDLKQVPGMGNSLVER----------
EEPD1_XENLA     -LSAARLNLNTASASQLMNLRGLTQEMVEDIVQYRSQQGPLKSIEDLVKVDSISPSFLDK----------
EEPD1_RAT       SVNQERLNINTATEEELMTLPGVTRAVARSIVEYREYIGGFKKVEDLALVSGVGATKLEQ----------
EEPD1_HUMAN     SVNQERLNINTATEEELMTLPGVTRAVARSIVEYREYIGGFKKVEDLALVSGVGATKLEQ----------
EEPD1_BOVIN     SVNQERLNINTATEEELMTLPGVTRAVARSIVEYREYIGGFKKVEDLALVSGVGATKLEQ----------
THIED_CORGL     ----------------------------------------------------------------------
SPT6_KLULA      IVNLVGIEVNKATAKALRYIAGFRRKSADFLESLQRLNEPLLARQQLITHDILTKTIFMNSAAFLYISWN


                         .         .         .         *         .         .         .:630
query           DDPLDSSSVHPEAYPVVRRILEATGRDIRALIGDTDTLRSLRPDDFVDERFGLPTVTDILAELEKPGRDP
YHGF_ECOLI      DNPLDASTVHPEAYPVVERILAATQQALKDLMGNSSELRNLKASDFTDEKFGVPTVTDIIKELEKPGRDP
Y568_HAEIN      KNPLDASGVHPEAYPVVEKILQATAQSIQDLMSNAGVVRQLDAKQFIDEQFGLPTVQDIFKELEKPGRDP
TEX_BORPE       DNPLDASAVHPEAYPVVERIVARIKADVRHIIGQREALKGVSPSDFTDERFGLPTVRDIFAELEKPGRDP
YHGF_NEIMB      KEPLDASAVHPEAYPVVAKMLAQQGISAAELIGNRERVKQIKASDFTDERFGLPTILDILSELEKPGRDP
YHGF_NEIMA      KEPLDASAVHPEAYPVVAKMLAQQGISAAELIGNRERVKQIKASDFTDERFGLPTILDILSELEKPGRDP
YHGF_NEIGO      ----------------------------------------------------------------------
SRBD1_PONAB     PNPLDQTCIHPESYDIAMRFLSSIGGTLYE-IGKPEMQQKI--NSFL-EKEGMEKIAEIIDGLSQPSFDF
SRBD1_HUMAN     PNPLDQTCIHPESYDIAMRFLSSIGGTLYE-VGKPEMQQKI--NSFL-EKEGMEKIAEIIDGLSQPSFDF
SRBD1_MOUSE     PNPLDQTCIHPESYDIAVRFLSFIGGTM-CEIGKPEMQQKINVSEGIEEQTTVHTLQVIIDGLSQPKTDI
SPT6_NEUCR      SDPLDNTRIHPEDYDLARKVADALGLDEEDVKAETDIVRKLFKDDEQDKVNELATLETIRAELQVPYEEL
SPT6H_MOUSE     DEVLDGSRVHPETYEWARKMVDALEYDLEEILENPERLKDLDLDAFAEERQGYGTLYDIRAELSCRYKDL
SPT6_GIBZE      SDPLDNTRVHPEDYELGRKMADALELDEEDVKGETD----------------------------------
SPT6H_HUMAN     DEVLDGSRVHPETYEWARKMVDALEYDLEEILENPERLKDLDLDAFAEERQGYGTLYDIRAELSCRYKDL
SPT6H_DANRE     DEVLDGSRVHPETYEWARKMVDALEYDLEEILENPERLKDLDLDAFAEERQGYGTLYDIRAELSCRYKDL
SPT6_ASPOR      D-PLDNTRVHPEDYDIARKMLELDEEDIKAETDENGTVRKLRVNDLILEEYARATLETIRAELQQPYEEL
SPT6_ASPFU      D-PLDNTRVHPEDYDIARKMLELDEEDIKAETGPGAIVRKLRVNDLILEEYARATLETIRAELQQPYEEL
SPT6H_CAEBR     TDALDGSRVHPETYEWARKM--------------------------------------------------
SPT6_EMENI      DDPLDNTRVHPEDYDIARKMLELDEEDIKAETGPGAIVRKLRVNDLILEEYARATLETIRAELQQPYEEL
SPT6H_DROME     DEVLDGSRVHPETYEWARKMIDAMEYDLEEILESPERLKDLDLDAFAVEGFGSKSITDIRNELSCLYKD-
SPT6_CANGA      HDQLDSTRIHPEDYHLATKV--------------------------------------------------
SPT6_SCHPO      EYPLDSTRIHNEDYELARKM--------------------------------------------------
SPT6_YEAST      EDQLDSTRIHPEDYHLATKV--------------------------------------------------
SPT6_CRYNE      PDPLDMTRIHPENYEFAQKMCQXXXXXXXXXXXKSEVVQTLMLDDKRGKKLGELNLDDFAFNLQRQG---
SPT6_CANAL      KEILDTTRIHPEDY--------------------------------------------------------
SPT6_ASHGO      EDHLDSTRIHPEDYHLATKV--------------------------------------------------
SPT6_DEBHA      EELLDATRIHPEDYDLARK---------------------------------------------------
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     KEVLDGSRVHPETYEWARKM--------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      PDVLDSTRIHPEDYDFPRKM--------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
THIED_CORGL     ----------------------------------------------------------------------
SPT6_KLULA      EDQLDGTRIHPEDYHLATKV--------------------------------------------------


                         .         +         .         .         .         .         *:700
query           RPEFQTAAFRDGVEDITDLEPGMVLEGVVTNXXXXXXXXXXXXXXXXXXXXSAMSKSFVKDPRDVVKPGD
YHGF_ECOLI      RPEFKTAQFADGVETMNDLQPGMILEGAVTNVTNFGAFVDIGVHQDGLVHISSLSNKFVEDPHTVVKAGD
Y568_HAEIN      RGEFKTAVFAEGVEEITDLKSGMILEGTVTNVTNFGAFVDIGVHQDGLVHISSLSDKFVEDPHQVVKTGN
TEX_BORPE       RPEFKTAQFKEGVETLNDLFPGMVLEGVVTNVANFGAFVDIGVHQDGLVHISALAEKFVKDPRDXXXXXX
YHGF_NEIMB      RGEFQTASFAEGIHEISDLQVGMILEGVVSNVANFGAFVDIGVHQDGLVHISALSNKFVQDPREXXXXXX
YHGF_NEIMA      RGEFQTASFAEGIHEISDLQVGMILEGVVSNVANFGAFVDIGVHQDGLVHISALSNKFVQDPREXXXXXX
YHGF_NEIGO      ----------------------------------------------------------------------
SRBD1_PONAB     RTDFDKPDFKRSIVCLKDLQVGTVLTGKVEN---------------------------------------
SRBD1_HUMAN     RTDFDKPDFKRSIVCLEDLQIGTVLTGKVEN---------------------------------------
SRBD1_MOUSE     RTDFDKPDFKRSIVCLEDLQVGTVLTGKVEN---------------------------------------
SPT6_NEUCR      RKKFESLTVDQVFTMLTGENRDSLCEGMI-----------------------------------------
SPT6H_MOUSE     RTAYRS----------------------------------------------------------------
SPT6_GIBZE      ----------------------------------------------------------------------
SPT6H_HUMAN     RTAYRS----------------------------------------------------------------
SPT6H_DANRE     RAPYRPPNTEEVFNMLTKETPGKLITCVVTN---------------------------------------
SPT6_ASPOR      RKQYVFLSTDDIFTMLTGETSDTLAEGMV-----------------------------------------
SPT6_ASPFU      RKQFALLSTDDVFTMLTGETSDTLAEGMV-----------------------------------------
SPT6H_CAEBR     ----------------------------------------------------------------------
SPT6_EMENI      RKHFVFLSTDDIFTMLTGETAQTLAEGMV-----------------------------------------
SPT6H_DROME     ---YRTPYTKPSAEELFDM---------------------------------------------------
SPT6_CANGA      ----------------------------------------------------------------------
SPT6_SCHPO      ----------------------------------------------------------------------
SPT6_YEAST      ----------------------------------------------------------------------
SPT6_CRYNE      ----------------------------------------------------------------------
SPT6_CANAL      ----------------------------------------------------------------------
SPT6_ASHGO      ----------------------------------------------------------------------
SPT6_DEBHA      ----------------------------------------------------------------------
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     ----------------------------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      ----------------------------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
THIED_CORGL     ----------------------------------------------------------------------
SPT6_KLULA      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           IXXXXXXXXXXXXXXISLTLRLDDExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YHGF_ECOLI      IVKVKVLEVDLQRKRIALTMRLDEQ---------------------------------------------
Y568_HAEIN      IVKVKVLEVDVPRKRIALTMRLDE----------------------------------------------
TEX_BORPE       XXXXXXLEVDVARKRVALTMRLND----------------------------------------------
YHGF_NEIMB      XXXXXXLEVDAARKRIALTMRLDDE---------------------------------------------
YHGF_NEIMA      XXXXXXLEVDAARKRIALTMRLDDE---------------------------------------------
YHGF_NEIGO      ----------------------------------------------------------------------
SRBD1_PONAB     ----------------------------------------------------------------------
SRBD1_HUMAN     ----------------------------------------------------------------------
SRBD1_MOUSE     ----------------------------------------------------------------------
SPT6_NEUCR      ----------------------------------------------------------------------
SPT6H_MOUSE     ----------------------------------------------------------------------
SPT6_GIBZE      ----------------------------------------------------------------------
SPT6H_HUMAN     ----------------------------------------------------------------------
SPT6H_DANRE     ----------------------------------------------------------------------
SPT6_ASPOR      ----------------------------------------------------------------------
SPT6_ASPFU      ----------------------------------------------------------------------
SPT6H_CAEBR     ----------------------------------------------------------------------
SPT6_EMENI      ----------------------------------------------------------------------
SPT6H_DROME     ----------------------------------------------------------------------
SPT6_CANGA      ----------------------------------------------------------------------
SPT6_SCHPO      ----------------------------------------------------------------------
SPT6_YEAST      ----------------------------------------------------------------------
SPT6_CRYNE      ----------------------------------------------------------------------
SPT6_CANAL      ----------------------------------------------------------------------
SPT6_ASHGO      ----------------------------------------------------------------------
SPT6_DEBHA      ----------------------------------------------------------------------
COMEA_BACSU     ----------------------------------------------------------------------
SPT6H_CAEEL     ----------------------------------------------------------------------
EEPD1_DANRE     ----------------------------------------------------------------------
SPT6_USTMA      ----------------------------------------------------------------------
YBAV_SHIFL      ----------------------------------------------------------------------
YBAV_ECOLI      ----------------------------------------------------------------------
EEPD1_XENLA     ----------------------------------------------------------------------
EEPD1_RAT       ----------------------------------------------------------------------
EEPD1_HUMAN     ----------------------------------------------------------------------
EEPD1_BOVIN     ----------------------------------------------------------------------
THIED_CORGL     ----------------------------------------------------------------------
SPT6_KLULA      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxx
YHGF_ECOLI      -------
Y568_HAEIN      -------
TEX_BORPE       -------
YHGF_NEIMB      -------
YHGF_NEIMA      -------
YHGF_NEIGO      -------
SRBD1_PONAB     -------
SRBD1_HUMAN     -------
SRBD1_MOUSE     -------
SPT6_NEUCR      -------
SPT6H_MOUSE     -------
SPT6_GIBZE      -------
SPT6H_HUMAN     -------
SPT6H_DANRE     -------
SPT6_ASPOR      -------
SPT6_ASPFU      -------
SPT6H_CAEBR     -------
SPT6_EMENI      -------
SPT6H_DROME     -------
SPT6_CANGA      -------
SPT6_SCHPO      -------
SPT6_YEAST      -------
SPT6_CRYNE      -------
SPT6_CANAL      -------
SPT6_ASHGO      -------
SPT6_DEBHA      -------
COMEA_BACSU     -------
SPT6H_CAEEL     -------
EEPD1_DANRE     -------
SPT6_USTMA      -------
YBAV_SHIFL      -------
YBAV_ECOLI      -------
EEPD1_XENLA     -------
EEPD1_RAT       -------
EEPD1_HUMAN     -------
EEPD1_BOVIN     -------
THIED_CORGL     -------
SPT6_KLULA      -------