[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54145.1

[Show Plain Result]


## Summary of Sequence Search
    1::306
   50::282     6e-15  33%  286 aa  YKUE_BACSU RecName: Full=Uncharacterized metallophosphoesterase
   28::270     4e-13  29%  270 aa  YAEI_ECOLI RecName: Full=Phosphodiesterase yaeI;       
   43::259     1e-10  31%  259 aa  YPBG_BACSU RecName: Full=Uncharacterized protein ypbG;Flags:
   52::323     4e-09  31%  329 aa  Y461_CHLTR RecName: Full=Uncharacterized metallophosphoesterase
  194::388     2e-08  30%  444 aa  TMPPE_BOVIN RecName: Full=Transmembrane protein with
  234::294     3e-06  44%  305 aa  Y2345_DEIRA RecName: Full=Uncharacterized metallophosphoesterase
  194::397     2e-05  29%  453 aa  TMPPE_HUMAN RecName: Full=Transmembrane protein with
   41::264     3e-05  32%  270 aa  YKOQ_BACSU RecName: Full=Uncharacterized metallophosphoesterase
  246::427     6e-05  28%  482 aa  YQZ2_CAEEL RecName: Full=Putative metallophosphoesterase F40B5.2;  
   52::323     2e-04  29%  329 aa  Y746_CHLMU RecName: Full=Uncharacterized metallophosphoesterase
  300::367     4e-04  43%  370 aa  YA44_HELPJ RecName: Full=Uncharacterized metallophosphoesterase
    1::306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxERNWFRLRHYEIPILAPGSDRLRILHLSDAHLTPGRR
YKUE_BACSU      ----------------------------------------------LIPHGFDGFKIVQFSDAHLSDYFT
YAEI_ECOLI      ---------------------------------EPGWFELIRHRLAFFKDNAAPFKILFLADLHYSRPLS
YPBG_BACSU      --------------------------------------------------GKPPLTIFFISDIH----KR
Y461_CHLTR      ------------------------------------------------------LRIVQISDLHLTPDA-
TMPPE_BOVIN     -------------------------------------------EVPVLPPSMNSLKIVLLSDIHLGPGRT
Y2345_DEIRA     ----------------------------------------------------------------------
TMPPE_HUMAN     -------------------------------------------EVPILPASMNNLKIVLLSDIHLGPGRT
YKOQ_BACSU      -------------------------------------------------PARKKLNILHLSDLHLE-NIS
YQZ2_CAEEL      ---------------------------------------------------SGNVSIALLSDVHIGPGRT
Y746_CHLMU      ------------------------------------------------------LRIVQISDLHLNQSTA
YA44_HELPJ      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           LLIDWIRSLDAHNPDLVVNTGDSLAHPQAVKPFLDALGPLLDRPGLFVYGSNDLFSPQPKNPARYLWRSS
YKUE_BACSU      LLKTVILTINESKPDLIVFTGDIIDNPQAVIPLLRKLNAPFGK--LCIYGNHDHGG------------YG
YAEI_ECOLI      LISDAIALGIEQKPDLILLGGDYVLFDMSLNAFSDVLSPLAEAPTFACFGNHDRPVGTEKNHL-------
YPBG_BACSU      LIDDLLEKARSHAPHLVIIGGDLAEGGVPSARIEENIKRLVHFPIVFVWGNND-----------------
Y461_CHLTR      FLKKVSRKISSLSPDILVFTGDFVCRPERLKHFLCSLAPLLGNHDYATYVSRDIMNSRPLKRAQSLFASS
TMPPE_BOVIN     KMDMFVRMVNTLEPDVTVIVGDLCSEASVLRTAVAPLGQLRSRLGTFVTGNHEYYTSDVSNWFALLMSLN
Y2345_DEIRA     ----------------------------------------------------------------------
TMPPE_HUMAN     KMEMFVRMVNVLEPDITVIVGDSDSEASVLRTAVAPLGQLHSHLGYFVTGNHEYYTSDVSNWFALLESLH
YKOQ_BACSU      VSPEELYHLTKDQPDIIALTGDFLDRKRNIPKYLNALQKLKPAYGMYVFGNHDYV---------------
YQZ2_CAEEL      RIAKIVELTNALKPDIIAIAGDLA--DGLVRDFHGAAEPLCNL----------------KAPGGVYFATG
Y746_CHLMU      FLKKISRKVSSLSPDMLVFTGDFICRAKVLKNFLCSLNPLLGNHDYATYVSRDIHSSRPLRRAQSLFSSS
YA44_HELPJ      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           KADYRKRKIPDLPWRELGAAMREAGWLDLNNQKGHLTAGNLRIAAAGIHDSHIGLDRYEKIAGPADPTAD
YKUE_BACSU      TAVYK-------------SLMTAGGFTVYRNGYQTLSADGSKIEIASLDDLMLGNPDYE---GTLSRLSD
YAEI_ECOLI      ----------------IGETLKSAGITVLFNQATVIATPNRQFELVGTGDLWAGQCK----PPPASEANL
YPBG_BACSU      ---YEVRQ------HKLYSIFKAHGVITLRNESVPFSYNGHTIAIAGVDDIRMEMDHYEEAIKELDES-Q
Y461_CHLTR      RNEFADTLNPQIPNPHLVSILRNTPFQLLHNQSATLSD---TINIVGLGDFFAKQFDPKKAFTDYNPTLP
TMPPE_BOVIN     VQPLHNENVRI---SATGAHREDDDWICL--------AGVDDIEANILHYTGHGMDLEKALEGPDHPT--
Y2345_DEIRA     ----------------------------------------------------------------------
TMPPE_HUMAN     VQPLHNENVKISATRXXXXXXEDEDWICL--------AGVDDIEADILHYSGHGMDLDKALEG-CSPDHT
YKOQ_BACSU      --------LKEEDFQRLKRVLEENGCITLQNE-------HVRIETAAGPVNIIGIDDYSNITGSYQSLEN
YQZ2_CAEEL      NHEYMHGNVTEWFW-----FLENCNITVLHNLNKHITVNGQKLCVAGADDLYAGMD-LRKALGTCNSDS-
Y746_CHLMU      HNEFAEEFTPQDPNPHLLSILHNTPFQLLHNQS--VTLSDV-VNIVGLGDFFAKQFDPKKAFTNYNPTLP
YA44_HELPJ      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           VRIGVMHSPEPRNLDRFTADGYELLLAGHTHGGQICLPFYGTLVTNCGIDRARAWGLSRNGTSWLHVSGG
YKUE_BACSU      RLFSILLVHEPDAALKTTDYPVNLQLSGHTHGGQIQLPFYGPIITP-PYGKVYTEGMYQTGSTHIYVNRG
YAEI_ECOLI      PRLVLAHNPDSKEVMR--DEPWDLMLCGHTHGGQLRVPLVGEPFAPVE-DKRYVAGLNAFGERHIYTTRG
YPBG_BACSU      LNILVCHNPEIHEQIN-EDDGIDVILSGHTHGGQIRFGKFGPYLGKTGIVKNAAYLIS-NGYGTTKVPLR
Y461_CHLTR      ---GIILSHNPDTIHHLQDYPGDVVFSGHSHGPQISLPWFANTITNSGLENARGLFSFPEESRLLYVNRG
TMPPE_BOVIN     --ILLAHQPLAAKRALQARPDINLILSGHTHAGQI-----------------------------------
Y2345_DEIRA     -----------------------LVLSGHTHGGQVRLPLLGALKVPADPRFTMGWVRGPQGIP-AYVSRG
TMPPE_HUMAN     I-ILLAHQPLAAKRALQARPDINLILSGHTHAGQI-----------------------------------
YKOQ_BACSU      YHLVLTHDP---NIILDMKDHYDYLLSGHFHGGQIHWPKPYHLVKMGKLVRMNIKGLHYHHDKPFYISEG
YQZ2_CAEEL      TNILLAHQPNAAKIDSELSKKVNLILSGHTHGGQM-----------------------------------
Y746_CHLMU      ---GIILSHNPDTIHYLKDYPGDVVFSGHSHGPQISLPWFANTITNSGLENARGLFSFPQEKRLLYVNRG
YA44_HELPJ      ----------------------DLVLSGHTHAGQI-FPF-SLLVK---LAQTYLHGLKHSGTTQIYVSSG


                         .         *         .         .         .         .         +:350
query           LGTSPYAPVRFCCRPEAALLDLIPRx
YKUE_BACSU      LGMT-RLPLRFLAKPEITVFTL----
YAEI_ECOLI      VG-SLYG-LRLNCRPEVTMLELV---
YPBG_BACSU      LGAEPETHIVTLCGPE----------
Y461_CHLTR      LG--GWKRIRFCSPPEICLM------
TMPPE_BOVIN     --------------------------
Y2345_DEIRA     LGMSG-LPVRNLCEPE----------
TMPPE_HUMAN     --------------------------
YKOQ_BACSU      LGQTG-VNIRVGSRPE----------
YQZ2_CAEEL      --------------------------
Y746_CHLMU      LG--GWKRIRFFSPPEICIM------
YA44_HELPJ      AGYWG-IPLRFLAPSEIAYLRLLPK-