[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54205.1

[Show Plain Result]


## Summary of Sequence Search
    1::262
    3::230     4e-26  30%  231 aa  Y1507_MYCTU RecName: Full=Uncharacterized protein Rv1507c/MT1555;
    1::262

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxRVAMHQPHYLPWLGLLDKIDRCDLFVVLDHVQFERKGWQHRN
Y1507_MYCTU     ----------------------------KVAIVQSNYIPWRGYFDLIAFVDEFIIYDDMQYTKRDWRNRN


                         .         .         *         .         .         .         .:140
query           YVASKNGPVLLTVPVVQRSRDERIMDKSVNNSSPWWEKHSRTLAQHCYRKAPFWDEFGAEITAIYERRWE
Y1507_MYCTU     RIKTSQGLQWITVPVQVKGRFHQKIRETLIDGTDWAKAHWRAL-EFNYSAAAHFAEIADWLAPIYEEQHT


                         +         .         .         .         .         *         .:210
query           QLVDLSLATTEFVLNAFGITTPMVRSSELGEFTVQKSELLAQISAKVGATTMLSGDGARAYLDKDVFDRY
Y1507_MYCTU     XXXXXXXXXXXAICSYLGISTRLANSWDY-ELADGKTERLANLCQQAAATEYVSGPSARSYVDERVFDEL


                         .         .         .         +         .         .         .:280
query           GIAVEWQNFQHPEYPQHNRKGQEFLPRMAAIDLLLNVGPEGMDLVRQARxxx
Y1507_MYCTU     SIRVTW--FDYDGYRDYKQLWGGFEPAVSILDLLFNVGAEAPDYLRYCR---