[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54436.1

[Show Plain Result]


## Summary of Sequence Search
    1::306
    4::254     1e-34  37%  255 aa  YABD_BACSU RecName: Full=Uncharacterized deoxyribonuclease yabD;   
   89::254     3e-29  41%  265 aa  YCFH_ECOLI RecName: Full=Uncharacterized deoxyribonuclease ycfH;   
   89::254     3e-29  41%  265 aa  YCFH_ECOL6 RecName: Full=Uncharacterized deoxyribonuclease ycfH;   
   89::254     3e-29  41%  265 aa  YCFH_ECO57 RecName: Full=Uncharacterized deoxyribonuclease ycfH;   
    9::259     3e-28  32%  265 aa  Y017_UREPA RecName: Full=Uncharacterized deoxyribonuclease UU017;  
   88::258     1e-25  38%  261 aa  Y1786_SYNY3 RecName: Full=Uncharacterized deoxyribonuclease
    8::260     2e-23  30%  262 aa  Y009_MYCGE RecName: Full=Uncharacterized deoxyribonuclease MG009;  
    5::258     4e-23  29%  265 aa  Y325_BUCBP RecName: Full=Uncharacterized deoxyribonuclease bbp_325;
    5::257     1e-21  30%  260 aa  Y454_HAEIN RecName: Full=Uncharacterized deoxyribonuclease HI0454; 
   97::262     4e-21  33%  264 aa  Y355_BUCAI RecName: Full=Uncharacterized deoxyribonuclease BU355;  
   95::250     4e-20  42%  264 aa  Y343_BUCAP RecName: Full=Uncharacterized deoxyribonuclease
    7::259     3e-19  27%  259 aa  YJJV_ECOLI RecName: Full=Uncharacterized deoxyribonuclease yjjV;   
   36::260     1e-17  31%  261 aa  Y009_MYCPN RecName: Full=Uncharacterized deoxyribonuclease MG009
   16::258     2e-16  38%  260 aa  TATD_ECOLI RecName: Full=Deoxyribonuclease tatD;       
   89::245     8e-13  26%  249 aa  Y1582_METJA RecName: Full=Uncharacterized deoxyribonuclease MJ1582;
   39::210     4e-11  29%  312 aa  YNF8_SCHPO RecName: Full=Deoxyribonuclease Tat-D;       
    7::262     1e-10  28%  294 aa  TATD3_MOUSE RecName: Full=Putative deoxyribonuclease TATDN3;       
  121::262     2e-10  25%  262 aa  Y081_HAEIN RecName: Full=Uncharacterized deoxyribonuclease HI0081; 
   10::264     2e-10  26%  273 aa  TATD3_BOVIN RecName: Full=Putative deoxyribonuclease TATDN3;       
  587::761     3e-10  34%  761 aa  TATD2_HUMAN RecName: Full=Putative deoxyribonuclease TATDN2;       
  101::265     5e-10  27%  274 aa  TATD3_HUMAN RecName: Full=Putative deoxyribonuclease TATDN3;       
  100::261     5e-10  30%  270 aa  TAT3A_XENLA RecName: Full=Putative deoxyribonuclease tatdn3-A;     
   31::197     7e-09  25%  295 aa  TATD1_MOUSE RecName: Full=Putative deoxyribonuclease TATDN1;       
  100::246     7e-09  31%  255 aa  TAT3B_XENLA RecName: Full=Putative deoxyribonuclease tatdn3-B;     
   31::162     3e-08  27%  297 aa  TATD1_XENLA RecName: Full=Putative deoxyribonuclease TATDN1;       
   31::197     1e-07  24%  297 aa  TATD1_BOVIN RecName: Full=Putative deoxyribonuclease TATDN1;       
   98::262     2e-06  25%  266 aa  TATD3_DANRE RecName: Full=Putative deoxyribonuclease tatdn3;       
  246::301     5e-04  32%  356 aa  DCUP_MAGSM RecName: Full=Uroporphyrinogen decarboxylase;       
    1::306

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDCHTHMDMQGGDVAEIVAKAASVGVTPIIQVGCDVAG
YABD_BACSU      ---------------------------------DTHAHLNAEDTDLEEVIERAKAEKVERIVVVGFDRPT
YCFH_ECOLI      ----------------------------------------------------------------------
YCFH_ECOL6      ----------------------------------------------------------------------
YCFH_ECO57      ----------------------------------------------------------------------
Y017_UREPA      ---------------------------------DTHTHPNIEPEEFDDIIFKCYEQGIGLNI-VGVDLKT
Y1786_SYNY3     ----------------------------------------------------------------------
Y009_MYCGE      ----------------------------------CHLNCEPLLSEIEKSIANFKLINLKANV-VGTDLDN
Y325_BUCBP      ---------------------------------DSHCHLDLLNYNIQDVLNKSKKKHVNVILTVSTSIEN
Y454_HAEIN      ---------------------------------DSHCHLDALDYEISDVVEKAHARDVKHLLAIGVTLSR
Y355_BUCAI      ----------------------------------------------------------------------
Y343_BUCAP      ----------------------------------------------------------------------
YJJV_ECOLI      ---------------------------------DTHCHFDFPSGDEEASLQRAAQAGVGKIIVPATEAEN
Y009_MYCPN      ---------------------------------------------------------------VGTNLTN
TATD_ECOLI      --------------------------------------------DRDDVVACAFDAGVNGLLITGTNLRE
Y1582_METJA     ----------------------------------------------------------------------
YNF8_SCHPO      --------------------------------------------DFDSIISRAKAVGVEKMMITGDNVEN
TATD3_MOUSE     ---------------------------------DCHCHLSASDNDLDDVLEKARKANVMALVAVA-EHAG
Y081_HAEIN      ----------------------------------------------------------------------
TATD3_BOVIN     ---------------------------------DCHCHLSAPDHDLDDVLKKAKEANVMALVVVAEHSGE
TATD2_HUMAN     ----------------------------------------------------------------------
TATD3_HUMAN     ----------------------------------------------------------------------
TAT3A_XENLA     ----------------------------------------------------------------------
TATD1_MOUSE     --------------------------------------------DLQDVIERAIQIGVKKFMITGGSLQD
TAT3B_XENLA     ----------------------------------------------------------------------
TATD1_XENLA     --------------------------------------------DFADIIERAVRTGVQKFMITGGNLHE
TATD1_BOVIN     --------------------------------------------DLQDVIERAVQIGVKKFMITGGNLQD
TATD3_DANRE     ----------------------------------------------------------------------
DCUP_MAGSM      ------------------------------------------------LFAKGCNAMVEDIAQSGCDVVG


                         .         .         *         .         .         .         .:140
query           SRWAVQAAAEHDTVWAAVALHPNEAPRIVHGVPEDEATXXXXXXXXXXXXXXXXXXXXXXXXXXXXKVCA
YABD_BACSU      ITRAMEMIEEYDFIYAAIGWHPVDA---IDMTEEDLA--------------------WIKELSAHEKVVA
YCFH_ECOLI      -------------------------------------------------------------------VVA
YCFH_ECOL6      -------------------------------------------------------------------VVA
YCFH_ECO57      -------------------------------------------------------------------VVA
Y017_UREPA      SQTAIQQAKKFKFLTCSVAIHPND----LHNIENDFVALEKLIAENIDY------------------ISC
Y1786_SYNY3     ------------------------------------------------------------------RVVA
Y009_MYCGE      SKIAVELAKKYDLLKATIGIHPND----VHLVDFKKTKKQLNELLINNRNF----------------ISC
Y325_BUCBP      FCYLLKFIKGNRNVLLSCGIHP-------HYIPENK-----------------NEILKLKKYSNNEKVVA
Y454_HAEIN      FEQAYDSLREFNNVSLACGVHPLDF--------EEEP----------------YDAERLLRLAQDPKVIA
Y355_BUCAI      -------------------------------------------------------------------VIA
Y343_BUCAP      -------------------------------------------------------------------VIA
YJJV_ECOLI      FARVLALAENYQPLYAALGLHP--------GMLEKHSDVSLEQLQQALERRPA-------------KVVA
Y009_MYCPN      SQIAVNLAKQHDLLKAGVGIHPNDVQ--LFDLKAAQATLKKLVSTHRSF------------------ISC
TATD_ECOLI      SQQAQKLARQYSSCWSTAGVHPHDSSQ-----------------------WQXXXXXXXXXXXXQPEVVA
Y1582_METJA     ------------------------------------------------------------------EILA
YNF8_SCHPO      SEEALNLATNYECFTSTVGVHPCQAQCFLRHSPEDYLVKLEALANKGKASG---------------KVVA
TATD3_MOUSE     EFERIMQLSENGFVLPCLGVHPPEKPRSVTLKDLDVALPIIEKYKD--------------------RLLA
Y081_HAEIN      ----------------------------------------------------------------------
TATD3_BOVIN     FEKIMQLSQRYNGVLPCLGVHP------VQGVPEDQRSVTLKDLDVALPIIENYKD----------QLLA
TATD2_HUMAN     ------------------------------------------------------------------KAVA
TATD3_HUMAN     ------------------------------------------------------------------RLLA
TAT3A_XENLA     ---------------------------------------------------------------------A
TATD1_MOUSE     SKDALQLAQTNDMFFSTVGCHPTRCDEFEKGSPDQYLAGLLSLAENNKG-----------------KVVA
TAT3B_XENLA     ------------------------------------------------------------------ELVA
TATD1_XENLA     SKEAIQLAQSNDRFYSTVGCHPTRCGEFEQGDPDQ-----------------YLAELQNLLEDNKGKVVA
TATD1_BOVIN     SKDALHLAQTNDMFFSTVGCHPTRCDEFEKNDPDH-----------------YLMELLNLAESNKGKVVA
TATD3_DANRE     -------------------------------------------------------------------IVA
DCUP_MAGSM      LDWTSEIGPLRERIGHKVALQGNMDPALLYASPE------------------------------------


                         +         .         .         .         .         *         .:210
query           IGETGLDCYRTGPEGFDIQERSFRAHIAIAQRHGKALMIHDRDAHEDVLRVLEDAGAPERVVFHCFSGDA
YABD_BACSU      IGEMGLD-YHWDKSPKDIQKEVFRNQIALAKEVNLPIIIHNRDATEDVVTILKEEGA-EAVIMHCFTGSA
YCFH_ECOLI      LGETGLDYYYT-PETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDGGVLHCFTEDR
YCFH_ECOL6      LGETGLDYYYT-PETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDGGVLHCFTEDR
YCFH_ECO57      LGETGLDYYYT-PETKVRQQESFIHHIQIGRELNKPVIVHTRDARADTLAILREEKVTDGGVLHCFTEDR
Y017_UREPA      IGECGLDYYHEQNYDHDFQKHWFKKHIELAKKYHKPLMLHIRNAHDDAIAILKEL-AVQDVIIHCFTDKK
Y1786_SYNY3     IGEMGLDFFKA--DNRDHQIEVFRAQLAIARELNKPVIIHCRDAAQTMRQVLTDFQAPVAGVMHCWGGTP
Y009_MYCGE      IGEYGFDYHYT-TEFIELQNKFFEMQFEIAETNKLVHMLHIRDAHEKIYEILTRLKPTQPVIFHCFSQDI
Y325_BUCBP      IGETGLDYYRNN-DNKKLQQILFREHIKTSITLKKPLLIHTRNSINDTINILKEENSKQCIVLHSFTEDM
Y454_HAEIN      IGEIGLDYYYSA-DNKAAQQAVFGSQIDIANQLDKPVIIHTRSAGDDTIAMLRQHRAEKGGVIHCFTETM
Y355_BUCAI      LGETGLDYYYSS-DTKKIQQDFFREHIRVAIKLKKPIIVHSRNASEDTIKILQEENAEKKGVLHSFTGDY
Y343_BUCAP      LGETGLDYYYSF-ETKNLQEKFFREHIRIAITLNKPIIIHSRNAIKDTIKILKEENAEKGGILHSFTESE
YJJV_ECOLI      VGEIGLDLFGDDPQ-FERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLKRHDLPRTGVVHGFSGSL
Y009_MYCPN      IGEYGFDYHYT-KDYITXXXXXXXXXXXXXXXYQLVHMLHVRDVHERIYEVLKRLKPKQPVVFHCFSEDT
TATD_ECOLI      IGECGLDFNRSTPEE---QERAFVAQLRIAADLNMPVFMHCRDAHERFMTLLEPLDKLPGAVLHCFTGTR
Y1582_METJA     IGEIGMDIK---DENYKRQEEIFKKFLSLAEELNKPIVVHARGFERKIFDIAKDK---VDIMFHCYSGDV
YNF8_SCHPO      FGEFGLDYDRLHYAPADVQKMYFEEQLKVAVRVQLPLFLHSRNAENDFFAILEKPELPKKGVVHSFTGSI
TATD3_MOUSE     IGEVGLDFYAGTDEEKEEQRQVLIRQVQLAKRLNVPLNVHSRSAGRPTISLLREQGA-EQVLLHAFDGRP
Y081_HAEIN      ----------------------FESQLYLAKQFNLPVNIHSRKTHDQIFTFLKRIPLSKLGVVHGFSGSY
TATD3_BOVIN     IGEVGLD-FSPRFAGTDEQKEEQRQQVQLAKRLNLPLNVHSRSAGRPTISLLNEQGA-DKVLLHAFDGRP
TATD2_HUMAN     FGEMGLDCTTPVPEQHKVFERQLQLAVSLK----KPLVIHCREADEDLLEIMKKFVPPDKIHRHCFTGSY
TATD3_HUMAN     IGEVGLDFFAGTGEQKEEQRQVLIRQIQLAKRLNLPVNVHSRSAGRPTINLLQEQGA-EKVLLHAFDGRP
TAT3A_XENLA     IGEIGLDFLAPTSEQREEQMKVFQMQLEMAKRMDLPVNVHSRSAGRQTVSFLKEQGA-EKVLLHNFAGRP
TATD1_MOUSE     IGECGLDFDRLQFCPKDTQLKYFEKQFELSEQTQLPMFLHCRNSHTEFLDIMRNRDRYVGGVVHSFDGTK
TAT3B_XENLA     IGEVGLD---------------FTPRIACTDQKEEQRNVHSRSAGRPTINLLRDQGA-EKVLLHAFDGKP
TATD1_XENLA     VGECGLDFDRLEFCSKETQLKYFEKQFDLAERSRLPMFLHCRNAHKEFLEIMQ-----------------
TATD1_BOVIN     IGECGLDFDRLQFCSKDTQLKYFEKQFELSEQTKLPMFLHCRNSHAEFLDIMRNRDRCVGGVVHSFDGTK
TATD3_DANRE     IGEIGLDFYSSITQERDEQMKVFIKQLEISKELDLPVNVHSRSSAKVTIATMKELGI-RQALLHNFAGKP
DCUP_MAGSM      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           AMAKLCADRGYYMSFAGNVTFGSAQQLRDXXXXXXXXXXXXXTDAPFLTPKPHRGRPNAPYLIPHTLRAL
YABD_BACSU      EVARECMKMNFYLSFGGPVTFKNAKKPKEVVKEIPNDRLLIETDCPFLTPHPFRGKRNEPSYVKYVAEQI
YCFH_ECOLI      ETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYM
YCFH_ECOL6      ETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYM
YCFH_ECO57      ETAGKLLDLGFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYM
Y017_UREPA      EYAQQYIEMGYYISYPGVITFNQLHELYEAIKITPLDKILVETDAPYLTPVPKRGQTNYPYYVLYTSAFI
Y1786_SYNY3     EETQWFLDLGFYISFSGTVTFKKAEGIQASAQMVPPDRLLVETDCPFLAPVPQRGKRNEPAFVRHVAEAI
Y009_MYCGE      NIAKKLLSLDIFFSIPGIVTFKNAQALHEALKIIPSELLLSETDSPWLTPSPFRGKVNWPEYVVHTVSTV
Y325_BUCBP      HSARILLNMGFYISFSGIVTFKNSKIVHETAKFVPIDRILIETDSPYLSPVPYRGIENQPAYLYDTMLYI
Y454_HAEIN      EFXKKALDLGFYISCSGIVTFKNAEAIREVIRYVPMERLLVETDSPYLAPVPYRGKENQPAYTREVCEYV
Y355_BUCAI      NTACKLLDLGFYISCSGIITFKNSLELCKTIRKIPLNRLLIETDSPYLSPAPYRGKGNQPAYLFYIAEYL
Y343_BUCAP      KSAFELLDMGFYISFSGIITFKKSIELCNTXXXXXXXXXXXXTDSPYLAPIPYRGKKNQPAYLLDIAKKI
YJJV_ECOLI      QQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRPEQAARVFAVL
Y009_MYCPN      NTAKLLTLREVYFSIPGIVTFKNAKNLQAALSVIPTELLLSETDSPYLAPVPFRGKTNWPECVVHTVQTI
TATD_ECOLI      EEMQACVAHGIYIGITGWVDXXXXXXXXXXXXXIPAEKLLIETDAPYLTPKP-SSRRNEPAHLPHILQRI
Y1582_METJA     ELAKEIGKEGHLISISTLVCF--SEHHKKLVESLDLEYLTTETDSPYLS--PIKGTKNEPKNVKLVIEEI
YNF8_SCHPO      DEMRRCIEHGLYVGVNG-----------------------------------------------------
TATD3_MOUSE     SVAMEGVRAGYYFSIPPSIVRSGQKQ--KLVKQLPLSSICLETDSPALGPE--KLTRNEPCNISIAAEFI
Y081_HAEIN      DQAKRFVDLGYKIGVGGTITYERANKTRQAIAKLPLDALVLETDSPDMPVFGFQGQPNRPERIVESFKAL
TATD3_BOVIN     SVAMEGVKAGYFFSIPPSIIRSGQQKL---VKQLPLTSICLETDSPALGPE--KQVRNEPRNISISAEYI
TATD2_HUMAN     PVIEPLLKYFPNMSFTAVLTYSSAWEAREALRQIPLERIIVETDAPYFLP---RQVPKSPGLALHTVREI
TATD3_HUMAN     SVAMEGVRAGYFFSIPPSIIRSGQKQ--KLVKQLPLTSICLETDSPALGPE--KQVRNEPWNISISAEYI
TAT3A_XENLA     SAAQEGVQAGYFFSFPPAVI--RNEQRKKLIKMIPLENICLETDSPSLGPK--KEDRNVPSNIRLSCEYI
TATD1_MOUSE     EAAAALVDLGLYIGFNG-----------------------------------------------------
TAT3B_XENLA     SVAMEGVKAGFYFSIPPSIIRSEQQKL---VKQLPLENMCLETDSPALGPE--KQVRNEPKNILHSAEYI
TATD1_XENLA     ----------------------------------------------------------------------
TATD1_BOVIN     EAAAALMDLGLYIGFNG-----------------------------------------------------
TATD3_DANRE     SVAMEGVQAGFCFSFPPAVS--KNEQRAKLIRQIPLEHVCLETDSPALGLDKHVR--NEPSNVTISCEYI
DCUP_MAGSM      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           AELKGMAEDELAETVAANARRAFALP
YABD_BACSU      AELKEMTFEEIASITTENAKRLFRI-
YCFH_ECOLI      AVLKGVAVEELAQVTTDNFARLF---
YCFH_ECOL6      AVLKGVAVEELAQVTTDNFARLF---
YCFH_ECO57      AVLKGVAVEELAQVTTDNFARLF---
Y017_UREPA      ANLLGITHEKMQKILLENSLR-----
Y1786_SYNY3     AALRHVPLETLAQQTTTNARNLFKLP
Y009_MYCGE      AEIKKIEIAEMKRIIVKNAKKLF---
Y325_BUCBP      AQLKNMSPECFAIQTTKNFLKLFNLP
Y454_HAEIN      ATLKGVSAEAFAQITTQNFERLFKI-
Y355_BUCAI      SILKEIDIHALGHITTSNFRTLF---
Y343_BUCAP      ALIKEISLKELAK-------------
YJJV_ECOLI      CELRREPADEIAQALLNNTYTLFNVP
Y009_MYCPN      ADIKQVPLAEIKQAIVHNAKKLF---
TATD_ECOLI      AHWRGEDAAWLAATTDANVKTLFGI-
Y1582_METJA     AKIKEMEVEEVKDVIYKNTCKFF---
YNF8_SCHPO      --------------------------
TATD3_MOUSE     AQVKGISVEEVREVTTRNAFRLF---
Y081_HAEIN      CTLRNEPAELIKKLTWENACQIFS--
TATD3_BOVIN     AQVKGVSVEEVIEVTTQNALKLF---
TATD2_HUMAN     ARVK---DQPLSLTLAANTSRLYSL-
TATD3_HUMAN     AQVKGISVEEVIEVTTQNALKLF---
TAT3A_XENLA     ASVKGLMPERVREVTTLNALRLF---
TATD1_MOUSE     --------------------------
TAT3B_XENLA     ARVKGISLEEVIEITTKNALKVF---
TATD1_XENLA     --------------------------
TATD1_BOVIN     --------------------------
TATD3_DANRE     AKVKGISSDVVMEVTTQNALRLFS--
DCUP_MAGSM      --------------------------