[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54441.1

[Show Plain Result]


## Summary of Sequence Search
    1::1523
 1080::1284    2e-09  22% 1324 aa  NPHP3_MOUSE RecName: Full=Nephrocystin-3;
 1003::1290    3e-08  20% 1330 aa  NPHP3_HUMAN RecName: Full=Nephrocystin-3;
 1083::1308    2e-07  24% 1404 aa  TIF31_USTMA RecName: Full=Protein TIF31 homolog;
 1094::1230    8e-07  30% 1300 aa  NPHP3_XENLA RecName: Full=Nephrocystin-3;
  261::487     1e-06  24%  540 aa  KLC_CAEEL RecName: Full=Kinesin light chain;         Short=KLC;
  275::414     2e-06  22%  571 aa  KLC_LOLPE RecName: Full=Kinesin light chain;         Short=KLC;
  241::471     3e-06  23%  508 aa  KLC_DROME RecName: Full=Kinesin light chain;         Short=KLC;
 1089::1220    4e-06  26% 1325 aa  TIF31_MALGO RecName: Full=Protein TIF31 homolog;
  159::295     5e-06  32%  843 aa  DRL37_ARATH RecName: Full=Probable disease resistance protein
  195::359     9e-06  29%  622 aa  KLC2_HUMAN RecName: Full=Kinesin light chain 2;         Short=KLC 2;
  194::358     2e-05  29%  599 aa  KLC2_MOUSE RecName: Full=Kinesin light chain 2;         Short=KLC 2;
  270::409     2e-05  21%  686 aa  KLC_STRPU RecName: Full=Kinesin light chain;         Short=KLC;
  285::495     2e-05  27%  560 aa  KLC1_PONAB RecName: Full=Kinesin light chain 1;         Short=KLC 1;
  285::495     2e-05  27%  573 aa  KLC1_HUMAN RecName: Full=Kinesin light chain 1;         Short=KLC 1;
  170::452     4e-05  26% 1372 aa  WRK16_ARATH RecName: Full=Probable WRKY transcription factor
  526::718     4e-05  34% 1244 aa  R1A4_SOLDE RecName: Full=Putative late blight resistance protein
  262::421     4e-05  21%  504 aa  KLC3_PONAB RecName: Full=Kinesin light chain 3;
  262::421     4e-05  21%  504 aa  KLC3_HUMAN RecName: Full=Kinesin light chain 3;AltName: Full=kinesin
  943::1044    5e-05  28% 1211 aa  TIF31_NEUCR RecName: Full=Protein TIF31 homolog;
  266::405     5e-05  22%  619 aa  KLC4_RAT RecName: Full=Kinesin light chain 4;         Short=KLC
  262::464     6e-05  21%  505 aa  KLC3_RAT RecName: Full=Kinesin light chain 3;AltName: Full=Kinesin
  262::416     8e-05  21%  508 aa  KLC3_MOUSE RecName: Full=Kinesin light chain 3;
  285::407     1e-04  25%  560 aa  KLC1_RAT RecName: Full=Kinesin light chain 1;         Short=KLC 1;
  504::649     2e-04  32% 1292 aa  R1C3_SOLDE RecName: Full=Putative late blight resistance protein
  474::619     2e-04  32% 1262 aa  R1B23_SOLDE RecName: Full=Putative late blight resistance protein
  990::1161    2e-04  20% 1320 aa  K0664_DICDI RecName: Full=Protein KIAA0664 homolog;
  538::683     2e-04  29% 1293 aa  R1A_SOLDE RecName: Full=Late blight resistance protein R1-A;       
  179::281     3e-04  36% 1288 aa  WRK52_ARATH RecName: Full=Probable WRKY transcription factor
  266::405     3e-04  21%  619 aa  KLC4_MOUSE RecName: Full=Kinesin light chain 4;         Short=KLC
 1049::1160    4e-04  24% 1242 aa  TIF31_PICST RecName: Full=Protein TIF31 homolog;
  561::736     4e-04  31% 1348 aa  R1B12_SOLDE RecName: Full=Putative late blight resistance protein
  312::350     4e-04  54% 1564 aa  NWD1_HUMAN RecName: Full=NACHT and WD repeat domain-containing
 1145::1266    5e-04  23% 1363 aa  TIF31_CANAL RecName: Full=Protein TIF31 homolog;
  534::709     5e-04  31% 1312 aa  R1B17_SOLDE RecName: Full=Putative late blight resistance protein
  534::709     5e-04  31% 1317 aa  R1B14_SOLDE RecName: Full=Putative late blight resistance protein
   16::161     5e-04  29%  775 aa  R1A3_SOLDE RecName: Full=Putative late blight resistance protein
  533::708     7e-04  31% 1284 aa  R1B16_SOLDE RecName: Full=Putative late blight resistance protein
  540::705     7e-04  31% 1141 aa  R1B13_SOLDE RecName: Full=Putative late blight resistance protein
  263::402     7e-04  21%  616 aa  KLC4_BOVIN RecName: Full=Kinesin light chain 4;         Short=KLC
  260::329     7e-04  31%  505 aa  KLC3_BOVIN RecName: Full=Kinesin light chain 3;
 1206::1335    7e-04  27% 1448 aa  K0664_DROME RecName: Full=Protein KIAA0664 homolog;
 1209::1338    9e-04  27% 1451 aa  K0664_DROYA RecName: Full=Protein KIAA0664 homolog;
 1210::1339    9e-04  27% 1452 aa  K0664_DROER RecName: Full=Protein KIAA0664 homolog;
  217::381     5e-04  28%  571 aa  KLC_LOLPE RecName: Full=Kinesin light chain;         Short=KLC;(query 1253->1417)
  260::329     7e-04  31%  504 aa  KLC3_PONAB RecName: Full=Kinesin light chain 3;(query 1351->1420)
  260::329     7e-04  31%  504 aa  KLC3_HUMAN RecName: Full=Kinesin light chain 3;AltName: Full=kinesin(query 1351->1420)
  262::401     7e-04  20%  505 aa  KLC3_BOVIN RecName: Full=Kinesin light chain 3;(query 1101->1240)
    1::1523

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:700
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxP
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ---------------------------------------------------------------------P
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ---------------------------------------------------------------------P
R1B23_SOLDE     ---------------------------------------------------------------------P
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ---------------------------------------------------------------------P
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ---------------------------------------------------------------------P
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ---------------------------------------------------------------------P
R1B14_SOLDE     ---------------------------------------------------------------------P
R1A3_SOLDE      ---------------------------------------------------------------------P
R1B16_SOLDE     ---------------------------------------------------------------------P
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           PRNALFTGRDDLILRLREQLRSSSEEGRMTPSVLKGMPGIGKTQLATEYLYRFRDEYDLVWWVRGGQTHQ
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     -------GLDTTLEKTWESLRK--DENRMLG--IFGMGGVGKTTLLTLINNKFSDDYDVVIWVESSKDAD
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     -----------------------------------GMPGIGKTTLAKAVFDQMSGEFDAHCFIE-DYTKA
R1A4_SOLDE      RMNEEIVGFKDVIENLRNQLLNGTK-GQDVISI-HGMPGLGKTTLANR-LYSDRSHFDICAQCCVSQVYS
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      RMNEEIVGFEDVIETLRKKLLNGTK-GQDVIS-MHGMPGLGKTTLANR-LYSDRSQFDICAQCCVSQVYS
R1B23_SOLDE     RMNEEIVGFEDVIETLRKKLLNGTK-GQDVIS-MHGMPGLGKTTLANR-LYSDRSQFDICAQCCVSQVYS
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       RMNEEIVGFEDVIENLRKKLLNGTK-GQDVISI-HGMPGLGKTTLANS-LYSDRSVFSQFDICAQCCVSQ
WRK52_ARATH     -----------------------------------GMPGIGKTTLAKAVFDQMSSAFDASCFIE-DYDKS
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     RMNEEIVGFEDVIENLRKKLLNGTK-GQDVISI-HGMPGLGKTTLANR-LYSDRSQFDICAQCCVSQVYS
NWD1_HUMAN      -----FCGRQELLARLGQQLRHDDSK-QHTPLVLFGPPGIGKTAL-------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     RMNEEIVGFKDVIENLRNRLLNGTK-GQDVISI-HGMPGLGKTTLANR-LYSDRSHFDICAQCCVSQVYS
R1B14_SOLDE     RMNEEIVGFKDVIENLRNRLLNGTK-GQDVISI-HGMPGLGKTTLANR-LYSDRSHFDICAQCCVSQVYS
R1A3_SOLDE      RMNEEIVGFEDVIENLRKKLLSETK-GQDVISI-HGMPGLGKTTLANR-LYSDRSQFDICAQCCVSQVYS
R1B16_SOLDE     RMNEEIVGFKDVIENLRNQLLNGTK-GQDAISI-HGMPGLGKTTLANT-LYSDRSQFDICAQCCVSQVYS
R1B13_SOLDE     ----------DVIENLRNRLLNGTK-GQDVISI-HSMPGLGKTTLANR-LYSDRSQFDICAQCCVSQVYS
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           IHEAYTLLAQELDVFRDNTSINSTIHSVREALRRGKPRSRWLLIFDDVRQPDDIMRYLPIAGPGHVIITT
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     VGKIQDAIGERLHICDNNWSTYSKASEISRVLRDMKP--RFVLLLDDLWEDVSLTAIIPVLGKKYVVFTT
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     IQEKGVYCLLEEQFLKENAGASGTVTKL-SLLRDRLNNKRVLVVLDDVRSPLVVESFLDWFGPKSLIIIT
R1A4_SOLDE      YKD--LLLALLCDAIGEG-SVRRELHALADMLRKTLLPRRYLILVDDVWENDDLRGCFPDANRSRIILTT
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      YKD--LLLALLRDAIGEG-SVRTELHALADMLRKTLLPRRYLILVDDVWENDDLSGCFPVNNRSRIILTT
R1B23_SOLDE     YKD--LLLALLRDAIGEG-SVRTELHALADMLRKTLLPRRYLILVDDVWENDDLSGCFPVNNRSRIILTT
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       VYSYKDLILALLRDAIGEGSVRRELHALADMLRKTLLPRRYLILVDDVWENDDLRGCFPVNNRSRIILTT
WRK52_ARATH     IHELYCLLEEQLLPGNDATIMK--LSSLRDRLN----SKRVLVVLDDVRNAESFLEGFDWLGPGSLIIIT
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     YKE--LLLALLCDVGEDSARRELPDNELADMFRKTLLPRRYLILVDDVWENDDLRGCFPVNNRSRIILTT
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     YKE--LLLALLCDAVGDDSARRKNENKLADKLRKTLLSRRYLILVDDVWDNDDLRGCFPDANRSRIILTT
R1B14_SOLDE     YKE--LLLALLCDAVGDDSARRKNENKLADKLRKTLLSRRYLILVDDVWDNDDLRGCFPDANRSRIILTT
R1A3_SOLDE      YKDLLLSLLRDA-IGDESGSRELPDNELADMLRKTLLPRRYLILVDDVWDNDDLRGCFPVNNRSRIILTT
R1B16_SOLDE     YKD--LLLALLCDVGEDSDRRELPDNELADMLRKTLLPRRYLILVDDVWDNDDLRGCFPVNNRSRIILTT
R1B13_SOLDE     YKE--LLLALLCDAIGEGSDQHREIHALADMLRKTLLPRRYLILVDDVWENDDLRGCFPVNNRSRIILTT
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           RNLTWPEGGYFKTLPVEVFSLQESVALLSKCGLVGFSKHXXXXXXXXXGHMPIALRQAAAWMNDSATTIA
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     RS--------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     SNQIYEVQGLNEKEALQLFSLCASIDDMAEQNLHEVS---MKVIKYANGH-PLALNLYGRELMGKKRPPE
R1A4_SOLDE      RHRMFDEDESWKLLEKKVFGEQSCSPLLKKVGL-------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      RH--------------------------------------------------------------------
R1B23_SOLDE     RH--------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       RH--------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     RHVAKYASVHSDPLHLRMFGEDESWKLLEK----------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     RHVAKYASVHSDPLHLRMFDEDESWKLLEK----------------------------------------
R1B14_SOLDE     RHVAKYASVHSDPLHLRMFDEDESWKLLEK----------------------------------------
R1A3_SOLDE      RH--------------------------------------------------------------------
R1B16_SOLDE     RHVAKYASVHSDPLHLRMFDKDESWKLLEK----------------------------------------
R1B13_SOLDE     RHVAKYASVHSEPLHLRMFEEDESWKLLEK----------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           EYLEFYRDKQAQLAPMFAPADPDYPETVITALNVSLDRLAVTNPAALQLLQVCSFFSTAPIPRSLFRHAQ
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     MEIAFLKLKECPPAIFVDAIKSSYDTLNDREKNIFLDIACFFQDYVMQLLEGCGFFPHVGI---------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           DVXXXXXXXXXXQEPNKLHRAFSDIGRYGLAVLNHRTRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     ----------------------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     DVLVEKSLVTISENRVRMHNLIQDVGR---QIINRETR--------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLQEIYVTDLRGEHSDSKQLAEATLSVWRE
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     -------------------------------------------------------NAEQLYKQALEISEN
TIF31_USTMA     --------------------------------------------------RGDRXXXXXXXXXXVSFHEQ
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       --------------------------------------------------QNKYKEAANLLNEALSIREK
KLC_LOLPE       --------------------------------------------------QGKYKEAANLLNDALGIREK
KLC_DROME       --------------------------------------------------QNKYKEAANLLNDALSIRGK
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       --------------------------------------------------QNKYKEAGNLLHDALAIREK
KLC1_PONAB      --------------------------------------------------------------------RE
KLC1_HUMAN      --------------------------------------------------------------------RE
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      --------------------------------------------------QNKYKEATDLLHDALQIREQ
KLC3_HUMAN      --------------------------------------------------QNKYKEATDLLHDALQIREQ
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        --------------------------------------------------QNKYKEAAHLLNDALSIRES
KLC3_RAT        --------------------------------------------------QNKYKEATELLHDALQIREQ
KLC3_MOUSE      --------------------------------------------------QNKYKEATELLHDALQIREQ
KLC1_RAT        --------------------------------------------------------------------RE
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      --------------------------------------------------QNKYKEAAHLLNDALSIRES
TIF31_PICST     -------------------------------------------------------NSVSLYNQAVATWTS
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     -----------------------------------------MNSAYYESSNEQYLNSLKLYKEAMNTWSL
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      --------------------------------------------------QNKYKEAALLLNDALSIRES
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      --------------------------------------------------QNKYKEATDLLHDALQIREQ


                         .         .         +         .         .         .         .:1190
query           KLGKTAPETLRAELYLVRALRNLGERKRAYELCERVLRILTEQHGPDSEEALEASLEFVRDLRYAGRFHD
NPHP3_MOUSE     ----------------------------------------------------------------------
NPHP3_HUMAN     AYGADHPYTARE----LEALATLYQKQNKYEQAEHFRKKSFKIHQ--------------KAIKKKGNLYG
TIF31_USTMA     VYGLVHPEVARCYALFATIVHHLAG-VAAMERAESI-----NQAKSENKEITEADLPVVNELSMA----N
NPHP3_XENLA     ----------------------------------------------------------------------
KLC_CAEEL       CLGESHPXXXXXXXXXXXXFGKRGKFKDAEPLCKRALEIREKVLGDDHPDVAKXXXXXXXXXXXXGKYEE
KLC_LOLPE       TLGPDHPXXXXXXXXXXXXYGKRGKYKDAEPLCKRALVIREKVLGKDHPDVAKXXXXXXXXXXXXGKYEE
KLC_DROME       TLGENHPXXXXXXXXXXXXYGKRGKYKDAEPLCKRALEIREKVLGKDHPDVAKXXXXXXXXXXXXGKYDE
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      ----------------------------------------------------------------------
KLC2_MOUSE      ----------------------------------------------------------------------
KLC_STRPU       TLGPDHPXXXXXXXXXXXXYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKXXXXXXXXXXXXGKYEE
KLC1_PONAB      KLGKDHPXXXXXXXXXXXXYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKXXXXXXXXXXXXGKYEE
KLC1_HUMAN      KLGKDHPXXXXXXXXXXXXYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKXXXXXXXXXXXXGKYEE
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      TLGPEHPXXXXXXXXXXXXYGKRGRYREAEPLCQRALEIREKVLGADHPDVAKXXXXXXXXXXXXGKFED
KLC3_HUMAN      TLGPEHPXXXXXXXXXXXXYGKRGRYREAEPLCQRALEIREKVLGADHPDVAKXXXXXXXXXXXXGKFED
TIF31_NEUCR     --GLVHPEVAQMYHTLSQLYYQLGQKDAAVELSRKAAIVAERTVGLDSSETVLNYLNLSLFLHQRGDSKE
KLC4_RAT        TLGRDHPXXXXXXXXXXXXYGKRGKYKEAEPLCQRALEIREKVLGTDHPDVAKXXXXXXXXXXXXGKYEA
KLC3_RAT        TLGPEHPXXXXXXXXXXXXYGKRGRYREAEPLCQRALEIREKVLGADHPDVAKXXXXXXXXXXXXGKFQD
KLC3_MOUSE      TLGPEHPXXXXXXXXXXXXYGKRGRYREAEPLCQRALEIREKVLGADHPDVAKXXXXXXXXXXXXGKFQD
KLC1_RAT        KLGRDHPXXXXXXXXXXXXYGKRGKYKEAEPLCKRALEIREKVLGKDHPDVAKXXXXXXXXXXXXGKYEE
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      TLGRDHPXXXXXXXXXXXXYGKRGKYKEAEPLCQRALEIREKVLGTDHPDVAKXXXXXXXXXXXXGKYEA
TIF31_PICST     VYGKGHPTLINTLTNIAENYSRASQNESAIKLLESALEFSKLANGEVSEITGIVTFRLANCLINTSKFDQ
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     VYGKDHPTLINTLTNLSESLLKIKAYDSALELLQEALEITKKLNGEISEITGFIYYRIANIVVTLNKFKE
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      TLGRDHPXXXXXXXXXXXXYGKRGKYKEAEPLCQRALEIREKVLGTNHPDVAKXXXXXXXXXXXXGKYEA
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      TLGPEHPXXXXXXXXXXXXYGKRGRYREAEPLCQRALEIREKVLGADHPDVAKXXXXXXXXXXXXGKFEE


                         *         .         .         .         .         +         .:1260
query           SVELARDTRDRYRRILGPDDPETISASHVYAYALLLAGDHRRAADLFWEIYQTNEMILGPNNPSTLAAVD
NPHP3_MOUSE     ----------------GKDKPENARTLNELGVLYFLQNNLETAEQFLKRSLEMRERVLGPDHPDCAQSLN
NPHP3_HUMAN     FXXXXXXXXXXXXXXXGKDTPDNARTLNELGVLYYLQNNLETADQFLKRSLEMRERVLGPDHPDCAQSLN
TIF31_USTMA     AVRYQRQAVTVSERTLGLDHPETLNQYMNLAVLERSAGNTRESLLCQRRVLELWSLLHGQHHPDCINALS
NPHP3_XENLA     ---------------------------------------------------EMRERVLGADHPDCAQSIN
KLC_CAEEL       VEKYYKRALEIYESKLGPDDPNVAKTKNNLSSAYLKQGKYKEAEELYKQILTRAHQISGENKPIWQIAEE
KLC_LOLPE       VERYYQRALEIYQKELGPDDPNVAKTKNNLASAYLKQGKYKQAEILYKEV--------------------
KLC_DROME       VEKYYQRALDIYESKLGPDDPNVAKTKNNLAGCYLKQGRYTEAEILY-------KQVLTRAHEREFGAID
TIF31_MALGO     -------------RTLGLDHPETMTQYMNLAMMEQSSANLDDALRYQERVMQLWQLLYGRDHPDVVHTLS
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      --------------------------------------------------------------PARLRTLH
KLC2_MOUSE      --------------------------------------------------------------PARLRTLH
KLC_STRPU       VEWYYQRALEIYEKKLGPDDPNVAKTKNNLAAAYLKQGKYKAAETLYKQV--------------------
KLC1_PONAB      VEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILRAHEREFGENKPIWMHAEE
KLC1_HUMAN      VEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEILRAHEREFGENKPIWMHAEE
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      VERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEILHKEDLPAPLGAPNTGTAGD
KLC3_HUMAN      VERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEILHKEDLPAPLGAPNTGTAGD
TIF31_NEUCR     ALLYARHALDLWKVIYGPDHPDTITTMNNYAVML------------------------------------
KLC4_RAT        VERYYQRALAIYERQLGPDNPNVARTKNNLASCYLKQGKYSEAETLYKEI--------------------
KLC3_RAT        VERHYARALSIYEALGGPQDPNVAKTKNNLASAYLKQNKYQQAEELYKEILSQEALPAPLGAPQGGTAGE
KLC3_MOUSE      VERHYARALSIYEALGGPQDPNVAKTKNNLASAYLKQNKYQQAEELYKEILSQEAL------PAPLGAPQ
KLC1_RAT        VEYYYQRALEIYQTKLGPDDPNVAKTKNNLASCYLKQGKFKQAETLYKEI--------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     ----------------------------------------------------------GPIHPDAGACFT
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      VERYYQRALAIYESQLGPDNPNVARTKNNLASCYLKQGKYSEAEALYKEI--------------------
TIF31_PICST     SLELYRACEATFEKVLGPDDALTKQAS-------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     SKELFDKAYDIFMKLLGPDDSMT-----------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      VERYYRRALAIYEGQLGPDNPNVARTKNNLASCYLKQGKYAEAETLYKEI--------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       --------------------------------------------------------------PARLRTLH
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      VERHYARALSIYEALGGPHDPNVAKTKNNLASAYLKQNKYQQAEELYKEI--------------------


                         .         .         .         *         .         .         .:1330
query           GYAGSLMEAGDYFKALRYQEDNTERIYSLFGINHRGTLENMAALAAVLRRTGNLERAVKISGEVWRETKD
NPHP3_MOUSE     NLAALCNEKKQYEKAEELYERALDIRRRALAPDHPSLAYTVKHLAILYKKTGKVDKAVPLYELAVEIRQK
NPHP3_HUMAN     NLAALCNEKKQYDKAEELYERALDIRRRALAPDHPSLAYTVKHLAILYKKMGKLDKAVPLYELAVEIRQK
TIF31_USTMA     NVALTLQNARLFEASLRVYRSAHELALTLFGADSIHTANLAHELSQAYTLAGDLKTALAVEKEAWRVFEE
NPHP3_XENLA     NLAALYNEKKQYDKAEELYERALDIRRRALSPDHPSLAYTVKHLAVLYKRKGKLDKAVPL----------
KLC_CAEEL       GEGATANEQAGWAKAAKVDSPTVTT-----------TLKNLGAL---YRRQGKYEAAETLEDVALRAKK-
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       SKNKPIWQVAE--EREEHKFDNRENTYGEYGGWHKATLKNLGAL---YRRQGMFEAAETLEDCAMRSKKE
TIF31_MALGO     SIALMLQMRQDYEPSLRAYEASHDLAVRLFGPNSIYTGNMAHELSQALILSGDLKAAIQVEKEAWRIFQE
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      NLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKEAAHLLNDALAIREK
KLC2_MOUSE      NLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQNKYKDAAHLLNDALAIREK
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      REGTSFGEYGGWYKACKVDSPTVTT-----------TLKNLGAL---YRRQGKFEAAETLEEAAMRSRK-
KLC1_HUMAN      REGTSFGEYGGWYKACKVDSPTVTT-----------TLKNLGAL---YRRQGKFEAAETLEEAAMRSRK-
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        AQQQVLRRSSSFSKLRESIRRGSEKLVSRL----RG--ESMAGAAGMKR---------------------
KLC3_MOUSE      G---------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     HLAMLAYQNEQYDLAIEYQKNALVITEKTAGLDHHETVQAYTTLAVFCQRSGRYNESIGYMKHVLYLTDL
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------
K0664_DROME     ----------------------------------------------------------------------
K0664_DROYA     ----------------------------------------------------------------------
K0664_DROER     ----------------------------------------------------------------------
KLC_LOLPE       NLVIQYASQGRYEVAVPLCKQALEDLEKTSGHDHPDVATMLNILALVYRDQGKYKEAANLLNDALGIREK
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         +         .         .         .         .         *:1400
query           RFGEDSMIXXXXXXXXXXXLRSVNRYHEALDLVEKAYRRCAELLGEDHPHVAAINVNRAVVLRQMGRTEE
NPHP3_MOUSE     SFGPKHPSVATALVNLAVLHSQMKKHSEALPLYERALKIYEDSLGRMHPRVGETLKNLAVLSYEEGNFEK
NPHP3_HUMAN     SFGPKHPSVATALVNLAVLYSQMKKHVEALPLYERALKIYEDSLGRMHPRVGETLKNLAVLSYEGGDFEK
TIF31_USTMA     RLGKD-----------------------------------------------------------------
NPHP3_XENLA     -------------------------YELAVDIRQKSF-------GPKHPSVATALVNLAVLYCQMKKQDD
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       AY--------------------------------------------------------------------
TIF31_MALGO     RLGSE-----------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      TLGKDHPXXXXXXXXXXXXYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEE
KLC2_MOUSE      TLGKDHPXXXXXXXXXXXXYGKRGKYKEAEPLCKRALEIREKVLGKFHPDVAKQLSNLALLCQNQGKAEE
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     LGGEYNPERASIYTAIAAILEDTERFDLALEFLKQTLKHQEFLFTPDHLMCSTTYHKMAIVCARATNFDD
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      --------------------RDQNKYKEATDLLHDALQIREQTLGPEHPXXXXXXXXXXXXYGKRGRYRE
K0664_DROME     ----------------------------SLKLLYRARYLMVLICGEDHPEVALIDSNISLILHALGEYEL
K0664_DROYA     ----------------------------SLKLLYRARYLMVLICGEDHPEVALIDSNISLILHALGEYEL
K0664_DROER     ----------------------------SLKLLYRARYLMVLICGEDHPEVALIDSNISLILHALGEYEL
KLC_LOLPE       TLGPDHPXXXXXXXXXXXXYGKRGKYKDAEPLCKRALVIREKVLGKDHPDVAKXXXXXXXXXXXXGKYEE
KLC3_PONAB      --------------------RDQNKYKEATDLLHDALQIREQTLGPEHPXXXXXXXXXXXXYGKRGRYRE
KLC3_HUMAN      --------------------RDQNKYKEATDLLHDALQIREQTLGPEHPXXXXXXXXXXXXYGKRGRYRE
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:1470
query           ARVIDERALQVLTDRLGEYHXXXXXXXXXXXXDFFGLDDVAESVRRDTETLARCRRALSERHPLTLLARR
NPHP3_MOUSE     AAELYKRAMEI-----------------------------------------------------------
NPHP3_HUMAN     AAELYKRAMEI-----------------------------------------------------------
TIF31_USTMA     ----------------------------------------------------------------------
NPHP3_XENLA     ALPLYERAMKIYEDSLGRMH--------------------------------------------------
KLC_CAEEL       ----------------------------------------------------------------------
KLC_LOLPE       ----------------------------------------------------------------------
KLC_DROME       ----------------------------------------------------------------------
TIF31_MALGO     ----------------------------------------------------------------------
DRL37_ARATH     ----------------------------------------------------------------------
KLC2_HUMAN      VEYYYRRALEIYATRLG-----------------------------------------------------
KLC2_MOUSE      VEYYYRRALEIYATRLG-----------------------------------------------------
KLC_STRPU       ----------------------------------------------------------------------
KLC1_PONAB      ----------------------------------------------------------------------
KLC1_HUMAN      ----------------------------------------------------------------------
WRK16_ARATH     ----------------------------------------------------------------------
R1A4_SOLDE      ----------------------------------------------------------------------
KLC3_PONAB      ----------------------------------------------------------------------
KLC3_HUMAN      ----------------------------------------------------------------------
TIF31_NEUCR     ----------------------------------------------------------------------
KLC4_RAT        ----------------------------------------------------------------------
KLC3_RAT        ----------------------------------------------------------------------
KLC3_MOUSE      ----------------------------------------------------------------------
KLC1_RAT        ----------------------------------------------------------------------
R1C3_SOLDE      ----------------------------------------------------------------------
R1B23_SOLDE     ----------------------------------------------------------------------
K0664_DICDI     SIIHQKKSTDILEKELGEAH--------------------------------------------------
R1A_SOLDE       ----------------------------------------------------------------------
WRK52_ARATH     ----------------------------------------------------------------------
KLC4_MOUSE      ----------------------------------------------------------------------
TIF31_PICST     ----------------------------------------------------------------------
R1B12_SOLDE     ----------------------------------------------------------------------
NWD1_HUMAN      ----------------------------------------------------------------------
TIF31_CANAL     ----------------------------------------------------------------------
R1B17_SOLDE     ----------------------------------------------------------------------
R1B14_SOLDE     ----------------------------------------------------------------------
R1A3_SOLDE      ----------------------------------------------------------------------
R1B16_SOLDE     ----------------------------------------------------------------------
R1B13_SOLDE     ----------------------------------------------------------------------
KLC4_BOVIN      ----------------------------------------------------------------------
KLC3_BOVIN      AEPLCQRALEIREKVLGADH--------------------------------------------------
K0664_DROME     SLRFIEHALKLNLKYFGDKDMHVALSYHLMARTQSCMGDFRSALNNEKETYSFYKSQLGENHELRLLTQQ
K0664_DROYA     SLRFIEHALKLNLKYFGDKAMPVALSYHLMARTQSCMGDFRSALNNEKETYSFYKSQLGENHELRLLTQQ
K0664_DROER     SLRFIEHALKLNLKYFGDKAMPVALSYHLMARTQSCMGDFRSALNNEKETYSFYKSQLGENHELRLLTQQ
KLC_LOLPE       VERYYQRALEIYQKELG-----------------------------------------------------
KLC3_PONAB      AEPLCQRALEIREKVLGADH--------------------------------------------------
KLC3_HUMAN      AEPLCQRALEIREKVLGADH--------------------------------------------------
KLC3_BOVIN      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:1540
query           NLVLGRKAMNExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NPHP3_MOUSE     -----------------------------------------------------
NPHP3_HUMAN     -----------------------------------------------------
TIF31_USTMA     -----------------------------------------------------
NPHP3_XENLA     -----------------------------------------------------
KLC_CAEEL       -----------------------------------------------------
KLC_LOLPE       -----------------------------------------------------
KLC_DROME       -----------------------------------------------------
TIF31_MALGO     -----------------------------------------------------
DRL37_ARATH     -----------------------------------------------------
KLC2_HUMAN      -----------------------------------------------------
KLC2_MOUSE      -----------------------------------------------------
KLC_STRPU       -----------------------------------------------------
KLC1_PONAB      -----------------------------------------------------
KLC1_HUMAN      -----------------------------------------------------
WRK16_ARATH     -----------------------------------------------------
R1A4_SOLDE      -----------------------------------------------------
KLC3_PONAB      -----------------------------------------------------
KLC3_HUMAN      -----------------------------------------------------
TIF31_NEUCR     -----------------------------------------------------
KLC4_RAT        -----------------------------------------------------
KLC3_RAT        -----------------------------------------------------
KLC3_MOUSE      -----------------------------------------------------
KLC1_RAT        -----------------------------------------------------
R1C3_SOLDE      -----------------------------------------------------
R1B23_SOLDE     -----------------------------------------------------
K0664_DICDI     -----------------------------------------------------
R1A_SOLDE       -----------------------------------------------------
WRK52_ARATH     -----------------------------------------------------
KLC4_MOUSE      -----------------------------------------------------
TIF31_PICST     -----------------------------------------------------
R1B12_SOLDE     -----------------------------------------------------
NWD1_HUMAN      -----------------------------------------------------
TIF31_CANAL     -----------------------------------------------------
R1B17_SOLDE     -----------------------------------------------------
R1B14_SOLDE     -----------------------------------------------------
R1A3_SOLDE      -----------------------------------------------------
R1B16_SOLDE     -----------------------------------------------------
R1B13_SOLDE     -----------------------------------------------------
KLC4_BOVIN      -----------------------------------------------------
KLC3_BOVIN      -----------------------------------------------------
K0664_DROME     AVLLQRK-MND------------------------------------------
K0664_DROYA     AVLLQRK-MND------------------------------------------
K0664_DROER     AVLLQRK-MND------------------------------------------
KLC_LOLPE       -----------------------------------------------------
KLC3_PONAB      -----------------------------------------------------
KLC3_HUMAN      -----------------------------------------------------
KLC3_BOVIN      -----------------------------------------------------