[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54462.1

[Show Plain Result]


## Summary of Sequence Search
    1::1210
   61::1202      0.0  56% 1234 aa  MFD_MYCTU RecName: Full=Transcription-repair-coupling factor;        
   61::1202      0.0  56% 1234 aa  MFD_MYCBO RecName: Full=Transcription-repair-coupling factor;        
   36::231       0.0  45% 1177 aa  MFD_BACSU RecName: Full=Transcription-repair-coupling factor;        
   27::1091    e-180  38% 1168 aa  MFD_STAAB RecName: Full=Transcription-repair-coupling factor;        
   27::1091    e-180  38% 1168 aa  MFD_STAAW RecName: Full=Transcription-repair-coupling factor;        
   27::1091    e-180  38% 1168 aa  MFD_STAAS RecName: Full=Transcription-repair-coupling factor;        
   27::1091    e-180  38% 1168 aa  MFD_STAA8 RecName: Full=Transcription-repair-coupling factor;        
   27::1091    e-180  38% 1168 aa  MFD_STAA3 RecName: Full=Transcription-repair-coupling factor;        
   27::1091    e-180  38% 1168 aa  MFD_STAAN RecName: Full=Transcription-repair-coupling factor;        
   27::1091    e-180  38% 1168 aa  MFD_STAAM RecName: Full=Transcription-repair-coupling factor;        
   27::1091    e-179  38% 1168 aa  MFD_STAAR RecName: Full=Transcription-repair-coupling factor;        
   38::1102    e-176  37% 1170 aa  MFD_STAS1 RecName: Full=Transcription-repair-coupling factor;        
   23::1101    e-175  37% 1169 aa  MFD_STAHJ RecName: Full=Transcription-repair-coupling factor;        
   68::1092    e-174  37% 1146 aa  MFD_HAEIN RecName: Full=Transcription-repair-coupling factor;        
  141::212     e-174  44% 1169 aa  MFD_STAES RecName: Full=Transcription-repair-coupling factor;        
  141::212     e-173  44% 1169 aa  MFD_STAEQ RecName: Full=Transcription-repair-coupling factor;        
   62::255     e-171  44% 1199 aa  MFD_SYNY3 RecName: Full=Transcription-repair-coupling factor;        
   27::211     e-170  41% 1168 aa  MFD_STAAC RecName: Full=Transcription-repair-coupling factor;        
   98::259     e-167  46% 1201 aa  MFD_MYXXA RecName: Full=Transcription-repair-coupling factor;        
   28::205     e-162  42% 1148 aa  MFD_ECOLI RecName: Full=Transcription-repair-coupling factor;        
  121::213     e-135  39% 1125 aa  MFD_BORBU RecName: Full=Transcription-repair-coupling factor;        
  148::740     e-134  42%  812 aa  MFD_BUCAI RecName: Full=Transcription-repair-coupling factor;        
   31::206     e-125  37% 1142 aa  MFD_RICFE RecName: Full=Transcription-repair-coupling factor;        
   30::205     e-124  37% 1120 aa  MFD_RICBR RecName: Full=Transcription-repair-coupling factor;        
  458::1048    e-124  40% 1122 aa  MFD_RICCN RecName: Full=Transcription-repair-coupling factor;        
  116::182     e-119  40% 1001 aa  MFD_HELPJ RecName: Full=Transcription-repair-coupling factor;        
   26::621     e-119  42%  697 aa  MFD_BUCBP RecName: Full=Transcription-repair-coupling factor;        
  116::182     e-118  38%  999 aa  MFD_HELPY RecName: Full=Transcription-repair-coupling factor;        
  459::1046    e-117  39% 1120 aa  MFD_RICPR RecName: Full=Transcription-repair-coupling factor;        
  459::1046    e-117  40% 1120 aa  MFD_RICTY RecName: Full=Transcription-repair-coupling factor;        
  258::631     2e-66  37%  686 aa  RECG_BORBU RecName: Full=ATP-dependent DNA helicase recG;       
  237::619     1e-63  38%  671 aa  RECG_STRPN RecName: Full=ATP-dependent DNA helicase recG;       
  253::642     9e-63  37%  693 aa  RECG_PASMU RecName: Full=ATP-dependent DNA helicase recG;       
  260::649     6e-61  37%  686 aa  RECG_TREPA RecName: Full=ATP-dependent DNA helicase recG;       
  371::774     6e-61  35%  831 aa  RECG_SYNY3 RecName: Full=ATP-dependent DNA helicase recG;       
  346::733     4e-59  37%  792 aa  RECG_AQUAE RecName: Full=ATP-dependent DNA helicase recG;       
  253::642     8e-59  37%  693 aa  RECG_HAEIN RecName: Full=ATP-dependent DNA helicase recG;       
  247::643     1e-58  38%  693 aa  RECG_ECOLI RecName: Full=ATP-dependent DNA helicase recG;       
  266::643     9e-57  38%  693 aa  RECG_ECO57 RecName: Full=ATP-dependent DNA helicase recG;       
  251::628     2e-53  33%  682 aa  RECG_STAES RecName: Full=ATP-dependent DNA helicase recG;       
  251::628     2e-53  34%  682 aa  RECG_STAEQ RecName: Full=ATP-dependent DNA helicase recG;       
  252::671     6e-53  34%  682 aa  RECG_BACSU RecName: Full=ATP-dependent DNA helicase recG;       
  259::632     8e-51  32%  686 aa  RECG_STAAW RecName: Full=ATP-dependent DNA helicase recG;       
  259::632     8e-51  32%  686 aa  RECG_STAAS RecName: Full=ATP-dependent DNA helicase recG;       
  259::632     8e-51  32%  686 aa  RECG_STAAN RecName: Full=ATP-dependent DNA helicase recG;       
  259::632     8e-51  32%  686 aa  RECG_STAAM RecName: Full=ATP-dependent DNA helicase recG;       
  259::632     6e-50  32%  686 aa  RECG_STAAR RecName: Full=ATP-dependent DNA helicase recG;       
  279::683     5e-48  37%  743 aa  RECG_MYCLE RecName: Full=ATP-dependent DNA helicase recG;       
  259::632     1e-47  31%  686 aa  RECG_STAAC RecName: Full=ATP-dependent DNA helicase recG;       
  259::632     1e-47  31%  686 aa  RECG_STAA8 RecName: Full=ATP-dependent DNA helicase recG;       
  254::682     1e-46  35%  737 aa  RECG_MYCTU RecName: Full=ATP-dependent DNA helicase recG;       
  254::682     1e-46  35%  737 aa  RECG_MYCBO RecName: Full=ATP-dependent DNA helicase recG;       
  227::589     2e-31  29%  623 aa  RECG_HELPJ RecName: Full=ATP-dependent DNA helicase recG;       
  227::589     2e-31  30%  623 aa  RECG_HELPY RecName: Full=ATP-dependent DNA helicase recG;       
  275::451     2e-18  35%  652 aa  RECG_THIFE RecName: Full=ATP-dependent DNA helicase recG;       
   57::223     2e-14  35%  700 aa  UVRB_GEMAT RecName: Full=UvrABC system protein B;       
   67::232     3e-14  37%  698 aa  UVRB_BEUC1 RecName: Full=UvrABC system protein B;       
   67::232     6e-14  35%  712 aa  UVRB_STRCO RecName: Full=UvrABC system protein B;       
   49::592     1e-13  32%  664 aa  UVRB_GEOSL RecName: Full=UvrABC system protein B;       
   71::252     2e-13  28%  683 aa  UVRB_NATPD RecName: Full=UvrABC system protein B;       
   72::237     2e-13  32%  689 aa  UVRB_HALSA RecName: Full=UvrABC system protein B;       
  229::528     3e-13  30%  808 aa  Y1401_METJA RecName: Full=Probable ATP-dependent helicase MJ1401;  
   67::232     3e-13  33%  693 aa  UVRB_RENSM RecName: Full=UvrABC system protein B;       
   63::597     5e-13  28%  665 aa  UVRB_ENTFA RecName: Full=UvrABC system protein B;       
   63::235     1e-12  31%  692 aa  UVRB_LACLS RecName: Full=UvrABC system protein B;       
   63::235     1e-12  31%  692 aa  UVRB_LACLM RecName: Full=UvrABC system protein B;       
   63::235     1e-12  31%  692 aa  UVRB_LACLA RecName: Full=UvrABC system protein B;       
   12::221     1e-12  29%  664 aa  UVRB_CHLAD RecName: Full=UvrABC system protein B;       
   57::657     2e-12  29%  657 aa  UVRB_CLONN RecName: Full=UvrABC system protein B;       
   55::236     2e-12  30%  662 aa  UVRB_CLOB6 RecName: Full=UvrABC system protein B;       
    9::553     2e-12  31%  658 aa  UVRB_BACHK RecName: Full=UvrABC system protein B;       
    9::553     2e-12  31%  658 aa  UVRB_BACCZ RecName: Full=UvrABC system protein B;       
    9::553     2e-12  31%  658 aa  UVRB_BACCR RecName: Full=UvrABC system protein B;       
    9::553     2e-12  31%  658 aa  UVRB_BACC1 RecName: Full=UvrABC system protein B;       
    9::553     2e-12  31%  658 aa  UVRB_BACAN RecName: Full=UvrABC system protein B;       
   63::597     2e-12  28%  663 aa  UVRB_STRS7 RecName: Full=UvrABC system protein B;       
   63::642     2e-12  27%  661 aa  UVRB_STRS2 RecName: Full=UvrABC system protein B;       
   63::597     2e-12  28%  663 aa  UVRB_STREM RecName: Full=UvrABC system protein B;       
   63::230     2e-12  31%  663 aa  UVRB_STRA5 RecName: Full=UvrABC system protein B;       
   63::230     2e-12  31%  663 aa  UVRB_STRA3 RecName: Full=UvrABC system protein B;       
   63::230     2e-12  31%  663 aa  UVRB_STRA1 RecName: Full=UvrABC system protein B;       
   58::225     2e-12  32%  658 aa  UVRB_LISMO RecName: Full=UvrABC system protein B;       
   58::225     2e-12  32%  658 aa  UVRB_LISMF RecName: Full=UvrABC system protein B;       
   58::225     2e-12  32%  658 aa  UVRB_LISIN RecName: Full=UvrABC system protein B;       
   63::597     3e-12  28%  663 aa  UVRB_STRE4 RecName: Full=UvrABC system protein B;       
   67::232     3e-12  33%  701 aa  UVRB_PROAC RecName: Full=UvrABC system protein B;       
   57::236     3e-12  30%  662 aa  UVRB_CLOBM RecName: Full=UvrABC system protein B;       
   57::236     4e-12  30%  662 aa  UVRB_CLOBL RecName: Full=UvrABC system protein B;       
   57::236     4e-12  30%  662 aa  UVRB_CLOBK RecName: Full=UvrABC system protein B;       
   57::236     4e-12  30%  662 aa  UVRB_CLOBJ RecName: Full=UvrABC system protein B;       
   57::236     4e-12  30%  662 aa  UVRB_CLOB1 RecName: Full=UvrABC system protein B;       
   56::224     5e-12  29%  666 aa  UVRB_SYNP6 RecName: Full=UvrABC system protein B;       
   56::224     5e-12  29%  666 aa  UVRB_SYNE7 RecName: Full=UvrABC system protein B;       
   63::587     5e-12  30%  663 aa  UVRB_STRU0 RecName: Full=UvrABC system protein B;       
   63::548     5e-12  29%  667 aa  UVRB_LACPL RecName: Full=UvrABC system protein B;       
   58::554     5e-12  28%  658 aa  UVRB_GEOKA RecName: Full=UvrABC system protein B;       
   19::224     7e-12  30%  679 aa  UVRB_PROM3 RecName: Full=UvrABC system protein B;       
   72::237     7e-12  31%  686 aa  UVRB_HALMA RecName: Full=UvrABC system protein B;       
   59::227     9e-12  31%  661 aa  UVRB_STAES RecName: Full=UvrABC system protein B;       
   59::227     9e-12  31%  661 aa  UVRB_STAEQ RecName: Full=UvrABC system protein B;       
   59::226     9e-12  32%  682 aa  UVRB_DESDG RecName: Full=UvrABC system protein B;       
   58::225     1e-11  32%  680 aa  UVRB_DESVM RecName: Full=UvrABC system protein B;       
   57::226     1e-11  31%  661 aa  UVRB_CLOTE RecName: Full=UvrABC system protein B;       
   58::225     1e-11  30%  661 aa  UVRB_BACA2 RecName: Full=UvrABC system protein B;       
   57::228     2e-11  31%  657 aa  UVRB_CLOBB RecName: Full=UvrABC system protein B;       
   57::228     2e-11  31%  657 aa  UVRB_CLOBA RecName: Full=UvrABC system protein B;       
   58::225     2e-11  31%  661 aa  UVRB_BACLD RecName: Full=UvrABC system protein B;       
   67::233     2e-11  32%  704 aa  UVRB_ARTCA RecName: Full=UvrABC system protein B;       
   23::227     2e-11  29%  663 aa  UVRB_AQUAE RecName: Full=UvrABC system protein B;       
   58::226     2e-11  30%  660 aa  UVRB_STAS1 RecName: Full=UvrABC system protein B;       
   59::227     2e-11  31%  661 aa  UVRB_STAHJ RecName: Full=UvrABC system protein B;       
   65::230     2e-11  31%  703 aa  UVRB_BIFLI RecName: Full=UvrABC system protein B;       
   63::242     3e-11  29%  662 aa  UVRB_STRSV RecName: Full=UvrABC system protein B;       
   63::242     3e-11  29%  662 aa  UVRB_STRGC RecName: Full=UvrABC system protein B;       
   67::233     3e-11  32%  709 aa  UVRB_MICLC RecName: Full=UvrABC system protein B;       
   63::229     3e-11  29%  671 aa  UVRB_LACJO RecName: Full=UvrABC system protein B;       
   58::225     3e-11  30%  661 aa  UVRB_BACSU RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRZT RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRZP RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRZJ RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRR6 RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRPS RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRPN RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRPJ RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRPI RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRP7 RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRP4 RecName: Full=UvrABC system protein B;       
   63::230     3e-11  31%  662 aa  UVRB_STRP2 RecName: Full=UvrABC system protein B;       
   19::224     3e-11  28%  679 aa  UVRB_PROMM RecName: Full=UvrABC system protein B;       
   19::224     3e-11  27%  679 aa  UVRB_PROM0 RecName: Full=UvrABC system protein B;       
   63::567     3e-11  27%  667 aa  UVRB_LACSS RecName: Full=UvrABC system protein B;       
   67::232     3e-11  31%  693 aa  UVRB_ARTS2 RecName: Full=UvrABC system protein B;       
   67::233     3e-11  31%  699 aa  UVRB_ARTAT RecName: Full=UvrABC system protein B;       
  221::364     3e-11  37%  732 aa  PRIA_ECOLI RecName: Full=Primosomal protein N';       
   56::233     4e-11  28%  665 aa  UVRB_CYAP7 RecName: Full=UvrABC system protein B;       
   59::554     4e-11  28%  658 aa  UVRB_BACCA RecName: Full=UvrABC system protein B;       
   20::237     6e-11  28%  676 aa  UVRB_VIBF1 RecName: Full=UvrABC system protein B;       
   67::232     6e-11  31%  701 aa  UVRB_THEFY RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRPZ RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRPM RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRPG RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRPF RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRPC RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRPB RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRP8 RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRP6 RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRP3 RecName: Full=UvrABC system protein B;       
   63::229     6e-11  31%  663 aa  UVRB_STRP1 RecName: Full=UvrABC system protein B;       
   63::230     6e-11  30%  663 aa  UVRB_STRMU RecName: Full=UvrABC system protein B;       
   61::229     6e-11  30%  663 aa  UVRB_STAAW RecName: Full=UvrABC system protein B;       
   61::229     6e-11  30%  663 aa  UVRB_STAAS RecName: Full=UvrABC system protein B;       
   61::229     6e-11  30%  663 aa  UVRB_STAAR RecName: Full=UvrABC system protein B;       
   61::229     6e-11  30%  663 aa  UVRB_STAAN RecName: Full=UvrABC system protein B;       
   61::229     6e-11  30%  663 aa  UVRB_STAAM RecName: Full=UvrABC system protein B;       
   61::229     6e-11  30%  663 aa  UVRB_STAAC RecName: Full=UvrABC system protein B;       
   60::227     6e-11  30%  698 aa  UVRB_MYCTU RecName: Full=UvrABC system protein B;       
   60::227     6e-11  30%  698 aa  UVRB_MYCBO RecName: Full=UvrABC system protein B;       
   63::587     6e-11  28%  668 aa  UVRB_LACBA RecName: Full=UvrABC system protein B;       
   57::222     6e-11  28%  698 aa  UVRB_HERA2 RecName: Full=UvrABC system protein B;       
   57::222     6e-11  32%  664 aa  UVRB_DEHSC RecName: Full=UvrABC system protein B;       
   64::258     8e-11  29%  708 aa  UVRB_RHOBA RecName: Full=UvrABC system protein B;       
   63::228     8e-11  31%  688 aa  UVRB_LEIXX RecName: Full=UvrABC system protein B;       
   63::229     8e-11  29%  671 aa  UVRB_LACCB RecName: Full=UvrABC system protein B;       
   63::229     8e-11  29%  671 aa  UVRB_LACC3 RecName: Full=UvrABC system protein B;       
  212::335     8e-11  33%  749 aa  PRIA_CHLPN RecName: Full=Primosomal protein N';       
  143::433     8e-11  31%  463 aa  COMFA_BACSU RecName: Full=ComF operon protein 1;       
   63::229     1e-10  31%  663 aa  UVRB_STRPD RecName: Full=UvrABC system protein B;       
   50::237     1e-10  30%  670 aa  UVRB_PSYIN RecName: Full=UvrABC system protein B;       
   19::224     1e-10  26%  679 aa  UVRB_PROMP RecName: Full=UvrABC system protein B;       
   63::229     1e-10  29%  671 aa  UVRB_LACGA RecName: Full=UvrABC system protein B;       
   56::581     1e-10  30%  665 aa  UVRB_ANASP RecName: Full=UvrABC system protein B;       
   20::237     1e-10  29%  676 aa  UVRB_ALISL RecName: Full=UvrABC system protein B;       
   65::230     1e-10  30%  703 aa  UVRB_BIFLO RecName: Full=UvrABC system protein B;       
   63::228     2e-10  29%  677 aa  UVRB_TROW8 RecName: Full=UvrABC system protein B;       
   19::224     2e-10  28%  678 aa  UVRB_PROMT RecName: Full=UvrABC system protein B;       
   19::224     2e-10  28%  678 aa  UVRB_PROM1 RecName: Full=UvrABC system protein B;       
   51::225     2e-10  32%  677 aa  UVRB_DESVV RecName: Full=UvrABC system protein B;       
   51::225     2e-10  32%  677 aa  UVRB_DESVH RecName: Full=UvrABC system protein B;       
   58::224     2e-10  30%  660 aa  UVRB_BACSK RecName: Full=UvrABC system protein B;       
   68::614     2e-10  28%  668 aa  UVRB_STRT2 RecName: Full=UvrABC system protein B;       
   68::614     2e-10  28%  668 aa  UVRB_STRT1 RecName: Full=UvrABC system protein B;       
   13::254     2e-10  28%  684 aa  UVRB_CHLL2 RecName: Full=UvrABC system protein B;       
   58::582     3e-10  29%  678 aa  UVRB_THICR RecName: Full=UvrABC system protein B;       
   13::614     3e-10  29%  659 aa  UVRB_SYMTH RecName: Full=UvrABC system protein B;       
   68::614     3e-10  28%  668 aa  UVRB_STRTD RecName: Full=UvrABC system protein B;       
   60::227     3e-10  30%  701 aa  UVRB_MYCUA RecName: Full=UvrABC system protein B;       
  265::472     3e-10  29%  805 aa  PRIA_BACSU RecName: Full=Primosomal protein N';       
   58::543     4e-10  31%  687 aa  UVRB_NITOC RecName: Full=UvrABC system protein B;       
   13::224     4e-10  26%  667 aa  UVRB_MICAN RecName: Full=UvrABC system protein B;       
   56::224     4e-10  29%  665 aa  UVRB_CYAP4 RecName: Full=UvrABC system protein B;       
  222::360     4e-10  36%  730 aa  PRIA_HAEIN RecName: Full=Primosomal protein N';       
   15::225     5e-10  27%  669 aa  UVRB_SYNY3 RecName: Full=UvrABC system protein B;       
   60::227     5e-10  30%  698 aa  UVRB_MYCLE RecName: Full=UvrABC system protein B;       
    4::629     5e-10  28%  664 aa  UVRB_METCA RecName: Full=UvrABC system protein B;       
   57::228     5e-10  30%  657 aa  UVRB_CLOB8 RecName: Full=UvrABC system protein B;       
   13::545     6e-10  29%  662 aa  UVRB_THETN RecName: Full=UvrABC system protein B;       
   50::544     6e-10  29%  669 aa  UVRB_PHOLL RecName: Full=UvrABC system protein B;       
   62::245     6e-10  25%  675 aa  UVRB_NEIMB RecName: Full=UvrABC system protein B;       
   20::548     8e-10  29%  676 aa  UVRB_VIBPA RecName: Full=UvrABC system protein B;       
   62::233     8e-10  26%  675 aa  UVRB_NEIMA RecName: Full=UvrABC system protein B;       
   62::233     8e-10  26%  675 aa  UVRB_NEIGO RecName: Full=UvrABC system protein B;       
   62::233     8e-10  26%  675 aa  UVRB_NEIG1 RecName: Full=UvrABC system protein B;       
   57::223     8e-10  31%  658 aa  UVRB_NATTJ RecName: Full=UvrABC system protein B;       
   58::224     8e-10  29%  660 aa  UVRB_BACHD RecName: Full=UvrABC system protein B;       
   70::595     8e-10  29%  685 aa  UVRB_AZOSE RecName: Full=UvrABC system protein B;       
    9::241     1e-09  29%  676 aa  UVRB_VIBVY RecName: Full=UvrABC system protein B;       
    9::241     1e-09  29%  676 aa  UVRB_VIBVU RecName: Full=UvrABC system protein B;       
   19::224     1e-09  27%  677 aa  UVRB_SYNPX RecName: Full=UvrABC system protein B;       
   20::227     1e-09  28%  674 aa  UVRB_PHOPR RecName: Full=UvrABC system protein B;       
   57::228     1e-09  30%  659 aa  UVRB_CLOPS RecName: Full=UvrABC system protein B;       
   57::228     1e-09  30%  659 aa  UVRB_CLOPE RecName: Full=UvrABC system protein B;       
   57::228     1e-09  30%  659 aa  UVRB_CLOP1 RecName: Full=UvrABC system protein B;       
   56::223     1e-09  30%  695 aa  UVRB_SYNJA RecName: Full=UvrABC system protein B;       
   56::224     1e-09  30%  679 aa  UVRB_PROM4 RecName: Full=UvrABC system protein B;       
   56::581     1e-09  29%  668 aa  UVRB_ACAM1 RecName: Full=UvrABC system protein B;       
   58::236     2e-09  30%  658 aa  UVRB_HELHP RecName: Full=UvrABC system protein B;       
   70::240     2e-09  28%  690 aa  UVRB_DECAR RecName: Full=UvrABC system protein B;       
  110::242     2e-09  31%  648 aa  PRIA_RICBR RecName: Full=Primosomal protein N';       
   58::579     2e-09  29%  660 aa  UVRB_OCEIH RecName: Full=UvrABC system protein B;       
   63::548     2e-09  27%  683 aa  UVRB_LACAC RecName: Full=UvrABC system protein B;       
   49::226     2e-09  29%  662 aa  UVRB_CARHZ RecName: Full=UvrABC system protein B;       
  110::242     2e-09  31%  648 aa  PRIA_RICFE RecName: Full=Primosomal protein N';       
   19::224     3e-09  27%  679 aa  UVRB_SYNS3 RecName: Full=UvrABC system protein B;       
   57::236     3e-09  27%  666 aa  UVRB_LEPIN RecName: Full=UvrABC system protein B;       
   57::236     3e-09  27%  666 aa  UVRB_LEPIC RecName: Full=UvrABC system protein B;       
   57::222     3e-09  31%  668 aa  UVRB_DEHE1 RecName: Full=UvrABC system protein B;       
   56::224     5e-09  29%  678 aa  UVRB_SYNPW RecName: Full=UvrABC system protein B;       
   57::592     5e-09  30%  667 aa  UVRB_PELCD RecName: Full=UvrABC system protein B;       
   57::236     5e-09  26%  666 aa  UVRB_LEPBL RecName: Full=UvrABC system protein B;       
   57::236     5e-09  26%  666 aa  UVRB_LEPBJ RecName: Full=UvrABC system protein B;       
   56::568     7e-09  30%  695 aa  UVRB_SYNJB RecName: Full=UvrABC system protein B;       
   19::224     7e-09  25%  677 aa  UVRB_PROMA RecName: Full=UvrABC system protein B;       
   59::237     7e-09  27%  663 aa  UVRB_FUSNN RecName: Full=UvrABC system protein B;       
   19::226     9e-09  28%  670 aa  UVRB_PSEAE RecName: Full=UvrABC system protein B;       
  158::635     9e-09  28%  660 aa  UVRB_METBU RecName: Full=UvrABC system protein B;       
  141::562     9e-09  32%  648 aa  PRIA_RICCN RecName: Full=Primosomal protein N';       
   88::267     1e-08  28%  740 aa  UVRB_ZYMMO RecName: Full=UvrABC system protein B;       
   55::220     1e-08  25%  664 aa  UVRB_THENN RecName: Full=UvrABC system protein B;       
   58::226     1e-08  28%  668 aa  UVRB_THEEB RecName: Full=UvrABC system protein B;       
   67::232     1e-08  31%  713 aa  UVRB_STRAW RecName: Full=UvrABC system protein B;       
   25::232     2e-08  27%  678 aa  UVRB_PASMU RecName: Full=UvrABC system protein B;       
   58::228     2e-08  29%  677 aa  UVRB_IDILO RecName: Full=UvrABC system protein B;       
   57::225     2e-08  26%  662 aa  UVRB_TREDE RecName: Full=UvrABC system protein B;       
   20::583     2e-08  30%  670 aa  UVRB_PECCP RecName: Full=UvrABC system protein B;       
  161::230     2e-08  36%  657 aa  UVRB_CAMJR RecName: Full=UvrABC system protein B;       
  161::230     2e-08  36%  657 aa  UVRB_CAMJE RecName: Full=UvrABC system protein B;       
  205::339     2e-08  34%  753 aa  PRIA_CHLTR RecName: Full=Primosomal protein N';       
   55::220     3e-08  25%  664 aa  UVRB_THESQ RecName: Full=UvrABC system protein B;       
   55::220     3e-08  25%  664 aa  UVRB_THEP1 RecName: Full=UvrABC system protein B;       
   55::220     3e-08  25%  664 aa  UVRB_THEMA RecName: Full=UvrABC system protein B;       
   54::233     3e-08  25%  661 aa  UVRB_THEAB RecName: Full=UvrABC system protein B;       
   63::228     3e-08  28%  688 aa  UVRB_CLAMS RecName: Full=UvrABC system protein B;       
   63::228     3e-08  28%  688 aa  UVRB_CLAM3 RecName: Full=UvrABC system protein B;       
   24::547     3e-08  28%  675 aa  UVRB_ACIAD RecName: Full=UvrABC system protein B;       
  110::567     3e-08  29%  648 aa  PRIA_RICPR RecName: Full=Primosomal protein N';       
   25::588     4e-08  27%  679 aa  UVRB_HAEIN RecName: Full=UvrABC system protein B;       
   25::588     4e-08  28%  679 aa  UVRB_HAEI8 RecName: Full=UvrABC system protein B;       
    3::240     4e-08  27%  675 aa  UVRB_HAEDU RecName: Full=UvrABC system protein B;       
   57::552     4e-08  29%  668 aa  UVRB_FRATT RecName: Full=UvrABC system protein B;       
   20::583     4e-08  29%  670 aa  UVRB_ERWCT RecName: Full=UvrABC system protein B;       
   58::227     4e-08  27%  672 aa  UVRB_COXBU RecName: Full=UvrABC system protein B;       
   58::227     4e-08  27%  672 aa  UVRB_COXBR RecName: Full=UvrABC system protein B;       
   58::227     4e-08  27%  672 aa  UVRB_COXBN RecName: Full=UvrABC system protein B;       
   58::227     4e-08  27%  672 aa  UVRB_COXB2 RecName: Full=UvrABC system protein B;       
   58::227     4e-08  27%  672 aa  UVRB_COXB1 RecName: Full=UvrABC system protein B;       
  170::232     4e-08  39%  658 aa  UVRB_CAMFF RecName: Full=UvrABC system protein B;       
   57::234     5e-08  27%  666 aa  UVRB_CLOAB RecName: Full=UvrABC system protein B;       
  162::254     5e-08  34%  685 aa  UVRB_CHLPD RecName: Full=UvrABC system protein B;       
   61::240     5e-08  27%  673 aa  UVRB_ACTP2 RecName: Full=UvrABC system protein B;       
  391::524     5e-08  34%  598 aa  DDX52_MOUSE RecName: Full=Probable ATP-dependent RNA helicase
   50::547     6e-08  28%  669 aa  UVRB_PROMH RecName: Full=UvrABC system protein B;       
   20::583     6e-08  29%  671 aa  UVRB_HAMD5 RecName: Full=UvrABC system protein B;       
   56::224     6e-08  28%  661 aa  UVRB_FERNB RecName: Full=UvrABC system protein B;       
  164::233     6e-08  39%  684 aa  UVRB_CHLTE RecName: Full=UvrABC system protein B;       
   62::233     6e-08  27%  681 aa  UVRB_CHLCH RecName: Full=UvrABC system protein B;       
  110::567     6e-08  28%  648 aa  PRIA_RICTY RecName: Full=Primosomal protein N';       
  391::524     6e-08  34%  598 aa  DDX52_RAT RecName: Full=Probable ATP-dependent RNA helicase DDX52; 
  491::628     6e-08  32%  947 aa  DDX42_XENLA RecName: Full=ATP-dependent RNA helicase DDX42;       
   57::571     8e-08  27%  661 aa  UVRB_RICRS RecName: Full=UvrABC system protein B;       
   57::571     8e-08  27%  661 aa  UVRB_RICRO RecName: Full=UvrABC system protein B;       
   57::571     8e-08  27%  661 aa  UVRB_RICPU RecName: Full=UvrABC system protein B;       
   57::571     8e-08  27%  661 aa  UVRB_RICCN RecName: Full=UvrABC system protein B;       
   57::571     8e-08  27%  661 aa  UVRB_RICAE RecName: Full=UvrABC system protein B;       
  159::236     8e-08  31%  658 aa  UVRB_HELPY RecName: Full=UvrABC system protein B;       
  159::236     8e-08  31%  658 aa  UVRB_HELPJ RecName: Full=UvrABC system protein B;       
  159::236     8e-08  31%  658 aa  UVRB_HELPH RecName: Full=UvrABC system protein B;       
  159::236     8e-08  31%  658 aa  UVRB_HELAH RecName: Full=UvrABC system protein B;       
  176::232     8e-08  41%  657 aa  UVRB_CAMHC RecName: Full=UvrABC system protein B;       
  211::339     8e-08  33%  753 aa  PRIA_CHLMU RecName: Full=Primosomal protein N';       
  166::222     1e-07  35%  649 aa  UVRB_METST RecName: Full=UvrABC system protein B;       
  390::523     1e-07  33%  599 aa  DDX52_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  494::604     1e-07  33%  929 aa  DDX42_MOUSE RecName: Full=ATP-dependent RNA helicase DDX42;        
   20::583     1e-07  29%  670 aa  UVRB_YERE8 RecName: Full=UvrABC system protein B;       
   61::600     1e-07  31%  675 aa  UVRB_THIDA RecName: Full=UvrABC system protein B;       
   54::236     1e-07  29%  665 aa  UVRB_THET8 RecName: Full=UvrABC system protein B;       
   34::227     1e-07  28%  670 aa  UVRB_SERP5 RecName: Full=UvrABC system protein B;       
   57::226     1e-07  29%  671 aa  UVRB_PSEPF RecName: Full=UvrABC system protein B;       
   20::227     1e-07  28%  673 aa  UVRB_ENT38 RecName: Full=UvrABC system protein B;       
   20::227     2e-07  28%  673 aa  UVRB_SHIFL RecName: Full=UvrABC system protein B;       
   20::227     2e-07  28%  673 aa  UVRB_SHIF8 RecName: Full=UvrABC system protein B;       
   57::571     2e-07  27%  661 aa  UVRB_RICFE RecName: Full=UvrABC system protein B;       
   57::571     2e-07  28%  661 aa  UVRB_RICBR RecName: Full=UvrABC system protein B;       
   57::571     2e-07  28%  661 aa  UVRB_RICB8 RecName: Full=UvrABC system protein B;       
   57::220     2e-07  29%  664 aa  UVRB_LEPBP RecName: Full=UvrABC system protein B;       
   57::220     2e-07  29%  664 aa  UVRB_LEPBA RecName: Full=UvrABC system protein B;       
   62::231     2e-07  28%  690 aa  UVRB_CHLPB RecName: Full=UvrABC system protein B;       
   57::236     2e-07  25%  661 aa  UVRB_RICM5 RecName: Full=UvrABC system protein B;       
   63::609     2e-07  28%  678 aa  UVRB_MANSM RecName: Full=UvrABC system protein B;       
   62::600     2e-07  27%  670 aa  UVRB_CHRVO RecName: Full=UvrABC system protein B;       
  388::521     2e-07  33%  596 aa  DDX52_BOVIN RecName: Full=Probable ATP-dependent RNA helicase
  494::604     2e-07  33%  942 aa  DDX42_PONAB RecName: Full=ATP-dependent RNA helicase DDX42;        
  494::604     2e-07  33%  938 aa  DDX42_HUMAN RecName: Full=ATP-dependent RNA helicase DDX42;        
   20::583     3e-07  30%  671 aa  UVRB_YERPY RecName: Full=UvrABC system protein B;       
   20::583     3e-07  30%  671 aa  UVRB_YERPS RecName: Full=UvrABC system protein B;       
   20::227     3e-07  29%  671 aa  UVRB_YERPP RecName: Full=UvrABC system protein B;       
   20::227     3e-07  29%  671 aa  UVRB_YERPN RecName: Full=UvrABC system protein B;       
   20::227     3e-07  29%  671 aa  UVRB_YERPG RecName: Full=UvrABC system protein B;       
   20::227     3e-07  29%  671 aa  UVRB_YERPE RecName: Full=UvrABC system protein B;       
   20::583     3e-07  30%  671 aa  UVRB_YERPB RecName: Full=UvrABC system protein B;       
   20::583     3e-07  30%  671 aa  UVRB_YERP3 RecName: Full=UvrABC system protein B;       
  162::234     3e-07  29%  667 aa  UVRB_KOSOT RecName: Full=UvrABC system protein B;       
  381::467     3e-07  32%  748 aa  RH3_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 3;     
   57::571     4e-07  27%  661 aa  UVRB_RICAH RecName: Full=UvrABC system protein B;       
  494::604     4e-07  31%  944 aa  DDX42_CHICK RecName: Full=ATP-dependent RNA helicase DDX42;        
   60::226     5e-07  31%  673 aa  UVRB_PARUW RecName: Full=UvrABC system protein B;       
   58::227     5e-07  26%  663 aa  UVRB_LEGPL RecName: Full=UvrABC system protein B;       
   58::582     5e-07  27%  663 aa  UVRB_LEGPH RecName: Full=UvrABC system protein B;       
   58::227     5e-07  26%  663 aa  UVRB_LEGPC RecName: Full=UvrABC system protein B;       
   58::227     5e-07  26%  663 aa  UVRB_LEGPA RecName: Full=UvrABC system protein B;       
   57::226     7e-07  24%  662 aa  UVRB_RICPR RecName: Full=UvrABC system protein B;       
   76::246     7e-07  25%  695 aa  UVRB_RALEJ RecName: Full=UvrABC system protein B;       
   62::232     7e-07  31%  695 aa  UVRB_NITEU RecName: Full=UvrABC system protein B;       
   57::238     7e-07  27%  659 aa  UVRB_MYCMO RecName: Full=UvrABC system protein B;       
   57::543     7e-07  28%  673 aa  UVRB_COLP3 RecName: Full=UvrABC system protein B;       
   58::553     9e-07  30%  673 aa  UVRB_XANAC RecName: Full=UvrABC system protein B;       
   57::226     9e-07  25%  662 aa  UVRB_RICTY RecName: Full=UvrABC system protein B;       
  125::463     9e-07  25%  590 aa  RH51_ORYSJ RecName: Full=Putative DEAD-box ATP-dependent RNA
   70::267     9e-07  31%  619 aa  PRIA_HELPY RecName: Full=Primosomal protein N';       
  129::240     9e-07  32%  619 aa  PRIA_HELPJ RecName: Full=Primosomal protein N';       
   20::227     1e-06  27%  671 aa  UVRB_YERPA RecName: Full=UvrABC system protein B;       
   58::573     1e-06  29%  658 aa  UVRB_WOLSU RecName: Full=UvrABC system protein B;       
  152::223     1e-06  28%  656 aa  UVRB_THELT RecName: Full=UvrABC system protein B;       
  208::398     1e-06  27%  600 aa  DDX55_MOUSE RecName: Full=ATP-dependent RNA helicase DDX55;        
  164::259     1e-06  26%  646 aa  UVRB_METMP RecName: Full=UvrABC system protein B;       
   20::227     1e-06  27%  674 aa  UVRB_ERWT9 RecName: Full=UvrABC system protein B;       
   57::542     1e-06  27%  661 aa  UVRB_ANATD RecName: Full=UvrABC system protein B;       
  311::568     1e-06  21%  666 aa  MS116_CANGA RecName: Full=ATP-dependent RNA helicase MSS116,
  149::377     1e-06  24%  601 aa  DDX55_BOVIN RecName: Full=ATP-dependent RNA helicase DDX55;        
   57::236     2e-06  24%  661 aa  UVRB_RICCK RecName: Full=UvrABC system protein B;       
  177::414     2e-06  27%  628 aa  RH9_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 9;     
  358::435     2e-06  29%  602 aa  RH53_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 53;   
  322::656     2e-06  25%  986 aa  DDX42_DICDI RecName: Full=Probable ATP-dependent RNA helicase
   73::568     3e-06  30%  688 aa  UVRB_XANOR RecName: Full=UvrABC system protein B;       
   58::553     3e-06  30%  673 aa  UVRB_XANOP RecName: Full=UvrABC system protein B;       
   58::237     3e-06  27%  673 aa  UVRB_XANOM RecName: Full=UvrABC system protein B;       
   58::553     3e-06  30%  673 aa  UVRB_XANCP RecName: Full=UvrABC system protein B;       
   58::553     3e-06  30%  673 aa  UVRB_XANCB RecName: Full=UvrABC system protein B;       
   58::553     3e-06  30%  673 aa  UVRB_XANC8 RecName: Full=UvrABC system protein B;       
   75::246     3e-06  25%  696 aa  UVRB_RALSO RecName: Full=UvrABC system protein B;       
   66::236     3e-06  28%  675 aa  UVRB_BORPD RecName: Full=UvrABC system protein B;       
   57::223     3e-06  27%  651 aa  UVRB_ANAMM RecName: Full=UvrABC system protein B;       
  355::423     3e-06  35%  758 aa  RH3_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 3;     
   58::606     3e-06  27%  680 aa  UVRB_GLOVI RecName: Full=UvrABC system protein B;       
   57::223     3e-06  27%  651 aa  UVRB_ANAMF RecName: Full=UvrABC system protein B;       
  258::377     3e-06  27%  593 aa  DDX55_DANRE RecName: Full=ATP-dependent RNA helicase DDX55;        
   58::227     4e-06  26%  664 aa  UVRB_PSEHT RecName: Full=UvrABC system protein B;       
  163::235     4e-06  30%  646 aa  UVRB_METTH RecName: Full=UvrABC system protein B;       
   48::605     4e-06  26%  677 aa  UVRB_BACFR RecName: Full=UvrABC system protein B;       
   48::605     4e-06  26%  677 aa  UVRB_BACFN RecName: Full=UvrABC system protein B;       
  128::428     4e-06  26%  568 aa  RH51_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 51;   
  252::377     4e-06  26%  591 aa  DDX55_CHICK RecName: Full=ATP-dependent RNA helicase DDX55;        
   58::636     6e-06  27%  669 aa  UVRB_XYLFT RecName: Full=UvrABC system protein B;       
   58::553     6e-06  28%  669 aa  UVRB_XYLFM RecName: Full=UvrABC system protein B;       
   58::660     6e-06  27%  669 aa  UVRB_XYLFA RecName: Full=UvrABC system protein B;       
   58::636     6e-06  27%  669 aa  UVRB_XYLF2 RecName: Full=UvrABC system protein B;       
   83::248     6e-06  25%  670 aa  UVRB_METMA RecName: Full=UvrABC system protein B;       
   20::227     6e-06  26%  672 aa  UVRB_EDWI9 RecName: Full=UvrABC system protein B;       
   66::236     6e-06  29%  676 aa  UVRB_BORA1 RecName: Full=UvrABC system protein B;       
  230::399     6e-06  28%  811 aa  PRIA_RHORU RecName: Full=Primosomal protein N';       
  365::595     6e-06  26%  753 aa  DRS1_YARLI RecName: Full=ATP-dependent RNA helicase DRS1;       
   20::227     7e-06  27%  673 aa  UVRB_KLEP7 RecName: Full=UvrABC system protein B;       
   20::227     7e-06  27%  673 aa  UVRB_KLEP3 RecName: Full=UvrABC system protein B;       
   66::636     7e-06  28%  675 aa  UVRB_BORPA RecName: Full=UvrABC system protein B;       
   66::636     7e-06  28%  675 aa  UVRB_BORBR RecName: Full=UvrABC system protein B;       
  252::398     7e-06  29%  600 aa  DDX55_HUMAN RecName: Full=ATP-dependent RNA helicase DDX55;        
   20::227     1e-05  26%  673 aa  UVRB_SALPK RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALPA RecName: Full=UvrABC system protein B;       
   57::222     1e-05  23%  655 aa  UVRB_METS3 RecName: Full=UvrABC system protein B;       
  565::658     1e-05  32% 1002 aa  MPH1_KLULA RecName: Full=ATP-dependent DNA helicase MPH1;       
  238::544     1e-05  28%  705 aa  DRS1_PICGU RecName: Full=ATP-dependent RNA helicase DRS1;       
  252::377     1e-05  27%  594 aa  DDX55_XENLA RecName: Full=ATP-dependent RNA helicase DDX55;        
   20::227     1e-05  26%  673 aa  UVRB_SHISS RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SHIDS RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SHIBS RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SHIB3 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALTY RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALTI RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALSV RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALPC RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALPB RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALNS RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALHS RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALG2 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALEP RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALDC RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALCH RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALAR RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_SALA4 RecName: Full=UvrABC system protein B;       
   52::221     1e-05  26%  870 aa  UVRB_RHILO RecName: Full=UvrABC system protein B;       
  186::248     1e-05  32%  670 aa  UVRB_METAC RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ESCF3 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOUT RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOSM RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOSE RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOLU RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOLI RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOLC RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOL5 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOK1 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOHS RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECODH RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECOBW RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECO8A RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECO81 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECO7I RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECO5E RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECO57 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECO55 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECO45 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECO27 RecName: Full=UvrABC system protein B;       
   20::227     1e-05  26%  673 aa  UVRB_ECO24 RecName: Full=UvrABC system protein B;       
   57::542     1e-05  27%  661 aa  UVRB_CALS8 RecName: Full=UvrABC system protein B;       
   48::222     1e-05  27%  677 aa  UVRB_BACTN RecName: Full=UvrABC system protein B;       
   62::309     1e-05  25%  465 aa  RH55_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 55;   
  130::413     1e-05  23%  558 aa  RH49_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 49;     
  156::254     1e-05  43%  657 aa  PRIA_TREPA RecName: Full=Primosomal protein N';       
   56::202     2e-05  26%  645 aa  UVRB_WOLTR RecName: Full=UvrABC system protein B;       
   20::227     2e-05  26%  673 aa  UVRB_CITK8 RecName: Full=UvrABC system protein B;       
   85::381     2e-05  27%  481 aa  ROK1_SCHPO RecName: Full=ATP-dependent RNA helicase rok1;       
  335::561     2e-05  28%  741 aa  DRS1_PICST RecName: Full=ATP-dependent RNA helicase DRS1;       
  343::564     2e-05  29%  734 aa  DRS1_ASHGO RecName: Full=ATP-dependent RNA helicase DRS1;       
  158::375     2e-05  27%  613 aa  DDX55_DROME RecName: Full=Probable ATP-dependent RNA helicase DDX55
   58::223     3e-05  26%  653 aa  UVRB_ANAPZ RecName: Full=UvrABC system protein B;       
   73::396     3e-05  24%  475 aa  RRP3_PICGU RecName: Full=ATP-dependent rRNA helicase RRP3;       
  314::415     3e-05  33%  831 aa  PRIA_SYNY3 RecName: Full=Primosomal protein N';       
  226::454     3e-05  24%  587 aa  HAS1_MAGGR RecName: Full=ATP-dependent RNA helicase HAS1;       
  366::647     3e-05  28%  829 aa  DRS1_NEUCR RecName: Full=ATP-dependent RNA helicase drs-1;       
   77::247     4e-05  25%  696 aa  UVRB_BURPS RecName: Full=UvrABC system protein B;       
   77::247     4e-05  25%  696 aa  UVRB_BURMA RecName: Full=UvrABC system protein B;       
  270::332     4e-05  33%  400 aa  RRP3_ENCCU RecName: Full=ATP-dependent rRNA helicase RRP3;       
  491::608     4e-05  26% 1052 aa  MPH1_CANGA RecName: Full=ATP-dependent DNA helicase MPH1;       
  175::342     4e-05  28%  403 aa  IF4A_DROME RecName: Full=Eukaryotic initiation factor 4A;       
  154::482     4e-05  26%  590 aa  HAS1_GIBZE RecName: Full=ATP-dependent RNA helicase HAS1;       
  252::470     4e-05  27%  613 aa  DRS1_CANAL RecName: Full=ATP-dependent RNA helicase DRS1;       
  246::577     4e-05  26%  668 aa  DDX52_DICDI RecName: Full=Probable ATP-dependent RNA helicase ddx52; 
  164::242     5e-05  27%  662 aa  UVRB_MYCPE RecName: Full=UvrABC system protein B;       
  135::352     5e-05  26%  434 aa  RHLB_ALISL RecName: Full=ATP-dependent RNA helicase rhlB;       
  379::421     5e-05  40%  616 aa  RH53_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 53;   
  379::471     6e-05  30%  696 aa  RH7_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 7;     
  411::583     6e-05  25%  834 aa  MFH1_SCHPO RecName: Full=ATP-dependent DNA helicase mfh1;       
   48::222     8e-05  24%  660 aa  UVRB_EUBR3 RecName: Full=UvrABC system protein B;       
   48::563     8e-05  26%  656 aa  UVRB_CHLCV RecName: Full=UvrABC system protein B;       
   66::636     8e-05  27%  678 aa  UVRB_BORPE RecName: Full=UvrABC system protein B;       
  391::433     8e-05  40%  610 aa  RH9_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 9;     
  507::631     8e-05  25%  748 aa  DRS1_KLULA RecName: Full=ATP-dependent RNA helicase DRS1;       
  319::551     8e-05  29%  725 aa  DRS1_CANGA RecName: Full=ATP-dependent RNA helicase DRS1;       
  393::585     1e-04  28%  657 aa  UVRB_MYCPN RecName: Full=UvrABC system protein B;       
  132::455     1e-04  25%  539 aa  RRP3_CANAL RecName: Full=ATP-dependent rRNA helicase RRP3;       
  141::435     1e-04  26%  739 aa  RH32_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 32;   
  547::624     1e-04  38%  662 aa  PRP28_SCHPO RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  521::608     1e-04  31% 1102 aa  MPH1_MAGGR RecName: Full=ATP-dependent DNA helicase MPH1;       
  300::638     1e-04  25%  702 aa  DDX4_MOUSE RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
  329::667     1e-04  25%  729 aa  DDX4_BOVIN RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
  479::585     1e-04  33%  769 aa  DBP7_ASPTN RecName: Full=ATP-dependent RNA helicase dbp7;       
  185::231     1e-04  38%  681 aa  UVRB_CORDI RecName: Full=UvrABC system protein B;       
  341::457     1e-04  31%  547 aa  ROK1_YARLI RecName: Full=ATP-dependent RNA helicase ROK1;       
  169::446     1e-04  24%  512 aa  RH5_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 5;     
   96::341     1e-04  28%  404 aa  IF4A_TRYBB RecName: Full=Probable eukaryotic initiation factor 4A; 
  328::655     1e-04  25%  725 aa  DDX4_MACFA RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
  327::654     1e-04  25%  724 aa  DDX4_HUMAN RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
  367::466     1e-04  29%  504 aa  DBP3_KLULA RecName: Full=ATP-dependent RNA helicase DBP3;       
  160::345     2e-04  29%  614 aa  Y383_METJA RecName: Full=Uncharacterized protein MJ0383;
  144::391     2e-04  24%  593 aa  RH18_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 18;   
  297::341     2e-04  38%  606 aa  IRC3_SCHPO RecName: Full=Putative mitochondrial ATP-dependent
   96::341     2e-04  29%  404 aa  IF4A_TRYCR RecName: Full=Probable eukaryotic initiation factor 4A; 
  507::650     2e-04  26%  713 aa  DDX4_RAT RecName: Full=Probable ATP-dependent RNA helicase DDX4;   
   81::360     2e-04  27%  452 aa  DBP4_ENCCU RecName: Full=ATP-dependent RNA helicase DBP4;       
  400::525     2e-04  26%  578 aa  DBP3_SCHPO RecName: Full=ATP-dependent RNA helicase dbp3;       
  158::223     2e-04  33%  668 aa  UVRB_TREPS RecName: Full=UvrABC system protein B;       
  158::223     2e-04  33%  668 aa  UVRB_TREPA RecName: Full=UvrABC system protein B;       
  158::381     2e-04  26%  421 aa  RHLB_PSEA6 RecName: Full=ATP-dependent RNA helicase rhlB;       
  329::601     2e-04  29%  796 aa  DRS1_GIBZE RecName: Full=ATP-dependent RNA helicase DRS1;       
  382::604     2e-04  28%  771 aa  DRS1_DEBHA RecName: Full=ATP-dependent RNA helicase DRS1;       
  520::652     2e-04  26%  722 aa  DDX4_PIG RecName: Full=Probable ATP-dependent RNA helicase DDX4;   
  188::442     2e-04  27%  875 aa  DDX10_CHICK RecName: Full=Probable ATP-dependent RNA helicase
   57::226     3e-04  28%  671 aa  UVRB_PSEPK RecName: Full=UvrABC system protein B;       
   57::226     3e-04  26%  671 aa  UVRB_PSEF5 RecName: Full=UvrABC system protein B;       
  551::613     3e-04  32%  993 aa  MPH1_YEAST RecName: Full=ATP-dependent DNA helicase MPH1;       
  551::613     3e-04  32%  993 aa  MPH1_YEAS7 RecName: Full=ATP-dependent DNA helicase MPH1;       
   63::238     4e-04  26%  672 aa  UVRB_ONYPE RecName: Full=UvrABC system protein B;       
  473::582     4e-04  28%  667 aa  UVRB_AYWBP RecName: Full=UvrABC system protein B;       
  377::519     4e-04  27%  671 aa  RH7_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 7;       
  699::776     4e-04  27% 1014 aa  PRP11_SCHPO RecName: Full=Pre-mRNA-processing ATP-dependent RNA
  551::613     4e-04  40% 1012 aa  MPH1_VANPO RecName: Full=ATP-dependent DNA helicase MPH1;       
   96::340     4e-04  30%  403 aa  IF4A_LEIBR RecName: Full=Probable eukaryotic initiation factor 4A; 
  288::613     4e-04  26%  808 aa  DRS1_PHANO RecName: Full=ATP-dependent RNA helicase DRS1;       
  372::627     4e-04  28%  819 aa  DRS1_NEOFI RecName: Full=ATP-dependent RNA helicase drs1;       
  383::638     4e-04  28%  830 aa  DRS1_ASPFU RecName: Full=ATP-dependent RNA helicase drs1;       
  512::581     4e-04  36% 1584 aa  DCL1_NEUCR RecName: Full=Dicer-like protein 1;Includes:  RecName:
  402::449     4e-04  33%  540 aa  DBP3_CANGA RecName: Full=ATP-dependent RNA helicase DBP3;       
  348::442     4e-04  29%  503 aa  DBP3_ASPFU RecName: Full=ATP-dependent RNA helicase dbp3;       
  124::274     5e-04  28%  513 aa  VF509_ASFP4 RecName: Full=Putative ATP-dependent RNA helicase
  390::597     5e-04  27%  661 aa  VASA_DROME RecName: Full=ATP-dependent RNA helicase vasa;       
   57::591     5e-04  27%  671 aa  UVRB_PSESM RecName: Full=UvrABC system protein B;       
   48::223     5e-04  26%  656 aa  UVRB_CHLAB RecName: Full=UvrABC system protein B;       
  145::462     5e-04  25%  537 aa  ROK1_PICGU RecName: Full=ATP-dependent RNA helicase ROK1;       
  604::678     5e-04  35%  736 aa  RH21_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 21;   
  534::676     5e-04  25%  733 aa  RH21_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 21;   
  463::543     5e-04  33%  575 aa  PRP28_PICGU RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
  165::371     5e-04  26%  397 aa  FAL1_USTMA RecName: Full=ATP-dependent RNA helicase FAL1;       
  341::586     5e-04  30%  801 aa  DRS1_SCLS1 RecName: Full=ATP-dependent RNA helicase drs1;       
  296::360     5e-04  38%  516 aa  DHH1_DEBHA RecName: Full=ATP-dependent RNA helicase DHH1;       
  158::459     5e-04  24%  602 aa  DDX18_DICDI RecName: Full=Probable ATP-dependent RNA helicase
  124::274     7e-04  28%  513 aa  VF509_ASFWA RecName: Full=Putative ATP-dependent RNA helicase
  124::274     7e-04  28%  509 aa  VF509_ASFB7 RecName: Full=Putative ATP-dependent RNA helicase
  393::548     7e-04  30%  671 aa  UVRB_THEYD RecName: Full=UvrABC system protein B;       
   57::226     7e-04  27%  671 aa  UVRB_PSEU2 RecName: Full=UvrABC system protein B;       
  113::196     7e-04  32% 1242 aa  RGYR1_SULSO RecName: Full=Reverse gyrase 1;Includes:  RecName:
   78::363     7e-04  28%  405 aa  IF4A_CRYPV RecName: Full=Eukaryotic initiation factor 4A;       
  415::504     7e-04  32%  678 aa  DHX58_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  308::439     7e-04  28%  875 aa  DDX10_HUMAN RecName: Full=Probable ATP-dependent RNA helicase
  386::432     7e-04  34%  523 aa  DBP3_YEAST RecName: Full=ATP-dependent RNA helicase DBP3;       
  400::482     7e-04  27%  535 aa  DBP3_LODEL RecName: Full=ATP-dependent RNA helicase DBP3;       
   57::226     0.001  25%  671 aa  UVRB_PSE14 RecName: Full=UvrABC system protein B;       
  524::627     0.001  33%  749 aa  ROK1_ASPTN RecName: Full=ATP-dependent RNA helicase rok1;       
  181::464     0.001  31%  508 aa  RH8_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 8;     
  171::454     0.001  30%  498 aa  RH6_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 6;     
  562::639     0.001  33%  674 aa  PRP28_MAGGR RecName: Full=Pre-mRNA-splicing ATP-dependent RNA
   96::340     0.001  30%  403 aa  IF4A_LEIMA RecName: Full=Probable eukaryotic initiation factor 4A; 
   96::340     0.001  30%  403 aa  IF4A_LEIIN RecName: Full=Probable eukaryotic initiation factor 4A; 
  291::391     0.001  27%  394 aa  FAL1_SCHPO RecName: Full=ATP-dependent RNA helicase fal1;       
  349::559     0.001  27%  808 aa  DRS1_CRYNE RecName: Full=ATP-dependent RNA helicase DRS1;       
  341::586     0.001  30%  801 aa  DRS1_BOTFB RecName: Full=ATP-dependent RNA helicase drs1;       
  557::619     0.001  33%  700 aa  DDX4_XENLA RecName: Full=Probable ATP-dependent RNA helicase DDX4; 
  337::441     0.001  29%  482 aa  DBP5_YEAST RecName: Full=ATP-dependent RNA helicase DBP5;       
  337::441     0.001  29%  482 aa  DBP5_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP5;       
  386::432     0.001  32%  523 aa  DBP3_YEAS7 RecName: Full=ATP-dependent RNA helicase DBP3;       
  397::505     0.001  29%  534 aa  DBP3_PICGU RecName: Full=ATP-dependent RNA helicase DBP3;       
    1::1210

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxRAGRPSSHAPPGDMSLNGLLSVVTGDPALKRAIETARNGHDPLLDLVAPPSVRPLIVAGLAA
MFD_MYCTU       ----------------------------------------------------------------------
MFD_MYCBO       ----------------------------------------------------------------------
MFD_BACSU       ----------------------------------------------------------SARSVFTSALAN
MFD_STAAB       ---------------------------------------------------------------LVTGLSP
MFD_STAAW       ---------------------------------------------------------------LVTGLSP
MFD_STAAS       ---------------------------------------------------------------LVTGLSP
MFD_STAA8       ---------------------------------------------------------------LVTGLSP
MFD_STAA3       ---------------------------------------------------------------LVTGLSP
MFD_STAAN       ---------------------------------------------------------------LVTGLSP
MFD_STAAM       ---------------------------------------------------------------LVTGLSP
MFD_STAAR       ---------------------------------------------------------------LVTGLSP
MFD_STAS1       -----------------------------------------------------------------ATIIA
MFD_STAHJ       ----------------------------------------------GHQNILVTGLSPSAKATIIA----
MFD_HAEIN       ----------------------------------------------------------------------
MFD_STAES       ----------------------------------------------------------------------
MFD_STAEQ       ----------------------------------------------------------------------
MFD_SYNY3       --------------------------------------------KRGHVQLSGLPRLP--KGLIVSSLAQ
MFD_STAAC       ---------------------------------------------------------------LVTGLSP
MFD_MYXXA       ----------------------------------------------------------------------
MFD_ECOLI       -----------------------------------------------------------------ATLVA
MFD_BORBU       ----------------------------------------------------------------------
MFD_BUCAI       ----------------------------------------------------------------------
MFD_RICFE       ----------------------------------------------------------------------
MFD_RICBR       ----------------------------------------------------------------------
MFD_RICCN       ----------------------------------------------------------------------
MFD_HELPJ       ----------------------------------------------------------------------
MFD_BUCBP       ----------------------------------------------------------------------
MFD_HELPY       ----------------------------------------------------------------------
MFD_RICPR       ----------------------------------------------------------------------
MFD_RICTY       ----------------------------------------------------------------------
RECG_BORBU      ----------------------------------------------------------------------
RECG_STRPN      ----------------------------------------------------------------------
RECG_PASMU      ----------------------------------------------------------------------
RECG_TREPA      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
RECG_AQUAE      ----------------------------------------------------------------------
RECG_HAEIN      ----------------------------------------------------------------------
RECG_ECOLI      ----------------------------------------------------------------------
RECG_ECO57      ----------------------------------------------------------------------
RECG_STAES      ----------------------------------------------------------------------
RECG_STAEQ      ----------------------------------------------------------------------
RECG_BACSU      ----------------------------------------------------------------------
RECG_STAAW      ----------------------------------------------------------------------
RECG_STAAS      ----------------------------------------------------------------------
RECG_STAAN      ----------------------------------------------------------------------
RECG_STAAM      ----------------------------------------------------------------------
RECG_STAAR      ----------------------------------------------------------------------
RECG_MYCLE      ----------------------------------------------------------------------
RECG_STAAC      ----------------------------------------------------------------------
RECG_STAA8      ----------------------------------------------------------------------
RECG_MYCTU      ----------------------------------------------------------------------
RECG_MYCBO      ----------------------------------------------------------------------
RECG_HELPJ      ----------------------------------------------------------------------
RECG_HELPY      ----------------------------------------------------------------------
RECG_THIFE      ----------------------------------------------------------------------
UVRB_GEMAT      ----------------------------------------------------------------------
UVRB_BEUC1      ----------------------------------------------------------------------
UVRB_STRCO      ----------------------------------------------------------------------
UVRB_GEOSL      ---------------------------------------------------------------------A
UVRB_NATPD      ----------------------------------------------------------------------
UVRB_HALSA      ----------------------------------------------------------------------
Y1401_METJA     ----------------------------------------------------------------------
UVRB_RENSM      ----------------------------------------------------------------------
UVRB_ENTFA      ----------------------------------------------------------------------
UVRB_LACLS      ----------------------------------------------------------------------
UVRB_LACLM      ----------------------------------------------------------------------
UVRB_LACLA      ----------------------------------------------------------------------
UVRB_CHLAD      -------------------------------TGDQAIEKLVAGLRAGYRHQTLLGATGTGKTFVMAHIFA
UVRB_CLONN      ----------------------------------------------------------------------
UVRB_CLOB6      ----------------------------------------------------------------------
UVRB_BACHK      -------------SAYSPQGDQPV-----------AIEKLVEGINSGKKKQVLLGATGTGKTFTISNVIK
UVRB_BACCZ      -------------SAYSPQGDQPV-----------AIEKLVEGINSGKKKQVLLGATGTGKTFTISNVIK
UVRB_BACCR      -------------SAYSPQGDQPV-----------AIEKLVEGINSGKKKQVLLGATGTGKTFTISNVIK
UVRB_BACC1      -------------SAYSPQGDQPV-----------AIEKLVEGINSGKKKQVLLGATGTGKTFTISNVIK
UVRB_BACAN      -------------SAYSPQGDQPV-----------AIEKLVEGINSGKKKQVLLGATGTGKTFTISNVIK
UVRB_STRS7      ----------------------------------------------------------------------
UVRB_STRS2      ----------------------------------------------------------------------
UVRB_STREM      ----------------------------------------------------------------------
UVRB_STRA5      ----------------------------------------------------------------------
UVRB_STRA3      ----------------------------------------------------------------------
UVRB_STRA1      ----------------------------------------------------------------------
UVRB_LISMO      ----------------------------------------------------------------------
UVRB_LISMF      ----------------------------------------------------------------------
UVRB_LISIN      ----------------------------------------------------------------------
UVRB_STRE4      ----------------------------------------------------------------------
UVRB_PROAC      ----------------------------------------------------------------------
UVRB_CLOBM      ----------------------------------------------------------------------
UVRB_CLOBL      ----------------------------------------------------------------------
UVRB_CLOBK      ----------------------------------------------------------------------
UVRB_CLOBJ      ----------------------------------------------------------------------
UVRB_CLOB1      ----------------------------------------------------------------------
UVRB_SYNP6      ----------------------------------------------------------------------
UVRB_SYNE7      ----------------------------------------------------------------------
UVRB_STRU0      ----------------------------------------------------------------------
UVRB_LACPL      ----------------------------------------------------------------------
UVRB_GEOKA      ----------------------------------------------------------------------
UVRB_PROM3      -----------------------------------AIARLVEGVNQGQRYQTLLGATGTGKTFTIANLIA
UVRB_HALMA      ----------------------------------------------------------------------
UVRB_STAES      ----------------------------------------------------------------------
UVRB_STAEQ      ----------------------------------------------------------------------
UVRB_DESDG      ----------------------------------------------------------------------
UVRB_DESVM      ----------------------------------------------------------------------
UVRB_CLOTE      ----------------------------------------------------------------------
UVRB_BACA2      ----------------------------------------------------------------------
UVRB_CLOBB      ----------------------------------------------------------------------
UVRB_CLOBA      ----------------------------------------------------------------------
UVRB_BACLD      ----------------------------------------------------------------------
UVRB_ARTCA      ----------------------------------------------------------------------
UVRB_AQUAE      -----------------------------------AIKKLLENLRKGVKEQTLLGVTGSGKTFTLANVIA
UVRB_STAS1      ----------------------------------------------------------------------
UVRB_STAHJ      ----------------------------------------------------------------------
UVRB_BIFLI      ----------------------------------------------------------------------
UVRB_STRSV      ----------------------------------------------------------------------
UVRB_STRGC      ----------------------------------------------------------------------
UVRB_MICLC      ----------------------------------------------------------------------
UVRB_LACJO      ----------------------------------------------------------------------
UVRB_BACSU      ----------------------------------------------------------------------
UVRB_STRZT      ----------------------------------------------------------------------
UVRB_STRZP      ----------------------------------------------------------------------
UVRB_STRZJ      ----------------------------------------------------------------------
UVRB_STRR6      ----------------------------------------------------------------------
UVRB_STRPS      ----------------------------------------------------------------------
UVRB_STRPN      ----------------------------------------------------------------------
UVRB_STRPJ      ----------------------------------------------------------------------
UVRB_STRPI      ----------------------------------------------------------------------
UVRB_STRP7      ----------------------------------------------------------------------
UVRB_STRP4      ----------------------------------------------------------------------
UVRB_STRP2      ----------------------------------------------------------------------
UVRB_PROMM      -----------------------------------AIARLVEGVNQGQRYQTLLGATGTGKTFTIANLIA
UVRB_PROM0      -----------------------------------AIKKLVKGVNTGKEFQTLLGATGTGKTFTIANVIQ
UVRB_LACSS      ----------------------------------------------------------------------
UVRB_ARTS2      ----------------------------------------------------------------------
UVRB_ARTAT      ----------------------------------------------------------------------
PRIA_ECOLI      ----------------------------------------------------------------------
UVRB_CYAP7      ----------------------------------------------------------------------
UVRB_BACCA      ----------------------------------------------------------------------
UVRB_VIBF1      -----------------------------------AIKTLNEGLENGHQTLLGVTG--SGKTFTLANVIA
UVRB_THEFY      ----------------------------------------------------------------------
UVRB_STRPZ      ----------------------------------------------------------------------
UVRB_STRPM      ----------------------------------------------------------------------
UVRB_STRPG      ----------------------------------------------------------------------
UVRB_STRPF      ----------------------------------------------------------------------
UVRB_STRPC      ----------------------------------------------------------------------
UVRB_STRPB      ----------------------------------------------------------------------
UVRB_STRP8      ----------------------------------------------------------------------
UVRB_STRP6      ----------------------------------------------------------------------
UVRB_STRP3      ----------------------------------------------------------------------
UVRB_STRP1      ----------------------------------------------------------------------
UVRB_STRMU      ----------------------------------------------------------------------
UVRB_STAAW      ----------------------------------------------------------------------
UVRB_STAAS      ----------------------------------------------------------------------
UVRB_STAAR      ----------------------------------------------------------------------
UVRB_STAAN      ----------------------------------------------------------------------
UVRB_STAAM      ----------------------------------------------------------------------
UVRB_STAAC      ----------------------------------------------------------------------
UVRB_MYCTU      ----------------------------------------------------------------------
UVRB_MYCBO      ----------------------------------------------------------------------
UVRB_LACBA      ----------------------------------------------------------------------
UVRB_HERA2      ----------------------------------------------------------------------
UVRB_DEHSC      ----------------------------------------------------------------------
UVRB_RHOBA      ----------------------------------------------------------------------
UVRB_LEIXX      ----------------------------------------------------------------------
UVRB_LACCB      ----------------------------------------------------------------------
UVRB_LACC3      ----------------------------------------------------------------------
PRIA_CHLPN      ----------------------------------------------------------------------
COMFA_BACSU     ----------------------------------------------------------------------
UVRB_STRPD      ----------------------------------------------------------------------
UVRB_PSYIN      ---------------------------------------------------------------------A
UVRB_PROMP      -----------------------------------AIKKLVQGVNSGEEFQTLLGATGTGKTFTIANVIQ
UVRB_LACGA      ----------------------------------------------------------------------
UVRB_ANASP      ----------------------------------------------------------------------
UVRB_ALISL      -----------------------------------AIKTLNEGLENGHQTLLGVTG--SGKTFTLANVIA
UVRB_BIFLO      ----------------------------------------------------------------------
UVRB_TROW8      ----------------------------------------------------------------------
UVRB_PROMT      -----------------------------------AIKGLVGGVNDGEKFQTLLGATGTGKTFTIANLIA
UVRB_PROM1      -----------------------------------AIKGLVGGVNDGEKFQTLLGATGTGKTFTIANLIA
UVRB_DESVV      ---------------------------------------------------------------------A
UVRB_DESVH      ---------------------------------------------------------------------A
UVRB_BACSK      ----------------------------------------------------------------------
UVRB_STRT2      ----------------------------------------------------------------------
UVRB_STRT1      ----------------------------------------------------------------------
UVRB_CHLL2      -------------SSYSPKGDQP-----------KAIEQLVEGVQRGDRWQTLLGVTGSGKTFTISNLIA
UVRB_THICR      ----------------------------------------------------------------------
UVRB_SYMTH      -------------------------------TGDQAIERLSEGVRRGAREQILLGATGTGKTFTIAKVIE
UVRB_STRTD      ----------------------------------------------------------------------
UVRB_MYCUA      ----------------------------------------------------------------------
PRIA_BACSU      ----------------------------------------------------------------------
UVRB_NITOC      ----------------------------------------------------------------------
UVRB_MICAN      -------------------------------TGDQAIDQLVDSLQNQHRFQTLLGATGTGKTFTIAAVIE
UVRB_CYAP4      ----------------------------------------------------------------------
PRIA_HAEIN      ----------------------------------------------------------------------
UVRB_SYNY3      -------------------------------TGDQAIASLIESLQGEHKFQTLLGATGTGKTFTMASVIA
UVRB_MYCLE      ----------------------------------------------------------------------
UVRB_METCA      -------------SGYAPSGDQP-----------EAIRRLVEGLNDGHQTLLGVTG--SGKTFTIANVIA
UVRB_CLOB8      ----------------------------------------------------------------------
UVRB_THETN      -------------------------------TGDQAIEKLVEGVRRGYRYQTLLGVTGSGKTFTMANIIA
UVRB_PHOLL      ---------------------------------------------------------------------A
UVRB_NEIMB      ----------------------------------------------------------------------
UVRB_VIBPA      -----------------------------------AIKQLLEGLDAGHQTLLGVTG--SGKTFTLANVIA
UVRB_NEIMA      ----------------------------------------------------------------------
UVRB_NEIGO      ----------------------------------------------------------------------
UVRB_NEIG1      ----------------------------------------------------------------------
UVRB_NATTJ      ----------------------------------------------------------------------
UVRB_BACHD      ----------------------------------------------------------------------
UVRB_AZOSE      ----------------------------------------------------------------------
UVRB_VIBVY      -------------SDYAPSGDQPT-----------AIKQLTEGLDAGHQTLLGVTG--SGKTFTLANVIA
UVRB_VIBVU      -------------SDYAPSGDQPT-----------AIKQLTEGLDAGHQTLLGVTG--SGKTFTLANVIA
UVRB_SYNPX      -----------------------------------AIKQLVQGVNGGERYQTLLGATGTGKTFTMANVIA
UVRB_PHOPR      -----------------------------------AINQLLEGLDSGHQTLLGVTG--SGKTFTIANVIA
UVRB_CLOPS      ----------------------------------------------------------------------
UVRB_CLOPE      ----------------------------------------------------------------------
UVRB_CLOP1      ----------------------------------------------------------------------
UVRB_SYNJA      ----------------------------------------------------------------------
UVRB_PROM4      ----------------------------------------------------------------------
UVRB_ACAM1      ----------------------------------------------------------------------
UVRB_HELHP      ----------------------------------------------------------------------
UVRB_DECAR      ----------------------------------------------------------------------
PRIA_RICBR      ----------------------------------------------------------------------
UVRB_OCEIH      ----------------------------------------------------------------------
UVRB_LACAC      ----------------------------------------------------------------------
UVRB_CARHZ      ---------------------------------------------------------------------A
PRIA_RICFE      ----------------------------------------------------------------------
UVRB_SYNS3      -----------------------------------AISKLVEGVNGGERYQTLLGATGTGKTFTMANVIA
UVRB_LEPIN      ----------------------------------------------------------------------
UVRB_LEPIC      ----------------------------------------------------------------------
UVRB_DEHE1      ----------------------------------------------------------------------
UVRB_SYNPW      ----------------------------------------------------------------------
UVRB_PELCD      ----------------------------------------------------------------------
UVRB_LEPBL      ----------------------------------------------------------------------
UVRB_LEPBJ      ----------------------------------------------------------------------
UVRB_SYNJB      ----------------------------------------------------------------------
UVRB_PROMA      -----------------------------------AITKLVDGVNSGREYQTLLGATGTGKTFTIANVIA
UVRB_FUSNN      ----------------------------------------------------------------------
UVRB_PSEAE      -----------------------------------AIRQMVEGLEAGHQTLLGVTG--SGKTFSIANVIA
UVRB_METBU      ----------------------------------------------------------------------
PRIA_RICCN      ----------------------------------------------------------------------
UVRB_ZYMMO      ----------------------------------------------------------------------
UVRB_THENN      ----------------------------------------------------------------------
UVRB_THEEB      ----------------------------------------------------------------------
UVRB_STRAW      ----------------------------------------------------------------------
UVRB_PASMU      -----------------------------------AITQLIEGLENGHQTLLGVTG--SGKTFTIANVIA
UVRB_IDILO      ----------------------------------------------------------------------
UVRB_TREDE      ----------------------------------------------------------------------
UVRB_PECCP      -----------------------------------AIRRLKEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_CAMJR      ----------------------------------------------------------------------
UVRB_CAMJE      ----------------------------------------------------------------------
PRIA_CHLTR      ----------------------------------------------------------------------
UVRB_THESQ      ----------------------------------------------------------------------
UVRB_THEP1      ----------------------------------------------------------------------
UVRB_THEMA      ----------------------------------------------------------------------
UVRB_THEAB      ----------------------------------------------------------------------
UVRB_CLAMS      ----------------------------------------------------------------------
UVRB_CLAM3      ----------------------------------------------------------------------
UVRB_ACIAD      -----------------------------------AIKKLVSGIEQGNRNQLLLGVTGSGKTYTMANVIA
PRIA_RICPR      ----------------------------------------------------------------------
UVRB_HAEIN      -----------------------------------AIEKLAENLTDGHQTLLGVTG--SGKTFTIANVIA
UVRB_HAEI8      -----------------------------------AIEKLAENLTDGHQTLLGVTG--SGKTFTIANVIA
UVRB_HAEDU      --------KPGKPSPFAPSGDQP-----------SAIKKLTEGLQDGHQTLLGVTG--SGKTFTIANVIA
UVRB_FRATT      ----------------------------------------------------------------------
UVRB_ERWCT      -----------------------------------AIRRLKEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_COXBU      ----------------------------------------------------------------------
UVRB_COXBR      ----------------------------------------------------------------------
UVRB_COXBN      ----------------------------------------------------------------------
UVRB_COXB2      ----------------------------------------------------------------------
UVRB_COXB1      ----------------------------------------------------------------------
UVRB_CAMFF      ----------------------------------------------------------------------
UVRB_CLOAB      ----------------------------------------------------------------------
UVRB_CHLPD      ----------------------------------------------------------------------
UVRB_ACTP2      ----------------------------------------------------------------------
DDX52_MOUSE     ----------------------------------------------------------------------
UVRB_PROMH      ---------------------------------------------------------------------A
UVRB_HAMD5      -----------------------------------AIHQLKEGLKNGHQTLLGVTG--SGKTFTVANVIA
UVRB_FERNB      ----------------------------------------------------------------------
UVRB_CHLTE      ----------------------------------------------------------------------
UVRB_CHLCH      ----------------------------------------------------------------------
PRIA_RICTY      ----------------------------------------------------------------------
DDX52_RAT       ----------------------------------------------------------------------
DDX42_XENLA     ----------------------------------------------------------------------
UVRB_RICRS      ----------------------------------------------------------------------
UVRB_RICRO      ----------------------------------------------------------------------
UVRB_RICPU      ----------------------------------------------------------------------
UVRB_RICCN      ----------------------------------------------------------------------
UVRB_RICAE      ----------------------------------------------------------------------
UVRB_HELPY      ----------------------------------------------------------------------
UVRB_HELPJ      ----------------------------------------------------------------------
UVRB_HELPH      ----------------------------------------------------------------------
UVRB_HELAH      ----------------------------------------------------------------------
UVRB_CAMHC      ----------------------------------------------------------------------
PRIA_CHLMU      ----------------------------------------------------------------------
UVRB_METST      ----------------------------------------------------------------------
DDX52_HUMAN     ----------------------------------------------------------------------
DDX42_MOUSE     ----------------------------------------------------------------------
UVRB_YERE8      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_THIDA      ----------------------------------------------------------------------
UVRB_THET8      ----------------------------------------------------------------------
UVRB_SERP5      -----------------------------------------------HQTLLGVTG--SGKTFTVANVIA
UVRB_PSEPF      ----------------------------------------------------------------------
UVRB_ENT38      -----------------------------------AIRRLKEGLEDGHQTLLGVTG--SGKTFTVANVIA
UVRB_SHIFL      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SHIF8      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_RICFE      ----------------------------------------------------------------------
UVRB_RICBR      ----------------------------------------------------------------------
UVRB_RICB8      ----------------------------------------------------------------------
UVRB_LEPBP      ----------------------------------------------------------------------
UVRB_LEPBA      ----------------------------------------------------------------------
UVRB_CHLPB      ----------------------------------------------------------------------
UVRB_RICM5      ----------------------------------------------------------------------
UVRB_MANSM      ----------------------------------------------------------------------
UVRB_CHRVO      ----------------------------------------------------------------------
DDX52_BOVIN     ----------------------------------------------------------------------
DDX42_PONAB     ----------------------------------------------------------------------
DDX42_HUMAN     ----------------------------------------------------------------------
UVRB_YERPY      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_YERPS      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_YERPP      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_YERPN      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_YERPG      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_YERPE      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_YERPB      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_YERP3      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_KOSOT      ----------------------------------------------------------------------
RH3_ARATH       ----------------------------------------------------------------------
UVRB_RICAH      ----------------------------------------------------------------------
DDX42_CHICK     ----------------------------------------------------------------------
UVRB_PARUW      ----------------------------------------------------------------------
UVRB_LEGPL      ----------------------------------------------------------------------
UVRB_LEGPH      ----------------------------------------------------------------------
UVRB_LEGPC      ----------------------------------------------------------------------
UVRB_LEGPA      ----------------------------------------------------------------------
UVRB_RICPR      ----------------------------------------------------------------------
UVRB_RALEJ      ----------------------------------------------------------------------
UVRB_NITEU      ----------------------------------------------------------------------
UVRB_MYCMO      ----------------------------------------------------------------------
UVRB_COLP3      ----------------------------------------------------------------------
UVRB_XANAC      ----------------------------------------------------------------------
UVRB_RICTY      ----------------------------------------------------------------------
RH51_ORYSJ      ----------------------------------------------------------------------
PRIA_HELPY      ----------------------------------------------------------------------
PRIA_HELPJ      ----------------------------------------------------------------------
UVRB_YERPA      -----------------------------------AIRKLEEGLENGHQTLLGVTG--SGKTFTVANVIA
UVRB_WOLSU      ----------------------------------------------------------------------
UVRB_THELT      ----------------------------------------------------------------------
DDX55_MOUSE     ----------------------------------------------------------------------
UVRB_METMP      ----------------------------------------------------------------------
UVRB_ERWT9      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTVANVIA
UVRB_ANATD      ----------------------------------------------------------------------
MS116_CANGA     ----------------------------------------------------------------------
DDX55_BOVIN     ----------------------------------------------------------------------
UVRB_RICCK      ----------------------------------------------------------------------
RH9_ORYSJ       ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DDX42_DICDI     ----------------------------------------------------------------------
UVRB_XANOR      ----------------------------------------------------------------------
UVRB_XANOP      ----------------------------------------------------------------------
UVRB_XANOM      ----------------------------------------------------------------------
UVRB_XANCP      ----------------------------------------------------------------------
UVRB_XANCB      ----------------------------------------------------------------------
UVRB_XANC8      ----------------------------------------------------------------------
UVRB_RALSO      ----------------------------------------------------------------------
UVRB_BORPD      ----------------------------------------------------------------------
UVRB_ANAMM      ----------------------------------------------------------------------
RH3_ORYSJ       ----------------------------------------------------------------------
UVRB_GLOVI      ----------------------------------------------------------------------
UVRB_ANAMF      ----------------------------------------------------------------------
DDX55_DANRE     ----------------------------------------------------------------------
UVRB_PSEHT      ----------------------------------------------------------------------
UVRB_METTH      ----------------------------------------------------------------------
UVRB_BACFR      ---------------------------------------------------------------------A
UVRB_BACFN      ---------------------------------------------------------------------A
RH51_ARATH      ----------------------------------------------------------------------
DDX55_CHICK     ----------------------------------------------------------------------
UVRB_XYLFT      ----------------------------------------------------------------------
UVRB_XYLFM      ----------------------------------------------------------------------
UVRB_XYLFA      ----------------------------------------------------------------------
UVRB_XYLF2      ----------------------------------------------------------------------
UVRB_METMA      ----------------------------------------------------------------------
UVRB_EDWI9      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_BORA1      ----------------------------------------------------------------------
PRIA_RHORU      ----------------------------------------------------------------------
DRS1_YARLI      ----------------------------------------------------------------------
UVRB_KLEP7      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_KLEP3      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_BORPA      ----------------------------------------------------------------------
UVRB_BORBR      ----------------------------------------------------------------------
DDX55_HUMAN     ----------------------------------------------------------------------
UVRB_SALPK      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALPA      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_METS3      ----------------------------------------------------------------------
MPH1_KLULA      ----------------------------------------------------------------------
DRS1_PICGU      ----------------------------------------------------------------------
DDX55_XENLA     ----------------------------------------------------------------------
UVRB_SHISS      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SHIDS      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SHIBS      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SHIB3      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALTY      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALTI      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALSV      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALPC      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALPB      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALNS      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALHS      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALG2      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALEP      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALDC      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALCH      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALAR      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_SALA4      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_RHILO      ----------------------------------------------------------------------
UVRB_METAC      ----------------------------------------------------------------------
UVRB_ESCF3      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOUT      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOSM      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOSE      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOLU      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOLI      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOLC      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOL5      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOK1      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOHS      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECODH      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECOBW      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECO8A      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECO81      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECO7I      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECO5E      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECO57      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECO55      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECO45      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECO27      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_ECO24      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
UVRB_CALS8      ----------------------------------------------------------------------
UVRB_BACTN      ---------------------------------------------------------------------A
RH55_ARATH      ----------------------------------------------------------------------
RH49_ARATH      ----------------------------------------------------------------------
PRIA_TREPA      ----------------------------------------------------------------------
UVRB_WOLTR      ----------------------------------------------------------------------
UVRB_CITK8      -----------------------------------AIRRLEEGLEDGHQTLLGVTG--SGKTFTIANVIA
ROK1_SCHPO      ----------------------------------------------------------------------
DRS1_PICST      ----------------------------------------------------------------------
DRS1_ASHGO      ----------------------------------------------------------------------
DDX55_DROME     ----------------------------------------------------------------------
UVRB_ANAPZ      ----------------------------------------------------------------------
RRP3_PICGU      ----------------------------------------------------------------------
PRIA_SYNY3      ----------------------------------------------------------------------
HAS1_MAGGR      ----------------------------------------------------------------------
DRS1_NEUCR      ----------------------------------------------------------------------
UVRB_BURPS      ----------------------------------------------------------------------
UVRB_BURMA      ----------------------------------------------------------------------
RRP3_ENCCU      ----------------------------------------------------------------------
MPH1_CANGA      ----------------------------------------------------------------------
IF4A_DROME      ----------------------------------------------------------------------
HAS1_GIBZE      ----------------------------------------------------------------------
DRS1_CANAL      ----------------------------------------------------------------------
DDX52_DICDI     ----------------------------------------------------------------------
UVRB_MYCPE      ----------------------------------------------------------------------
RHLB_ALISL      ----------------------------------------------------------------------
RH53_ARATH      ----------------------------------------------------------------------
RH7_ORYSJ       ----------------------------------------------------------------------
MFH1_SCHPO      ----------------------------------------------------------------------
UVRB_EUBR3      ---------------------------------------------------------------------A
UVRB_CHLCV      ---------------------------------------------------------------------A
UVRB_BORPE      ----------------------------------------------------------------------
RH9_ARATH       ----------------------------------------------------------------------
DRS1_KLULA      ----------------------------------------------------------------------
DRS1_CANGA      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
RRP3_CANAL      ----------------------------------------------------------------------
RH32_ARATH      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
MPH1_MAGGR      ----------------------------------------------------------------------
DDX4_MOUSE      ----------------------------------------------------------------------
DDX4_BOVIN      ----------------------------------------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
UVRB_CORDI      ----------------------------------------------------------------------
ROK1_YARLI      ----------------------------------------------------------------------
RH5_ORYSJ       ----------------------------------------------------------------------
IF4A_TRYBB      ----------------------------------------------------------------------
DDX4_MACFA      ----------------------------------------------------------------------
DDX4_HUMAN      ----------------------------------------------------------------------
DBP3_KLULA      ----------------------------------------------------------------------
Y383_METJA      ----------------------------------------------------------------------
RH18_ARATH      ----------------------------------------------------------------------
IRC3_SCHPO      ----------------------------------------------------------------------
IF4A_TRYCR      ----------------------------------------------------------------------
DDX4_RAT        ----------------------------------------------------------------------
DBP4_ENCCU      ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
UVRB_TREPS      ----------------------------------------------------------------------
UVRB_TREPA      ----------------------------------------------------------------------
RHLB_PSEA6      ----------------------------------------------------------------------
DRS1_GIBZE      ----------------------------------------------------------------------
DRS1_DEBHA      ----------------------------------------------------------------------
DDX4_PIG        ----------------------------------------------------------------------
DDX10_CHICK     ----------------------------------------------------------------------
UVRB_PSEPK      ----------------------------------------------------------------------
UVRB_PSEF5      ----------------------------------------------------------------------
MPH1_YEAST      ----------------------------------------------------------------------
MPH1_YEAS7      ----------------------------------------------------------------------
UVRB_ONYPE      ----------------------------------------------------------------------
UVRB_AYWBP      ----------------------------------------------------------------------
RH7_ARATH       ----------------------------------------------------------------------
PRP11_SCHPO     ----------------------------------------------------------------------
MPH1_VANPO      ----------------------------------------------------------------------
IF4A_LEIBR      ----------------------------------------------------------------------
DRS1_PHANO      ----------------------------------------------------------------------
DRS1_NEOFI      ----------------------------------------------------------------------
DRS1_ASPFU      ----------------------------------------------------------------------
DCL1_NEUCR      ----------------------------------------------------------------------
DBP3_CANGA      ----------------------------------------------------------------------
DBP3_ASPFU      ----------------------------------------------------------------------
VF509_ASFP4     ----------------------------------------------------------------------
VASA_DROME      ----------------------------------------------------------------------
UVRB_PSESM      ----------------------------------------------------------------------
UVRB_CHLAB      ---------------------------------------------------------------------A
ROK1_PICGU      ----------------------------------------------------------------------
RH21_ORYSJ      ----------------------------------------------------------------------
RH21_ARATH      ----------------------------------------------------------------------
PRP28_PICGU     ----------------------------------------------------------------------
FAL1_USTMA      ----------------------------------------------------------------------
DRS1_SCLS1      ----------------------------------------------------------------------
DHH1_DEBHA      ----------------------------------------------------------------------
DDX18_DICDI     ----------------------------------------------------------------------
VF509_ASFWA     ----------------------------------------------------------------------
VF509_ASFB7     ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PSEU2      ----------------------------------------------------------------------
RGYR1_SULSO     ----------------------------------------------------------------------
IF4A_CRYPV      ----------------------------------------------------------------------
DHX58_HUMAN     ----------------------------------------------------------------------
DDX10_HUMAN     ----------------------------------------------------------------------
DBP3_YEAST      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_PSE14      ----------------------------------------------------------------------
ROK1_ASPTN      ----------------------------------------------------------------------
RH8_ORYSJ       ----------------------------------------------------------------------
RH6_ORYSJ       ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
IF4A_LEIMA      ----------------------------------------------------------------------
IF4A_LEIIN      ----------------------------------------------------------------------
FAL1_SCHPO      ----------------------------------------------------------------------
DRS1_CRYNE      ----------------------------------------------------------------------
DRS1_BOTFB      ----------------------------------------------------------------------
DDX4_XENLA      ----------------------------------------------------------------------
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP3_YEAS7      ----------------------------------------------------------------------
DBP3_PICGU      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           DAPVGAGRPVLALTATEREAADLNSALGSLLPADSVALFPAWETLPHERLSPRSDTVGQRLAVLRRLTHP
MFD_MYCTU       --------PLLVVTATGREADDLAAELRGVF-GDAVALLPSWETLPHERLSPGVDTVGTRLMALRRLAHP
MFD_MYCBO       --------PLLVVTATGREADDLAAELRGVF-GDAVALLPSWETLPHERLSPGVDTVGTRLMALRRLAHP
MFD_BACSU       ET----NKPIFLITHNLYQAQKVTDDLTSLLEDRSVLLYPVNELISSEIAVASPELRAQRLDVINRLTNG
MFD_STAAB       SAKVTSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRTLTALAQG
MFD_STAAW       SAKVTSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRTLTALAQG
MFD_STAAS       SAKVTSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRTLTALAQG
MFD_STAA8       SAKVTSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRTLTALAQG
MFD_STAA3       SAKVTSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRTLTALAQG
MFD_STAAN       SAKVTSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRTLTALAQG
MFD_STAAM       SAKVTSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRTLTALAQG
MFD_STAAR       SAKVTSNQQLLLITNNLYQADKLETDLLQFVDVEELYKYPVQDIMTEEFSTQSPQLMSERIRTLTALAQG
MFD_STAS1       EKYLNSEQQLLVVTNNLYQADKLESDLLQFVEDSEIYKYPMQDIMTEEFSTQSPQFMSERVRTLTALAQE
MFD_STAHJ       EKYLKDQKQMLLITNNLYQADKLETDILQYIDHSEVYKYPVQDIMTEEFSTQSPQLMSERVRTLTALAHN
MFD_HAEIN       -----------------------------------VCLFPDWETLPYDTFSPHQEIISSRLSALFHLQN-
MFD_STAES       ----------------------------------------------------------------------
MFD_STAEQ       ----------------------------------------------------------------------
MFD_SYNY3       SLE----KNLLVITATLEEAGRWTAQL-ELMGWQTVNFYPTSEASPYDPGRLESEMVWGQMQVLAELIQG
MFD_STAAC       SAKVTSNQQLLLITNNLYQADKLETDLLQFIDAEELYKYPVQDIMTEEFSTQSPQLMSERIRTLTALAQG
MFD_MYXXA       --------------------------------APRVLRLPADEVLPYDEVSPDAAAVTERLGALFHLGQG
MFD_ECOLI       EIAERHAGPVVLIAPDMQNALRLHDEI-SQFTDQMVMNLADWETLPYDSFSPHQDIISSRLSTLYQLP--
MFD_BORBU       ----------------------------------------------------------------------
MFD_BUCAI       ----------------------------------------------------------------------
MFD_RICFE       -------------SSNEDEALQLYKQALFFSSNENIYYFPSYDTIPYDHTSPNANILSRRAEILTKLTTN
MFD_RICBR       ------------VTSNEEEALQLYKQALFFLPSENIYYFPSYDTIPYDHTSPNCNILSKRAETLSKLTTN
MFD_RICCN       ----------------------------------------------------------------------
MFD_HELPJ       ----------------------------------------------------------------------
MFD_BUCBP       ----------------------------------------------------------------------
MFD_HELPY       ----------------------------------------------------------------------
MFD_RICPR       ----------------------------------------------------------------------
MFD_RICTY       ----------------------------------------------------------------------
RECG_BORBU      ----------------------------------------------------------------------
RECG_STRPN      ----------------------------------------------------------------------
RECG_PASMU      ----------------------------------------------------------------------
RECG_TREPA      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
RECG_AQUAE      ----------------------------------------------------------------------
RECG_HAEIN      ----------------------------------------------------------------------
RECG_ECOLI      ----------------------------------------------------------------------
RECG_ECO57      ----------------------------------------------------------------------
RECG_STAES      ----------------------------------------------------------------------
RECG_STAEQ      ----------------------------------------------------------------------
RECG_BACSU      ----------------------------------------------------------------------
RECG_STAAW      ----------------------------------------------------------------------
RECG_STAAS      ----------------------------------------------------------------------
RECG_STAAN      ----------------------------------------------------------------------
RECG_STAAM      ----------------------------------------------------------------------
RECG_STAAR      ----------------------------------------------------------------------
RECG_MYCLE      ----------------------------------------------------------------------
RECG_STAAC      ----------------------------------------------------------------------
RECG_STAA8      ----------------------------------------------------------------------
RECG_MYCTU      ----------------------------------------------------------------------
RECG_MYCBO      ----------------------------------------------------------------------
RECG_HELPJ      ----------------------------------------------------------------------
RECG_HELPY      ----------------------------------------------------------------------
RECG_THIFE      ----------------------------------------------------------------------
UVRB_GEMAT      ------GRPTLVLSHNKTLAAQLYGELKSFFPNNAVEYFISYDYYQPEAYVPSSDTYIEKDASINRLRLR
UVRB_BEUC1      -------RPTLVMAPNKTLAAQLATEFRELLPNNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSINRLRHS
UVRB_STRCO      -------RPTLVMAPNKTLAAQLANEFRELLPNNAVEYFVSYDYYQPEAYVPQSDTYIEKDSSINRLRHS
UVRB_GEOSL      NVIAAVNRPALVLAPNKTLAAQLYGEFRELFPDNAVEYFVSYDYYQPEAYIPTTDTFIEKDSSINKLRHA
UVRB_NATPD      -------QPTLVLAHNKTLAAQLYEEFRELFPDNAVEYFVSYDYYQPEAYVEQTDTIDKDMSIIERLRHS
UVRB_HALSA      -------QPTLVIAHNKTLAAQLYEEFRSLFPDNAVEYFVSYYNYYQEAYVEQTDKYIEKDASINRLRHS
Y1401_METJA     ----------------------------------------------------------------------
UVRB_RENSM      -------RPTLVMVQNKTLAAQLANEFRELLPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDSSVNRLRYS
UVRB_ENTFA      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSINKLRHS
UVRB_LACLS      ------GKPTLVMAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_LACLM      ------GKPTLVMAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_LACLA      ------GKPTLVMAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_CHLAD      QIQ----RPTLVLAHNKTLVSQLWAEFREFLPDAAVEMFISYDEYTPEAYVPSKDLYIEKEASINRLRHA
UVRB_CLONN      -------KPTLVLAHNKTLAAQLTSEFREFFPENCVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_CLOB6      -----AQKPTLVLAHNKTLAAQLCSEFREFFPNNAVEYFVSYDYYQPEAYVAQSDTYIEKDASINKLRHS
UVRB_BACHK      EVQ----KPTLVMAHNKTLAGQLYSELKDFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDAQINKLRHS
UVRB_BACCZ      EVQ----KPTLVMAHNKTLAGQLYSELKDFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDAQINKLRHS
UVRB_BACCR      EVQ----KPTLVMAHNKTLAGQLYSELKDFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDAQINKLRHS
UVRB_BACC1      EVQ----KPTLVMAHNKTLAGQLYSELKDFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDAQINKLRHS
UVRB_BACAN      EVQ----KPTLVMAHNKTLAGQLYSELKDFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDAQINKLRHS
UVRB_STRS7      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRS2      -------KPTLVIAHNKTLAGQLYSEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STREM      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRA5      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRA3      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRA1      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_LISMO      -------KPTLVMAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPQSDTYIEKDASIN-----
UVRB_LISMF      -------KPTLVMAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPQSDTYIEKDASIN-----
UVRB_LISIN      -------KPTLVMAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPQSDTYIEKDASIN-----
UVRB_STRE4      -------KPTLVVAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_PROAC      -------RPMLVMQPNKTLAAQFAQELRTFFPDNAVEYFVSYDYYQPEAYIPQTDTYIEKDSSLNRLRHS
UVRB_CLOBM      -------KPTLVLAHNKTLAAQLCSEFREFFPNNAVEYFVSYDYYQPEAYVAQSDTYIEKDASINKLRHS
UVRB_CLOBL      -------KPTLVLAHNKTLAAQLCSEFREFFPNNAVEYFVSYDYYQPEAYVAQSDTYIEKDASINKLRHS
UVRB_CLOBK      -------KPTLVLAHNKTLAAQLCSEFREFFPNNAVEYFVSYDYYQPEAYVAQSDTYIEKDASINKLRHS
UVRB_CLOBJ      -------KPTLVLAHNKTLAAQLCSEFREFFPNNAVEYFVSYDYYQPEAYVAQSDTYIEKDASINKLRHS
UVRB_CLOB1      -------KPTLVLAHNKTLAAQLCSEFREFFPNNAVEYFVSYDYYQPEAYVAQSDTYIEKDASINKLRHS
UVRB_SYNP6      ------GRPALVLAHNKTLAAQLCNELREFFPNNAVEYFISYDYYQPEAYIPVTDTYIAKTASINELRHS
UVRB_SYNE7      ------GRPALVLAHNKTLAAQLCNELREFFPNNAVEYFISYDYYQPEAYIPVTDTYIAKTASINELRHS
UVRB_STRU0      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_LACPL      -------KPTLILSHNKTLAGQLYGEFKKFFPNNAVEYFVSYDYYQPEAYVPSSDTYIEKDSAINKLRHS
UVRB_GEOKA      -------KPTLVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYDYYQPEAYVPQTDTYIEKDAKINKLRHS
UVRB_PROM3      QT----GRPALVLAHNKTLAAQLCNEFREFFPDNSVEYFISYDYYQPEAYVPVSDTYIAKTASINELRHS
UVRB_HALMA      -------QPTLVIAHNKTLAAQLYEEFRELFPDNAVEYFVSYDYYQPEAYVEQTDTFIDKDASINRLRHS
UVRB_STAES      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_STAEQ      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_DESDG      -------RPALILAPNKTLAAQLYNEFRALFPHNAVEYFVSYDYYQPEAYVPTSDTYIEKDSSINKLRHA
UVRB_DESVM      ------GRPALVLAPNKTLAAQLYNEFRQLFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSINKLRHA
UVRB_CLOTE      -------KPTLVLAHNKTLAAQLCSEFREFFPENSVEYFVSYDYYQPEAYVAQTDTYIEKDASINKLRHS
UVRB_BACA2      -------KPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_CLOBB      -------RPTLILAHNKTLAAQLCSEFKEFFPENIVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_CLOBA      -------RPTLILAHNKTLAAQLCSEFKEFFPENIVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_BACLD      -------KPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_ARTCA      -------RPTLVMVQNKTLAAQLANEFRELLPNNAVEYFVSYDYYQPEAYVAQTDTFIEKDSSINRLRHS
UVRB_AQUAE      KY----NKPTLVVVHNKILAAQLYREFKELFPENAVEYFVSYDYYQPEAYIPEKDLYIEKDATLERFRHS
UVRB_STAS1      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_STAHJ      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_BIFLI      -------RPTLIIEPNKTLAAQLCAEFRELMPDNAVSYFVSYDYYQPEAYIPQTDTYIEKDSNINRLRHQ
UVRB_STRSV      -------KPTLVIAHNKTLAGQLYGEFKEFFPNNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRGC      -------KPTLVIAHNKTLAGQLYGEFKEFFPNNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_MICLC      -------RPTLVMVQNKTLAAQLANEFRELLPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDSSINRLRHS
UVRB_LACJO      -------KPTLVISHNKTLVGQLYGEFKEFFPKNAVDYFVSYDYYQPEAYVPQSDTYIEKDSSINQLRHK
UVRB_BACSU      -------KPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_STRZT      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRZP      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRZJ      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRR6      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRPS      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRPN      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRPJ      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRPI      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRP7      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRP4      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRP2      -------KPTLVIAHNKTLAGQLYGEFKEFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_PROMM      QT----GRPALVLAHNKTLAAQLCNEFREFFPDNSVEYFISYDYYQPEAYVPVSDTYIAKTSSINELRHS
UVRB_PROM0      QT----GRPALVLAHNKTLAAQLCNELREFFPKNAVEYFISYDYYQPEAYVPVSDTYIAKTASINELRHS
UVRB_LACSS      -------KPTLIISHNKTLAGQLYAEFKQFFPNNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSINKLRHS
UVRB_ARTS2      -------RPTLVMVQNKTLAAQLANEFRELLPNNAVEYFVSYDYYQPEAYVAQTDTFIEKDSSVNRLRHS
UVRB_ARTAT      -------RPTLVMVQNKTLAAQLANEFRELLPNNAVEYFVSYDYYQPEAYVAQTDTFIEKDSSINRLRHS
PRIA_ECOLI      ----------------------------------------------------------------------
UVRB_CYAP7      ------GKPTLVLAHNKTLAAQLCNELRQFFPENAVEYFISYDYYQPEAYIPVSDTYIEKSASINMLRHS
UVRB_BACCA      -------KPTLVIAHNKTLAGQLYSELKEFFPHNAVEYFVSYDYYQPEAYVPQTDTYIEKDAKINKLRHS
UVRB_VIBF1      HS----GRPTIIMAHNKTLAAQLYGEMKAFFPNNAVEYFVSYDYYQPEAYVPTTDTFIEKDSSVNEHIEQ
UVRB_THEFY      -------RPTLVIQPNKTLAAQFANELREMMPHNAVEYFVSYDYYQPEAYVPQTDTYIEKDSSINRLRHS
UVRB_STRPZ      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRPM      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRPG      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRPF      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRPC      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRPB      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRP8      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRP6      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRP3      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRP1      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STRMU      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_STAAW      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_STAAS      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_STAAR      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_STAAN      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_STAAM      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_STAAC      ------GKPTLIIAHNKTLAGQLYSEFKEFFPENRVEYFVSYDYYQPEAYVPSTDTFIEKDASINQLRHS
UVRB_MYCTU      -------RPTLVMAPNKTLAAQLANELREMLPHNAVEYFVSYDYYQPEAYIAQTDTYIEKDSSINRLRHS
UVRB_MYCBO      -------RPTLVMAPNKTLAAQLANELREMLPHNAVEYFVSYDYYQPEAYIAQTDTYIEKDSSINRLRHS
UVRB_LACBA      -------KPTLVLSHNKTLAGQLYGEFKQFFPNNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSINKLRHS
UVRB_HERA2      -------RPTLVMAHNKTLAAQLYAEFKEFFPENAVGYFVSYDAYTPEAYVPSKDLYIEKEAQINRLRHE
UVRB_DEHSC      -------RPTLIISHNKTLAAQLYSEMKEFLPENSVEYFVSYDYYQPEAYVPQKDMYIEKDSDINKLRHA
UVRB_RHOBA      -------RPALILSHNKTLAAQLYGEFKEFFPNNAVHYFVSYDYYQPEAYIPQRDVYIEKDSSINRLRLA
UVRB_LEIXX      -------RPTLVLAHNKTLAAQLANEFRELLPNNAVEYFVSYDYYQPEAYVPQTDTFIEKNAEVERLRHS
UVRB_LACCB      -------KPTLILSHNKTLAGQLYGEFKEFFPHNAVEYFVSYDYYQPEAYVPSTDTYIEKDSAINKLRHS
UVRB_LACC3      -------KPTLILSHNKTLAGQLYGEFKEFFPHNAVEYFVSYDYYQPEAYVPSTDTYIEKDSAINKLRHS
PRIA_CHLPN      ----------------------------------------------------------------------
COMFA_BACSU     ----------------------------------------------------------------------
UVRB_STRPD      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_PSYIN      NAIAKLNRPTLILAPNKTLAAQLYGEMKEFFPNNAVEYFVSYDYYQPEAYVPSSDSFIEKDAAINAHIEQ
UVRB_PROMP      QT----GRPALILAHNKTLAAQLCNELRQFFPKNAVEYFISYDYYQPEAYVPVSDTYIAKTASINELRHS
UVRB_LACGA      -------KPTLVISHNKTLVGQLYGEFKEFFPKNAVDYFVSYDYYQPEAYVPQSDTYIEKDSSINQLRHK
UVRB_ANASP      ------GRPTLVLAHNKTLAAQLCNELREFFPNNAVEYFVSYDYYQPEAYIPVTDTYIEKTAAINMLRHS
UVRB_ALISL      KS----GRPTVIMAHNKTLAAQLYGEMKAFFPNNAVEYFVSYDYYQPEAYVPTTDTFIEKDSSVNEHIEQ
UVRB_BIFLO      -------RPTLIIEPNKTLAAQLCAEFRELMPDNAVSYFVSYDYYQPEAYIPQTDTYIEKDSNINRLRHQ
UVRB_TROW8      -------RPTLIIAHNKTLAAQLANEFRKFFPDNAVEYFVSYDYYQPEAYVPKTDTFIEKDASVNRLRHR
UVRB_PROMT      QT----GRPALVLAHNKTLAAQLCNELREFFPDNAVEYFISYDYYQPEAYVPVSDTYIAKTSSINELRHS
UVRB_PROM1      QT----GRPALVLAHNKTLAAQLCNELREFFPDNAVEYFISYDYYQPEAYVPVSDTYIAKTSSINELRHS
UVRB_DESVV      NVIAACNRPALILAPNKTLAAQLYNEFRALFPDNAVEYFVSYDYYQPEAYVPASDTYIEKDSSINKLRHA
UVRB_DESVH      NVIAACNRPALILAPNKTLAAQLYNEFRALFPDNAVEYFVSYDYYQPEAYVPASDTYIEKDSSINKLRHA
UVRB_BACSK      -------KPTLVMAHNKTLAGQLYSEFKQLFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDASINKLRHS
UVRB_STRT2      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSINKLRHS
UVRB_STRT1      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSINKLRHS
UVRB_CHLL2      QV----GKPVLVMSHNKTLAAQLYGELRQFFPDNAVEYFISYYDFPEAYLPALDKYIAKDLRIIERLRLK
UVRB_THICR      -------RPTIILAHNKTLAAQLYGEMKSFFPHNAVEYFVSYDYYQPEAYVPASDTIAKDSSVNEQIEQL
UVRB_SYMTH      QVQ----KPTLVLAHNKILAAQLCSEFQQFFPENAVEYFVSYDYYQPEAYIPTTDTYIEKDALIN-----
UVRB_STRTD      -------KPTLVIAHNKTLAGQLYGEFKEFFPDNAVEYFVSYDYYQPEAYVPSSDTYIEKDSSVNKLRHS
UVRB_MYCUA      -------RPTLVMAPNKTLAAQLANELREMLPHNAVEYFVSYDYYQPEAYIAQTDTYIEKDSSINRLRHS
PRIA_BACSU      ----------------------------------------------------------------------
UVRB_NITOC      -------RPTIVLAPNKTLAAQLYSEMREFFPRNAVGYFVSYDYYQPEAYVPASDTIGKDASVIEQMRLS
UVRB_MICAN      KI----GRPTLVLAHNKTLAAQLCNELRQFFPNNAVEYFISYDYYQPEAYIPVSDTYIEKSSSINMLRHS
UVRB_CYAP4      ------GKPTLVLAHNKTLAAQLCNELREFFPNNAVEYFISYDYYQPEAYIPVTDTYIEKTAAINELRHS
PRIA_HAEIN      ----------------------------------------------------------------------
UVRB_SYNY3      EL----GRPTLVLAHNKTLAAQLCNELRQFFPENAVEYFISYDYYQPEAYIPVTDTYIEKTASINMLRHS
UVRB_MYCLE      -------RPTLVMAPNKTLAAQLANELRGMLPHNAVEYFVSYDYYQPEAYIAQTDTYIEKDSSINRLRHS
UVRB_METCA      QVQ----RPTLILAHNKTLAAQLYGEMKEFFPENSVEYFVSYDYYQPEAYVPASDTYIEKDSSLNEHIEQ
UVRB_CLOB8      -------RPTIILAHNKTLAAQLCSEFKEFFPDNIVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_THETN      RL----NRPTLVIAHNKTLAAQLYSEFKEFFPENAVEYFVSYDYYQPEAYVPETDTYIEKDASINKLRHS
UVRB_PHOLL      NVIANLNRPTMVLAPNKTLAAQLYSEMKDFFPENSVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_NEIMB      -----SGRPAIIMAHNKTLAAQLYAEMREFFPENAVEYFVSYYDYPEAYVPSRDLFIEKDSAIIEQMRLS
UVRB_VIBPA      QAQ----RPAILLAPNKTLAAQLYGEMKSFFPNNAVEYFVSYDYYQPEAYVPTTDTFIEKDASVNAHIEQ
UVRB_NEIMA      -----SGRPAIIMAHNKTLAAQLYAEMREFFPENAVEYFVSYYDYPEAYVPSRDLFIEKDSAIIEQMRLS
UVRB_NEIGO      -----SGRPAIIMAHNKTLAAQLYAEMREFFPENAVEYFVSYYDYPEAYVPSRDLFIEKDSAIIEQMRLS
UVRB_NEIG1      -----SGRPAIIMAHNKTLAAQLYAEMREFFPENAVEYFVSYYDYPEAYVPSRDLFIEKDSAIIEQMRLS
UVRB_NATTJ      -------RPTLVIAHNKTLAAQLCGEFKEFFPENAVEYFVSYDYYQPEAYIPQTDTYIEKDASINKLRHS
UVRB_BACHD      -------KPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPQSDTYIEKDASINKLRHS
UVRB_AZOSE      ------GRPALVLAPNKTLAAQLYAEFREFFPENAVEYFVSY----YDYYQPEAYVPSRDLFIEKDSSIN
UVRB_VIBVY      QAQ----RPAILLAPNKTLAAQLYGEMKAFFPNNAVEYFVSYDYYQPEAYVPTTDTFIEKNAHIEQMRLS
UVRB_VIBVU      QAQ----RPAILLAPNKTLAAQLYGEMKAFFPNNAVEYFVSYDYYQPEAYVPTTDTFIEKNAHIEQMRLS
UVRB_SYNPX      QT----GRPALVLAHNKTLAAQLCNELREFFPENAVEYFISYDYYQPEAYVPVSDTYIAKTASINELRHS
UVRB_PHOPR      ES----NRPTFIMAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPTTDTFIEKDASVNAHIEQ
UVRB_CLOPS      -------KPTLILAHNKTLAAQLCAEFKEFFPDNIVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_CLOPE      -------KPTLILAHNKTLAAQLCAEFKEFFPDNIVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_CLOP1      -------KPTLILAHNKTLAAQLCAEFKEFFPDNIVEYFVSYDYYQPEAYVPQTDTFIEKDASINKLRHS
UVRB_SYNJA      ------GRPTLVMAPNKTLAAQLCNELRELFPYNAVEYFISYDYYQPEAYVPSTDTYIAKSSSINMLRHS
UVRB_PROM4      ------GRPTLVLAHNKTLAAQLCNELREFFPKNAVEYFISYDYYQPEAYVPVSDTVNEEIDMLR---HS
UVRB_ACAM1      ------GKPTLILAHNKTLAAQLCNEIRSFFPNNAVEYFISYDYYQPEAYIPVTDTFIEKTASINELRHS
UVRB_HELHP      --------PTLIMTHNKTLAAQLYSEFRGFFPKNHVEYFISFDYYQPEAYIPRRDLFIEKDSSLERLRLS
UVRB_DECAR      ------GRPALVLAPNKTLAAQLYSEFKEFFPENSVEYFVSY----YDYYQPEAYVPSRDLFIEKDSSIN
PRIA_RICBR      ----------------------------------------------------------------------
UVRB_OCEIH      -------RPTLVIAHNKTLAGQLYSEFKEFFPNNAVEYFVSYDYYQPEAYVPSTDTFIEKDASINKLRHS
UVRB_LACAC      -------KPTLVITHNKTLVGQLYGEFKGFFPNNAVEYFVSYDYYQPEAYVPQSDTYIEKDSAINQLRHA
UVRB_CARHZ      NVIANVNKPTLVIAPNKTLAAQLCAEFREFFPENAVEYFVSYDYYQPEAYLPATDTYIEKDSAIN-----
PRIA_RICFE      ----------------------------------------------------------------------
UVRB_SYNS3      QT----GRPALVLAHNKTLAAQLCNELREFFPHNAVEYFISYDYYQPEAYVPVSDTYIAKTASINELRHS
UVRB_LEPIN      ------GLPTLVLSHNKTLAAQLFREFKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINKLRLR
UVRB_LEPIC      ------GLPTLVLSHNKTLAAQLFREFKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINKLRLR
UVRB_DEHE1      -------RPTLIISHNKTLAAQLYSEMKEFLPENSVEYFVSYDYYQPEAYVPQKDMYIEKDADINKLRHA
UVRB_SYNPW      ------GRPALVLAHNKTLAAQLCNELREFFPNNAVEYFISYDYYQPEAYVPVSDTYIAKTASINELRHS
UVRB_PELCD      -------RPTLVLAHNKTLAAQLYGEFKELFPDNAVEYFVSYDYYQPEAYVPTTDTFIEKDSSINKMRHS
UVRB_LEPBL      ------GLPTLVLSHNKTLAAQLFREFKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINKLRLR
UVRB_LEPBJ      ------GLPTLVLSHNKTLAAQLFREFKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINKLRLR
UVRB_SYNJB      ------GRPTLVMAHNKTLAAQLCNELRELFPHNAVEYFISYDYYQPEAYVPSTDTYIAKSSSINMLRHS
UVRB_PROMA      KT----GRPALVLAHNKTLAAQLCNELREFFPNNAVEYFISYDYYQPEAYVPVSDTYIAKTSSINELRHS
UVRB_FUSNN      -------RPSLIIAPNKTLAAQLYSEYKKFFPENAVEYFVSY----YDYYQPEAYIKTTDTYIEKDSSVN
UVRB_PSEAE      QVQ----RPTLVLAPNKTLAAQLYGEFKTFFPHNSVEYFVSYDYYQPEAYVPSSDTYIEKDSSINQMRLS
UVRB_METBU      ----------------------------------------------------------------------
PRIA_RICCN      ----------------------------------------------------------------------
UVRB_ZYMMO      -------RPSLILAPNKILAAQLYGEFKRFFPENAVEFFVSYDYYQPEAYVPRTDTYIEKDSAINRMRHA
UVRB_THENN      -------RPALVISPNKTLAAQLYQEFKTFFPENRVEFFISYDYYQPEAYIPTKDLYIEKNAVIVRMRMS
UVRB_THEEB      ------GRPTLVLAHNKTLAAQLCNELRSFFPENAVEYFISYDYYQPEAYIPVTDTYIEKSASINELRHS
UVRB_STRAW      -------RPTLVMAPNKTLAAQLANEFRELLPNNAVEYFVSYDYYQPEAYVPQSDTYIEKDSSINRLRHS
UVRB_PASMU      KL----NRPAMVLAPNKTLAAQLYAEMKAFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASINQMRLS
UVRB_IDILO      -------RPTLILAHNKTLAAQLYGEMKEYFPNNAVEYFVSYDYYQPEAYVPTTDTFIEKDASINDHIEQ
UVRB_TREDE      -------KPTLIISHNKTLAAQLYREFKTFFPENAVEYFVSY----YDYYQPEAYVPARDLYIEKDASIN
UVRB_PECCP      DL----NRPTMMLAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_CAMJR      ----------------------------------------------------------------------
UVRB_CAMJE      ----------------------------------------------------------------------
PRIA_CHLTR      ----------------------------------------------------------------------
UVRB_THESQ      -------RPALVISPNKTLAAQLYQEFKAFFPENRVEFFISYDYYQPEAYIPTKDLYIEKNAVIVRMRMS
UVRB_THEP1      -------RPALVISPNKTLAAQLYQEFKAFFPENRVEFFISYDYYQPEAYIPTKDLYIEKNAVIVRMRMS
UVRB_THEMA      -------RPALVISPNKTLAAQLYQEFKTFFPENRVEFFISYDYYQPEAYIPTKDLYIEKNAVIVRMRMS
UVRB_THEAB      ------GKPTLIISPNKTLAAQLYSEFKSFFPENKVEFFVSYDYYQPEAYIPTRDLYIEKNAVIEKMRIS
UVRB_CLAMS      -------RPTLILAHNKTLAAQLATEFRELMPDNAVEYFVSYDYYQPEAYVPQTDTFIEKNAEVERLRHS
UVRB_CLAM3      -------RPTLILAHNKTLAAQLATEFRELMPDNAVEYFVSYDYYQPEAYVPQTDTFIEKNAEVERLRHS
UVRB_ACIAD      QTQ----RPTIVMAHNKTLAAQLYGEFKAFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDAAI----ND
PRIA_RICPR      ----------------------------------------------------------------------
UVRB_HAEIN      QL----NRPAMLLAPNKTLAAQLYAEMKAFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASINQMRLS
UVRB_HAEI8      QL----NRPAMLLAPNKTLAAQLYAEMKAFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASINQMRLS
UVRB_HAEDU      QL----NRPAMLLAPNKTLAAQLYAEMKAFFPENAVEYFVSYDYYQPEAYVPASDTFIEKDASINEQIEQ
UVRB_FRATT      -------KPCLILAHNKTLAAQLYSEFKQYFPDNAVEYFVSYDYYQPEAYIAASDTYIEKDSSVNEHIEQ
UVRB_ERWCT      DL----NRPTMMLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_COXBU      -------RPTLILEPNKTLAAQFYAEMREFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDASI----ND
UVRB_COXBR      -------RPTLILEPNKTLAAQFYAEMREFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDASI----ND
UVRB_COXBN      -------RPTLILEPNKTLAAQFYAEMREFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDASI----ND
UVRB_COXB2      -------RPTLILEPNKTLAAQFYAEMREFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDASI----ND
UVRB_COXB1      -------RPTLILEPNKTLAAQFYAEMREFFPENAVEYFVSYDYYQPEAYVPSSDTYIEKDASI----ND
UVRB_CAMFF      ----------------------------------------------------------------------
UVRB_CLOAB      -------KPTLVIAHNKTLAAQLCSEFRDFFPDSSVEYFVSYDYYQPEAYVAQTDTYIEKDASINKLRHS
UVRB_CHLPD      ----------------------------------------------------------------------
UVRB_ACTP2      -------RPAMLLAPNKTLAAQLYAEMKAFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASINEQIEQ
DDX52_MOUSE     ----------------------------------------------------------------------
UVRB_PROMH      NVIANLNRPTMVLAPNKTLAAQLYSEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_HAMD5      DL----NRPTMILAPNKTLAAQLYGEMKDFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDAAVNEHIEQ
UVRB_FERNB      -------RPVLIISPNKTLAAQLYSEFKAFFPNNKVEFFISYDYYQPEAYVPTKDLYIEKSA--------
UVRB_CHLTE      ----------------------------------------------------------------------
UVRB_CHLCH      -------RPVLVMSHNKTLAAQLYGELKQFFPHNAVEYFISYYDFPEAYLPSLDKYIAKDLRINDEIEXX
PRIA_RICTY      ----------------------------------------------------------------------
DDX52_RAT       ----------------------------------------------------------------------
DDX42_XENLA     ----------------------------------------------------------------------
UVRB_RICRS      -------RPTLIMAHNKTLAAQIYSEMKSLFPKNAVEYFVSYDYYQPEAYIARTDTFIEKDSSINEMRHA
UVRB_RICRO      -------RPTLIMAHNKTLAAQIYSEMKSLFPKNAVEYFVSYDYYQPEAYIARTDTFIEKDSSINEMRHA
UVRB_RICPU      -------RPTLIMAHNKTLAAQIYSEMKSLFPKNAVEYFVSYDYYQPEAYIARTDTFIEKDSSINEMRHA
UVRB_RICCN      -------RPTLIMAHNKTLAAQIYSEMKSLFPKNAVEYFVSYDYYQPEAYIARTDTFIEKDSSINEMRHA
UVRB_RICAE      -------RPTLIMAHNKTLAAQIYSEMKSLFPKNAVEYFVSYDYYQPEAYIARTDTFIEKDSSINEMRHA
UVRB_HELPY      ----------------------------------------------------------------------
UVRB_HELPJ      ----------------------------------------------------------------------
UVRB_HELPH      ----------------------------------------------------------------------
UVRB_HELAH      ----------------------------------------------------------------------
UVRB_CAMHC      ----------------------------------------------------------------------
PRIA_CHLMU      ----------------------------------------------------------------------
UVRB_METST      ----------------------------------------------------------------------
DDX52_HUMAN     ----------------------------------------------------------------------
DDX42_MOUSE     ----------------------------------------------------------------------
UVRB_YERE8      DL----NRPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_THIDA      -----AGRPALIMAPNKTLAAQLYAEMREFFPENAVEYFPARDLFIEKDSSINEHIEQMRLSATKSL---
UVRB_THET8      ------GRPALVLAPNKILAAQLAAEFRELFPENAVEYFISY----YDYYQPEAYVPGKDLYIEKDASNP
UVRB_SERP5      DL----NRPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDAAVNEHIEQ
UVRB_PSEPF      -------RPTLVLAPNKTLAAQLYGEFKSFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDASINDHIEQ
UVRB_ENT38      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_SHIFL      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_SHIF8      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_RICFE      -------RPTLIMAHNKTLAAQIYSEMKSIFPKNAVEYFVSYDYYQPEAYIARTDTFIEKDSSINEMRHS
UVRB_RICBR      -------RPTLIMAHNKTLAAQIYSEMKSIFPKNAVEYFVSYDYYQPEAYIPKTDSINEQIDLMR---HS
UVRB_RICB8      -------RPTLIMAHNKTLAAQIYSEMKSIFPKNAVEYFVSYDYYQPEAYIPKTDSINEQIDLMR---HS
UVRB_LEPBP      -------KPTLILSHNKTLAAQLFREFKEFFPENAVEYFVSYDYYQPEAYVPSSDTF-----IEKDMSMN
UVRB_LEPBA      -------KPTLILSHNKTLAAQLFREFKEFFPENAVEYFVSYDYYQPEAYVPSSDTF-----IEKDMSMN
UVRB_CHLPB      -------KPVLLISHNKTLAAQLYGELKQFFPHNAVEYFISYYDFPEAYIPTMDKYIAKDLKIIERLRLK
UVRB_RICM5      -------RPTLIMAHNKTLAAQIYSEMKSIFPKNAVEYFVSYDYYQPEAYIARTDTFIEKDSSINEMRHA
UVRB_MANSM      -------RPAMLLAPNKTLAAQLYAEMKAFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASINQMRLS
UVRB_CHRVO      ------GRPAIIMAHNKTLAAQLYSEMREFFPHNAVEYFVSYDYYQPEAYVPSRDLFIEKDSSINQMRLS
DDX52_BOVIN     ----------------------------------------------------------------------
DDX42_PONAB     ----------------------------------------------------------------------
DDX42_HUMAN     ----------------------------------------------------------------------
UVRB_YERPY      DL----NRPTMILAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_YERPS      DL----NRPTMILAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_YERPP      DL----NRPTMILAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_YERPN      DL----NRPTMILAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_YERPG      DL----NRPTMILAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_YERPE      DL----NRPTMILAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_YERPB      DL----NRPTMILAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_YERP3      DL----NRPTMILAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_KOSOT      ----------------------------------------------------------------------
RH3_ARATH       ----------------------------------------------------------------------
UVRB_RICAH      -------RPTLIMAHNKTLAAQIYSEMKSIFPKNAVEYFVSYDYYQPEAYIARTDTFIEKDSSINEMRHS
DDX42_CHICK     ----------------------------------------------------------------------
UVRB_PARUW      -------RPTLILAHNKTLAAQLYQEFKAFFPHNAVEYFVSYDYYQPEAYVPRTDTY-----IEKDMSIN
UVRB_LEGPL      -------RPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYDYYQPEAYVPASDTFIEKDASINEHIEQ
UVRB_LEGPH      -------RPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYDYYQPEAYVPASDTFIEKDASINEHIEQ
UVRB_LEGPC      -------RPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYDYYQPEAYVPASDTFIEKDASINEHIEQ
UVRB_LEGPA      -------RPTLIMAPNKTLAAQLYGEFKAFFPDNAVEYFVSYDYYQPEAYVPASDTFIEKDASINEHIEQ
UVRB_RICPR      -------RPTLIMAHNKTLAAQIYLEMKSIFPKNAVEYFVSYDYYQPESYIVRTDTFIEKDSSINEMRHS
UVRB_RALEJ      ------GRPAIVFAPNKTLAAQLYSEFREFFPRNAVEYFVSYDYYQPEAYVPQRDLFIEKDSSINQMRLS
UVRB_NITEU      ------GRPAIIMAPNKTLAAQLYAEMREFFPENAVEYFVSYRDLFIEKDSSINEHIEQRLSATKSLLER
UVRB_MYCMO      -----ANRPVLLLSHNKTLASQLYSELKDFFPNNRVEYFVSYDYYRPEAYMPNTDTYIDKTTKLEEMRMS
UVRB_COLP3      -------RPTMMLAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPTTDTFIEKDASVNEHIEQ
UVRB_XANAC      -------RPTLVMAPNKTLAAQLYGEFKSFFPHNAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINQMRLS
UVRB_RICTY      -------RPTLIMAHNKTLAAQIYLEMKSIFPKNAVEYFVSYDYYQPEAYIVRTDTFIEKDSSINEMRHS
RH51_ORYSJ      ----------------------------------------------------------------------
PRIA_HELPY      ----------------------------------------------------------------------
PRIA_HELPJ      ----------------------------------------------------------------------
UVRB_YERPA      DL----NRPTMILAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_WOLSU      --------PTLIMTHNKTLAAQLYSEFRGFFPKNHVEYFISFDYYQPEAYIPRQDSINEELERLRL----
UVRB_THELT      ----------------------------------------------------------------------
DDX55_MOUSE     ----------------------------------------------------------------------
UVRB_METMP      ----------------------------------------------------------------------
UVRB_ERWT9      DL----NRPTMVLAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_ANATD      -------RPTLVLAHNKTLAAQLCSEFREFFPENAVEFFVSYDYYQPEAYIPETDTYIEKDSSINKLRHS
MS116_CANGA     ----------------------------------------------------------------------
DDX55_BOVIN     ----------------------------------------------------------------------
UVRB_RICCK      -------RPTLIMAHNKTLAAQIYSEMKLMFPKNAIEYFVSYDYYQPEAYIARTDTFIEKDSSINEMRHS
RH9_ORYSJ       ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DDX42_DICDI     ----------------------------------------------------------------------
UVRB_XANOR      -------KPTLVMAPNKTLAAQLYGEFKSFFPHNAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINQMRLS
UVRB_XANOP      -------KPTLVMAPNKTLAAQLYGEFKSFFPHNAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINQMRLS
UVRB_XANOM      -------KPTLVMAPNKTLAAQLYGEFKSFFPHNAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINQMRLS
UVRB_XANCP      -------KPTLVMAPNKTLAAQLYGEFKSFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINQMRLS
UVRB_XANCB      -------KPTLVMAPNKTLAAQLYGEFKSFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINQMRLS
UVRB_XANC8      -------KPTLVMAPNKTLAAQLYGEFKSFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDSSINQMRLS
UVRB_RALSO      -----AGRPAIVFAPNKTLAAQLYSEFREFFPRNAVEYFVSYDYYQPEAYVPQRDSVNEHIEQMRLSATK
UVRB_BORPD      ------GRPALVLAPNKTLAAQLYAEMREFFPKNAVEYFVSYDYYQPEAYVPTRDSINEHIEQMRLSATK
UVRB_ANAMM      -------RPAIIIAHNKTLAAQLHEEMRSFFPENAVEYFVSYDYYQPEAYIPQSDVYIEKDALINDLRHS
RH3_ORYSJ       ----------------------------------------------------------------------
UVRB_GLOVI      ------GKPTLVLAHNKTLAAQLCNELREFFPDNAVEYFVSYDYYQPEAYIPQTDTYIEKSASINMLRHS
UVRB_ANAMF      -------RPAIIIAHNKTLAAQLHEEMRSFFPENAVEYFVSYDYYQPEAYIPQSDVYIEKDALINDLRHS
DDX55_DANRE     ----------------------------------------------------------------------
UVRB_PSEHT      -------RPTIIMAHNKTLAAQLYGEMKEFFPKNAVEYFVSYDYYQPEAYVVSSDTFIEKDASINEHIEQ
UVRB_METTH      ----------------------------------------------------------------------
UVRB_BACFR      NVIANINKPTLILSHNKTLAAQLYSEFKGFFPNNAVAYLPSSDTYIEKDLAINDEIDKLRLAATSALLSG
UVRB_BACFN      NVIANINKPTLILSHNKTLAAQLYSEFKGFFPNNAVAYLPSSDTYIEKDLAINDEIDKLRLAATSALLSG
RH51_ARATH      ----------------------------------------------------------------------
DDX55_CHICK     ----------------------------------------------------------------------
UVRB_XYLFT      -------KPTLVMAPNKTLAAQLYGEFKAFFPHNAVEYFVSYDYYQPEAYVPASDTFIEKDSSINEYIEQ
UVRB_XYLFM      -------KPTLVMAPNKTLAAQLYGEFKAFFPHNAVEYFVSYDYYQPEAYVPASDTFIEKDSSINEYIEQ
UVRB_XYLFA      -------KPTLVMAPNKTLAAQLYGEFKAFFPHNAVEYFVSYDYYQPEAYVPASDTFIEKDSSINEYIEQ
UVRB_XYLF2      -------KPTLVMAPNKTLAAQLYGEFKAFFPHNAVEYFVSYDYYQPEAYVPASDTFIEKDSSINEYIEQ
UVRB_METMA      -------KPTLVIAHNKTLAAQLYNEFREFFPENRVEYFVSYDYYQPESYLPAKDQYIEKDAMI----NP
UVRB_EDWI9      DL----NRPTMVMAPNKTLAAQLYGEMKQFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_BORA1      ------GRPALVLAPNKTLAAQLYAEMRDFFPKNAVEYFVSYDYYQPEAYVPTRDSVNEHIEQMRLSATK
PRIA_RHORU      ----------------------------------------------------------------------
DRS1_YARLI      ----------------------------------------------------------------------
UVRB_KLEP7      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_KLEP3      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_BORPA      ------GRPALVLAPNKTLAAQLYAEMREFFPRNAVEYFVSYDYYQPEAYVPTRDSINEHIEQMRLSATK
UVRB_BORBR      ------GRPALVLAPNKTLAAQLYAEMREFFPRNAVEYFVSYDYYQPEAYVPTRDSINEHIEQMRLSATK
DDX55_HUMAN     ----------------------------------------------------------------------
UVRB_SALPK      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASINEHIE-
UVRB_SALPA      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASINEHIE-
UVRB_METS3      -------KPTLVISHNKTLAAQLYEEFKEFFPDNAVEYFVSYDYYQPEAYVPRTDTVNEEIDIMRHSATQ
MPH1_KLULA      ----------------------------------------------------------------------
DRS1_PICGU      ----------------------------------------------------------------------
DDX55_XENLA     ----------------------------------------------------------------------
UVRB_SHISS      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_SHIDS      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_SHIBS      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_SHIB3      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_SALTY      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALTI      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALSV      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALPC      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALPB      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALNS      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALHS      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALG2      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALEP      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALDC      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALCH      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALAR      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_SALA4      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
UVRB_RHILO      -------RPALILAPNKTLAAQLYSEFKKFFPDNAVEYFVSYDYYQPEAYVPRTDTFIEKESSINRMRHS
UVRB_METAC      ----------------------------------------------------------------------
UVRB_ESCF3      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOUT      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOSM      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOSE      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOLU      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOLI      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOLC      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOL5      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOK1      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOHS      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECODH      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECOBW      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECO8A      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECO81      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECO7I      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECO5E      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECO57      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECO55      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECO45      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECO27      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_ECO24      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIEQ
UVRB_CALS8      -------RPTLVLAHNKTLAAQLCSEFREFFPENAVEFFVSYDYYQPEAYIPETDTYIEKDSSINKLRHS
UVRB_BACTN      NVIANINKPTLILSHNKTLAAQLYSEFKGFFPNNAVEXXXXXXXXXQEAYLPNSDTIEKDLAIIDKLRLA
RH55_ARATH      ----------------------------------------------------------------------
RH49_ARATH      ----------------------------------------------------------------------
PRIA_TREPA      ----------------------------------------------------------------------
UVRB_WOLTR      -------RPALIIAHNKTLAAQLYEEMKGFFPHNAVEYFISYDYYQPEAYLPQTDTYIEKDSVINELRYS
UVRB_CITK8      DLQ----RPTMVLAPNKTLAAQLYGEMKEFFPDNAVEYFVSYDYYQPEAYVPSSDTFIEKDASVNEHIE-
ROK1_SCHPO      ----------------------------------------------------------------------
DRS1_PICST      ----------------------------------------------------------------------
DRS1_ASHGO      ----------------------------------------------------------------------
DDX55_DROME     ----------------------------------------------------------------------
UVRB_ANAPZ      --------PALIVAHNKTLAAQLYEEMRMFFPNNAVEYFVSYDYYQPEAYIPHSDVYIEKDALINELRHS
RRP3_PICGU      ----------------------------------------------------------------------
PRIA_SYNY3      ----------------------------------------------------------------------
HAS1_MAGGR      ----------------------------------------------------------------------
DRS1_NEUCR      ----------------------------------------------------------------------
UVRB_BURPS      ------GRPAIVFAPNKTLAAQLYAEFREFFPRNAVEYFVSYDYYQPEAYVPQRDSINEHIEQMRLSATK
UVRB_BURMA      ------GRPAIVFAPNKTLAAQLYAEFREFFPRNAVEYFVSYDYYQPEAYVPQRDSINEHIEQMRLSATK
RRP3_ENCCU      ----------------------------------------------------------------------
MPH1_CANGA      ----------------------------------------------------------------------
IF4A_DROME      ----------------------------------------------------------------------
HAS1_GIBZE      ----------------------------------------------------------------------
DRS1_CANAL      ----------------------------------------------------------------------
DDX52_DICDI     ----------------------------------------------------------------------
UVRB_MYCPE      ----------------------------------------------------------------------
RHLB_ALISL      ----------------------------------------------------------------------
RH53_ARATH      ----------------------------------------------------------------------
RH7_ORYSJ       ----------------------------------------------------------------------
MFH1_SCHPO      ----------------------------------------------------------------------
UVRB_EUBR3      NVIAALNKPTLIISHNKTLAGQLYGEMKEFFPENAVEYFVSYDYYQPEAYVPQSDTY-----IAKDSSVN
UVRB_CHLCV      NVVANVNRPTLVLAHNKTLAAQLYQEFKEFFPNNAVEYFISYDYYQPEAYIARNDTYIEKSLLI----NS
UVRB_BORPE      ------GRPALVLAPNKTLAAQLYAEMREFFPRNAVEYFVSYDYYQPEAYVPTRDSINEHIEQMRLSATK
RH9_ARATH       ----------------------------------------------------------------------
DRS1_KLULA      ----------------------------------------------------------------------
DRS1_CANGA      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
RRP3_CANAL      ----------------------------------------------------------------------
RH32_ARATH      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
MPH1_MAGGR      ----------------------------------------------------------------------
DDX4_MOUSE      ----------------------------------------------------------------------
DDX4_BOVIN      ----------------------------------------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
UVRB_CORDI      ----------------------------------------------------------------------
ROK1_YARLI      ----------------------------------------------------------------------
RH5_ORYSJ       ----------------------------------------------------------------------
IF4A_TRYBB      ----------------------------------------------------------------------
DDX4_MACFA      ----------------------------------------------------------------------
DDX4_HUMAN      ----------------------------------------------------------------------
DBP3_KLULA      ----------------------------------------------------------------------
Y383_METJA      ----------------------------------------------------------------------
RH18_ARATH      ----------------------------------------------------------------------
IRC3_SCHPO      ----------------------------------------------------------------------
IF4A_TRYCR      ----------------------------------------------------------------------
DDX4_RAT        ----------------------------------------------------------------------
DBP4_ENCCU      ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
UVRB_TREPS      ----------------------------------------------------------------------
UVRB_TREPA      ----------------------------------------------------------------------
RHLB_PSEA6      ----------------------------------------------------------------------
DRS1_GIBZE      ----------------------------------------------------------------------
DRS1_DEBHA      ----------------------------------------------------------------------
DDX4_PIG        ----------------------------------------------------------------------
DDX10_CHICK     ----------------------------------------------------------------------
UVRB_PSEPK      -------RPTLVLAPNKTLAAQLYGEFKAFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDASINDHIEQ
UVRB_PSEF5      -------RPTLVLAPNKTLAAQLYGEFKAFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDASINDHIEQ
MPH1_YEAST      ----------------------------------------------------------------------
MPH1_YEAS7      ----------------------------------------------------------------------
UVRB_ONYPE      ----------LVIAHNKTLAGQLYNELKAMFPNNRVEYFISYDYYQPEAYVASSDTYIEKDSKINQLRHS
UVRB_AYWBP      ----------------------------------------------------------------------
RH7_ARATH       ----------------------------------------------------------------------
PRP11_SCHPO     ----------------------------------------------------------------------
MPH1_VANPO      ----------------------------------------------------------------------
IF4A_LEIBR      ----------------------------------------------------------------------
DRS1_PHANO      ----------------------------------------------------------------------
DRS1_NEOFI      ----------------------------------------------------------------------
DRS1_ASPFU      ----------------------------------------------------------------------
DCL1_NEUCR      ----------------------------------------------------------------------
DBP3_CANGA      ----------------------------------------------------------------------
DBP3_ASPFU      ----------------------------------------------------------------------
VF509_ASFP4     ----------------------------------------------------------------------
VASA_DROME      ----------------------------------------------------------------------
UVRB_PSESM      -------RPTLVLAPNKTLAAQLYGEFKAFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDASINDHIEQ
UVRB_CHLAB      NVVANVNRPTLVLAHNKTLAAQLYQEFKEFFPNNAVEYFISYDYYQPEAYIARNDTYIEKSLLI----NS
ROK1_PICGU      ----------------------------------------------------------------------
RH21_ORYSJ      ----------------------------------------------------------------------
RH21_ARATH      ----------------------------------------------------------------------
PRP28_PICGU     ----------------------------------------------------------------------
FAL1_USTMA      ----------------------------------------------------------------------
DRS1_SCLS1      ----------------------------------------------------------------------
DHH1_DEBHA      ----------------------------------------------------------------------
DDX18_DICDI     ----------------------------------------------------------------------
VF509_ASFWA     ----------------------------------------------------------------------
VF509_ASFB7     ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PSEU2      -------RPTLVLAPNKTLAAQLYGEFKAFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDASINDHIEQ
RGYR1_SULSO     ----------------------------------------------------------------------
IF4A_CRYPV      ----------------------------------------------------------------------
DHX58_HUMAN     ----------------------------------------------------------------------
DDX10_HUMAN     ----------------------------------------------------------------------
DBP3_YEAST      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_PSE14      -------RPTLVLAPNKTLAAQLYGEFKAFFPNNAVEYFVSYDYYQPEAYVPSSDTFIEKDASINDHIEQ
ROK1_ASPTN      ----------------------------------------------------------------------
RH8_ORYSJ       ----------------------------------------------------------------------
RH6_ORYSJ       ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
IF4A_LEIMA      ----------------------------------------------------------------------
IF4A_LEIIN      ----------------------------------------------------------------------
FAL1_SCHPO      ----------------------------------------------------------------------
DRS1_CRYNE      ----------------------------------------------------------------------
DRS1_BOTFB      ----------------------------------------------------------------------
DDX4_XENLA      ----------------------------------------------------------------------
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP3_YEAS7      ----------------------------------------------------------------------
DBP3_PICGU      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           DPDDPLTAPLRVVVAPIRSVLQPLVSGLGDLQPVRVREGDSVALDELVQSLVDIGYSRVDLVEKRGDIAV
MFD_MYCTU       D-DAQLGPPLGVVVTSVRSLLQPMTPQLGMMEPLTLTVGDESPFDGVVARLVELAYTRVDMVGRRGEFAV
MFD_MYCBO       D-DAQLGPPLGVVVTSVRSLLQPMTPQLGMMEPLTLTVGDESPFDGVVARLVELAYTRVDMVGRRGEFAV
MFD_BACSU       EXXXXXXXXXXX-----RRMLPPVEVWKSSQMLIQV--GHDIEPDQLASRLVEVGYERSDMVSAPGEFSI
MFD_STAAB       KKG--------LFIVPLNGLKKWLTSEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRESVVSHIGEFSL
MFD_STAAW       KKG--------LFIVPLNGLKKWLTPEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRESVVSHIGEFSL
MFD_STAAS       KKG--------LFIVPLNGLKKWLTPEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRESVVSHIGEFSL
MFD_STAA8       KKG--------LFIVPLNGLKKWLTPEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRESVVSHIGEFSL
MFD_STAA3       KKG--------LFIVPLNGLKKWLTPEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRESVVSHIGEFSL
MFD_STAAN       KKG--------LFIVPLNGLKKWLTPEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRESVVSHIGEFSL
MFD_STAAM       KKG--------LFIVPLNGLKKWLTPEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRESVVSHIGEFSL
MFD_STAAR       KKG--------LFIVPLNGLKKWLTPEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRESVVSHIGEFSL
MFD_STAS1       ERG--------LFIVPLNGLKKWLTPDMWKSHQLTLNVGDDIDIDEFLNKLVNMGYRRESVVSHIGEFSL
MFD_STAHJ       KKG--------LFIVPLNGLKKWLTPELWKDHQITLRVGEDIDVDEFLNKLVNMGYRRESVVSHIGEFSL
MFD_HAEIN       -------AKKGIFLLPISTLMQRLCPPQYLQHNVLIKKGDRLVIDKMRLQLEAAGYRAVEQVLEHGEYAV
MFD_STAES       -----------------------------------LKVGQDIDVDAFLNKLVNMGYRRESVVSHIGEFSL
MFD_STAEQ       -----------------------------------LKVGQDIDVDAFLNKLVNMGYRRESVVSHIGEFSL
MFD_SYNY3       HQ-----VKGKAIVATEKA-LQPHLPPVATLRELALRRGQEMDSKSLELTLARLGYERGSTVETEGQWSR
MFD_STAAC       KKG--------LFIVPLNGLKKWLTPEMWQNHQMTLRVGEDIDVDQFLNKLVNMGYKRESVVSHIGEFSL
MFD_MYXXA       TRFPALVLSVRALHR------KXXXXXXXXXXXXXXXXGQDFDRDSLARRLVRMGYQNSPLVEDVGTFSV
MFD_ECOLI       ------TMQRGVLIVPVNTLMQRVCPSFLHGHALVMKKGQRLSRDALRTQLDSAGYRHVDQVMEHGEYAT
MFD_BORBU       ------------------TVLKSLLSKIPDKNTLKIEKNTNINTADIEKTLITLGYEKTLRVTIPGEFTV
MFD_BUCAI       ----------------------------------------------------------------------
MFD_RICFE       NSNGKL---LITYAANLLNKLPP--KDFFSKYFLKLSPKMKFTTDELAMFLVENSFTRNASSIDVGEFAV
MFD_RICBR       KGN-------KLVITHATNLLNKLPKDFFAKYYLKLFPKMKLSANELSKFLVENSFTRNASTVDVGEFAV
MFD_RICCN       ----------------------------------------------------------------------
MFD_HELPJ       -------------------------------------------LKDLKDKLFYYGYEILDLVEVEGEASF
MFD_BUCBP       ----------------------------------------------------------------------
MFD_HELPY       -------------------------------------------LKDLKDKLFYYGYEILDLVEVEGEASF
MFD_RICPR       ----------------------------------------------------------------------
MFD_RICTY       ----------------------------------------------------------------------
RECG_BORBU      ----------------------------------------------------------------------
RECG_STRPN      ----------------------------------------------------------------------
RECG_PASMU      ----------------------------------------------------------------------
RECG_TREPA      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
RECG_AQUAE      ----------------------------------------------------------------------
RECG_HAEIN      ----------------------------------------------------------------------
RECG_ECOLI      ----------------------------------------------------------------------
RECG_ECO57      ----------------------------------------------------------------------
RECG_STAES      ----------------------------------------------------------------------
RECG_STAEQ      ----------------------------------------------------------------------
RECG_BACSU      ----------------------------------------------------------------------
RECG_STAAW      ----------------------------------------------------------------------
RECG_STAAS      ----------------------------------------------------------------------
RECG_STAAN      ----------------------------------------------------------------------
RECG_STAAM      ----------------------------------------------------------------------
RECG_STAAR      ----------------------------------------------------------------------
RECG_MYCLE      ----------------------------------------------------------------------
RECG_STAAC      ----------------------------------------------------------------------
RECG_STAA8      ----------------------------------------------------------------------
RECG_MYCTU      ----------------------------------------------------------------------
RECG_MYCBO      ----------------------------------------------------------------------
RECG_HELPJ      ----------------------------------------------------------------------
RECG_HELPY      ----------------------------------------------------------------------
RECG_THIFE      ----------------------------------------------------------------------
UVRB_GEMAT      ATSSLMERDDVVIVSTVSAIY-----GLGD--PVQYREGQQIARDDILRALVGIQYLRNDVAFERGTFRV
UVRB_BEUC1      ATNSLLTRRDVVVVASVSCIY-----GLGTPQEVRLRVGMQIERDDLLRQFVGMQYTRNDLSFQRGTFRV
UVRB_STRCO      ATNSLLTRRDVIVVASVSCIY-----GLGTPQEVPLRVGEEHDRDELLRRFVDIQYTRNDMAFARGTFRV
UVRB_GEOSL      ATRSLLTRRDVIIVASVSCIYG--IGSPAEYQAMHIHQGDEYGRDELLRKLVDIQYERNDLDFHRGTFRV
UVRB_NATPD      ATRSLLTRDDVIVVASVSAIY-----GLGDPMALRLEAGDERSREDLLSALVELNYERNDVDFQQGTFRV
UVRB_HALSA      ATRSLLTRDDVIVVASVSAIY-----GLGDPRSLRVERGQSIGRDQLLAKLVDLNYDRNDVDFTQGTFRV
Y1401_METJA     ----------------------------------------------------------------------
UVRB_RENSM      ATNSLLTRRDVIVVATVSCIY-----GLGTPEEVTLKQGDRVDRDQLLRQFVGIQYTRNDIDFHRGTFRV
UVRB_ENTFA      ATSSLLERNDVIVVASVSCIF-----GLGDQQVVSLRVGMEMDRNELLKSLVDIQFERNDIDFQRGRFRV
UVRB_LACLS      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNDLVGIQFERNDIDFQRGCFRV
UVRB_LACLM      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNDLVGIQFERNDIDFQRGCFRV
UVRB_LACLA      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNDLVGIQFERNDIDFQRGCFRV
UVRB_CHLAD      ATQALLTRRDVLIVASVSAIF-----GLGSQEKIHLRTGEVRNRDKLLRQLIDLQFERNDVDFQRGTFRV
UVRB_CLONN      ATSALFERNDVIVVASVSCIY-----GLGNPEEVSLREGMEKDRDEIMRQLVDIQYERNEINFVRGTFRA
UVRB_CLOB6      ATSALFERKDVIIVASVSCIY-----GLGNPEEISLREGMEKDRDEIIKKLVEIQYERNDIDFSRGTFRV
UVRB_BACHK      ATSALFERDDVIIVASVSCIY-----GLGSPEEYRLRVGMEKDRNQLLRELVDVQYGRNDIDFKRGTFRV
UVRB_BACCZ      ATSALFERDDVIIVASVSCIY-----GLGSPEEYRLRVGMEKDRNQLLRELVDVQYGRNDIDFKRGTFRV
UVRB_BACCR      ATSALFERDDVIIVASVSCIY-----GLGSPEEYRLRVGMEKDRNQLLRELVDVQYGRNDIDFKRGTFRV
UVRB_BACC1      ATSALFERDDVIIVASVSCIY-----GLGSPEEYRLRVGMEKDRNQLLRELVDVQYGRNDIDFKRGTFRV
UVRB_BACAN      ATSALFERDDVIIVASVSCIY-----GLGSPEEYRLRVGMEKDRNQLLRELVDVQYGRNDIDFKRGTFRV
UVRB_STRS7      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNALVDIQFERNDIDFQRGRFRV
UVRB_STRS2      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNALVDIQFERNDIDFQRGRFRV
UVRB_STREM      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNALVDIQFERNDIDFQRGRFRV
UVRB_STRA5      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNNLVDIQFERNDIDFQRGKFRV
UVRB_STRA3      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNNLVDIQFERNDIDFQRGKFRV
UVRB_STRA1      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNNLVDIQFERNDIDFQRGKFRV
UVRB_LISMO      DEIDKLRHSATAALFERRDVIVSCIYGLGSPMLVSLRVGMEISRDQLLRKLVDIQYDRNDIDFQRGRFRV
UVRB_LISMF      DEIDKLRHSATAALFERRDVIVSCIYGLGSPMLVSLRVGMEISRDQLLRKLVDIQYDRNDIDFQRGRFRV
UVRB_LISIN      DEIDKLRHSATAALFERRDVIVSCIYGLGSPVEVSLRVGMEISRDQLLRKLVDIQYDRNDIDFQRGRFRV
UVRB_STRE4      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNALVDIQFERNDIDFQRGRFRV
UVRB_PROAC      ATNSLLTRRDVIVVSTVSAIY-----GLGTPQEIPLEVGQEWDRDELLRDLVTNQYVRNDISGERGTFRV
UVRB_CLOBM      ATSALFERKDVIIVASVSCIY-----GLGNPEEISLREGMEKDRDEIIKKLVEIQYERNDIDFSRGTFRV
UVRB_CLOBL      ATSALFERKDVIIVASVSCIY-----GLGNPEEISLREGMEKDRDEIIKKLVEIQYERNDIDFSRGTFRV
UVRB_CLOBK      ATSALFERKDVIIVASVSCIY-----GLGNPEEISLREGMEKDRDEIIKKLVEIQYERNDIDFSRGTFRV
UVRB_CLOBJ      ATSALFERKDVIIVASVSCIY-----GLGNPEEISLREGMEKDRDEIIKKLVEIQYERNDIDFSRGTFRV
UVRB_CLOB1      ATSALFERKDVIIVASVSCIY-----GLGNPEEISLREGMEKDRDEIIKKLVEIQYERNDIDFSRGTFRV
UVRB_SYNP6      ATRNLFERRDVIVVASISCIYGLGIPSEYLKAAIPLEVGAEINMREVLRQLVDVQYSRNDLESGRGRFRV
UVRB_SYNE7      ATRNLFERRDVIVVASISCIYGLGIPSEYLKAAIPLEVGAEINMREVLRQLVDVQYSRNDLESGRGRFRV
UVRB_STRU0      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDQLLNQLVDIQFERNDFDFQRGRFRV
UVRB_LACPL      ATSSLLERNDVIVVASVSSIF-----GLGDPHEVSLRVGMEIDRNDLLRKLVDIQFDRNDIDFQRGRFRV
UVRB_GEOKA      ATSALFERRDVIIVASVSCIY-----GLGSPEEYRLRVGMEIERNALLRRLVDIQYDRNDIDFRRGTFRV
UVRB_PROM3      ATRSLFERNDVIVVASISCIYGLGIPSEYLKAAVKFKVGETLNLRSSLRELVDNQYSRNDFDITRGRFRV
UVRB_HALMA      ATRSLLTRDDVIVVASVSAIY-----GLGDPRSLSLEVGQEIERDELLGQLVDLNYERNDVDFTQGTFRV
UVRB_STAES      ATSSLFERDDVIIIASVSCIY-----GLGNPEEVSVRVGMEMERSELLRKLVDVQYSRNDIDFQRGTFRV
UVRB_STAEQ      ATSSLFERDDVIIIASVSCIY-----GLGNPEEVSVRVGMEMERSELLRKLVDVQYSRNDIDFQRGTFRV
UVRB_DESDG      ATHALLTRRDVIIIASVSCIY-----GLGSPEVIPVEAGQHMSMDSLIGRLVDVQYERNDYDFHRGTFRV
UVRB_DESVM      ATHALLTRRDVVIVASVSCIY-----GLGSPEVIPVETGQRLSMDALITRLVEVQYERNDYDFHRGTFRV
UVRB_CLOTE      ATSALLERKDVIIVSSVSCIY-----GLGNPEEISLREGMEKDRDEILKKLVEIQYERNEINFVRGTFRV
UVRB_BACA2      ATSSLFERRDVIIIASVSCIY-----GLGSPEEYRLRPEMEIERNELLRKLVDIQYARNDIDFQRGTFRV
UVRB_CLOBB      ATSALFERRDVIIVASVSCIY-----GLGNPDEISLRKGMQKERDEIIKKLIEIQYERNDIDFSRGTFRV
UVRB_CLOBA      ATSALFERRDVIIVASVSCIY-----GLGNPDEISLRKGMQKERDEIIKKLIEIQYERNDIDFSRGTFRV
UVRB_BACLD      ATSALFERKDVIIVASVSCIY-----GLGSPEEYRLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRV
UVRB_ARTCA      ATNALLTRRDVVVVATVSCIY-----GLGTPEEVTLRKGAEMNRDDLLRKFVSMQYARNDMDFHRGTFRV
UVRB_AQUAE      ATISVLERRDVIVVASVSCIY-----GLGKPEHIKLQRGIRLNLSKLLRKLVELGYQRNDFAIKRATFSV
UVRB_STAS1      ATSALFERDDVIVIASVSCIY-----GLGNPEEYRIRAGMEMDRSELLKKLVDVQYTRNDIDFRRGTFRV
UVRB_STAHJ      ATSALFERDDVIIIASVSCIY-----GLGNPEEVSVRVGMEMDRSELLRKLVDVQYSRNDIDFQRGTFRV
UVRB_BIFLI      ATANLLTRRDCVVVATVSCIY-----GLGTPEEYALKEGQQINRDDLLRRFVAMQYKRNDIAFTRGTFRV
UVRB_STRSV      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGKFRV
UVRB_STRGC      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGKFRV
UVRB_MICLC      ATNALLTRRDVIVVATVSCIY-----GLGTPQMVTLRRGAEMDRDVLLRRFVQMQYVRNDVDFHRGTFRV
UVRB_LACJO      TTSDLMSRNDVIVVASVSCIY-----GLGDPREVSLSEGQEISRDVLLRDLVNIQYDRNDIDFQRGRFRV
UVRB_BACSU      ATSALFERRDVIIIASVSCIY-----GLGSPEEYRLRTEMEIERNELLRKLVDIQYARNDIDFQRGTFRV
UVRB_STRZT      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRZP      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRZJ      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRR6      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRPS      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRPN      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRPJ      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRPI      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRP7      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRP4      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STRP2      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGLEISRDKLLNDLVDIQFERNDIDFQRGRFRV
UVRB_PROMM      ATRSLFERNDVIVVASISCIYGLGIPSEYLKAAVKFKVGETLNIRSALRELVENQYSRNDIDITRGRFRV
UVRB_PROM0      ATRSLFERKDVIVVASISCIYGLGIPSEYLKAAVKFEVGKSINLRSYLRSLVENQYTRNDIEITRGRFRI
UVRB_LACSS      ATSSLLERNDVIVVASVSCIF-----GLGDPREYQLRPGMEVERNDLLRQLVDIQFERNDIDFQRGRFRV
UVRB_ARTS2      ATNALLTRRDVIVVATVSCIY-----GLGTPEEVTLRKGAEMNRDDLLRKFVSMQYARNDMDFHRGTFRV
UVRB_ARTAT      ATNALLTRRDVIVVATVSCIY-----GLGTPEEVTLRKGAEMNRDHLLRKFVSMQYARNDMDFHRGTFRV
PRIA_ECOLI      ----------------------------------------------------------------------
UVRB_CYAP7      ATRSLFERRDVVVVASISCIYGLGMPSEYLKASIGLEVGKEINQRQLLRDLVSVQYSRNDLDLQRGRFRL
UVRB_BACCA      ATSALFERRDVIIVASVSCIY-----GLGSPEEYRLRVGMEIERNALLRRLVDIQYDRND-IDFRGTFRV
UVRB_VIBF1      MRLSATKALLEIIIASVSAIY-----GLGDPKALHLRRGDIINQRDMLRRLAELQYKRNDMAFERGTFRV
UVRB_THEFY      ATTALLTRRDTVVVASVSCIY-----GLGTPQEATVEVGMEIDRDELLRRLVEMQYTRNDVAFTRGTFRV
UVRB_STRPZ      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRPM      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRPG      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRPF      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRPC      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRPB      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRP8      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRP6      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRP3      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRP1      ATSSLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_STRMU      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPSQEISRDQLLNDLVDIQFERNDIDFQRGRFRV
UVRB_STAAW      ATSALFERDDVIIIASVSCIY-----GLGNPEEVSVRVGMEMDRSELLRKLVDVQYTRNDIDFQRGTFRV
UVRB_STAAS      ATSALFERDDVIIIASVSCIY-----GLGNPEEVSVRVGMEMDRSELLRKLVDVQYTRNDIDFQRGTFRV
UVRB_STAAR      ATSALFERDDVIIIASVSCIY-----GLGNPEEVSVRVGMEMDRSELLRKLVDVQYTRNDIDFQRGTFRV
UVRB_STAAN      ATSALFERDDVIIIASVSCIY-----GLGNPEEVSVRVGMEMDRSELLRKLVDVQYTRNDIDFQRGTFRV
UVRB_STAAM      ATSALFERDDVIIIASVSCIY-----GLGNPEEVSVRVGMEMDRSELLRKLVDVQYTRNDIDFQRGTFRV
UVRB_STAAC      ATSALFERDDVIIIASVSCIY-----GLGNPEEVSVRVGMEMDRSELLRKLVDVQYTRNDIDFQRGTFRV
UVRB_MYCTU      -----ATXXXXXXXXXXXXXXXXCIYGLGTPQSVELKVGEEVPRDGLLRLLVDVQYTRNDMSFTRGSFRV
UVRB_MYCBO      -----ATXXXXXXXXXXXXXXXXCIYGLGTPQSVELKVGEEVPRDGLLRLLVDVQYTRNDMSFTRGSFRV
UVRB_LACBA      ATSSLLERNDVIVVASVSSIF-----GLGDPTEVSLRVGQEIERDALLRKLVNIQFERNDYDFQRGRFRV
UVRB_HERA2      ATQALFTRSDVIIVASVSAIY-----GLGSPTDLKLKTGEIRNRDKVLRTLIDLQFERNDLDFHRGTFRV
UVRB_DEHSC      ATRALFERRDVVIVASVSCIY-----GLGEPEEYRLKKGQSFRRDLILRRLVDMQYERNDLDFSRGKFRL
UVRB_RHOBA      TTSSLVSRRDVVIVASVSSIY-----GLGSPDDYRLHQGEQTRRDHLLLKFVDLQYQRNDIQFERGKFRV
UVRB_LEIXX      T-----TNXXXXXXXXXXXXXXXCIYGLGAAEEVALQVGQNVGRDQLIRRFVAMQYERNDIDFSRGKFRV
UVRB_LACCB      ATSALLERNDVIVVASVSSIF-----GLGDPHEYKLRTGMTIDRNTLLRQLVDIQFDRNDIDFQRGRFRV
UVRB_LACC3      ATSALLERNDVIVVASVSSIF-----GLGDPHEYKLRTGMTIDRNTLLRQLVDIQFDRNDIDFQRGRFRV
PRIA_CHLPN      ----------------------------------------------------------------------
COMFA_BACSU     ----------------------------------------------------------------------
UVRB_STRPD      ATASLLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDTLLNQLVDIQFERNDIDFQRGCFRV
UVRB_PSYIN      MRLSATKALLEVLVASVSAIY-----GLGDQMMLHLTVGEIISSREILQRLVDLQYNRNETELSRGTFRV
UVRB_PROMP      ATRSLFERKDVIVVASISCIYGLGIPSEYLKAAVKFAVGESIDLRSSLRALVDNQYTRNDTEITRGRFRI
UVRB_LACGA      TTSDLMSRNDVIVVASVSCIY-----GLGDPREVSISGGQEISRDVLLRDLVNIQYDRNDIDFQRGRFRV
UVRB_ANASP      ATRSLFERRDVIVVASISCIYGLGIPAEYLKAAIPLQIGMEVNQREILRDLASVQYSRNDVEMGRGRFRV
UVRB_ALISL      MRLSATKALLEIIIASVSAIY-----GLGDPQALHLSRGDIINQRDILRRLAELQYKRNDMAFERGTFRV
UVRB_BIFLO      ATANLLTRRDCVVVATVSCIY-----GLGTPEEYALKVGQEINRDDLLRQFVAMQYKRNDIAFTRGTFRV
UVRB_TROW8      ATTSLLTRRDVIVVATVSCIY-----GLGAPSEYRLEVGQKISQRVLLERFTQLQYNRNDVGFERGNFRV
UVRB_PROMT      ATRSLFERDDVIVVASISCIYGLGIPSEYLKASVKFQVGQSIDLRSCLRSLVSNQYTRNDIEISRGRFRV
UVRB_PROM1      ATRSLFERDDVIVVASISCIYGLGIPSEYLKASVKFQVGQSIDLRSCLRSLVSNQYTRNDIEISRGRFRV
UVRB_DESVV      ATHALLTRRDVVIVASVSCIY-----GLGSPEVIPVECGQRFSMDALMTRLVEVQYQRNDFDFHRGTFRV
UVRB_DESVH      ATHALLTRRDVVIVASVSCIY-----GLGSPEVIPVECGQRFSMDALMTRLVEVQYQRNDFDFHRGTFRV
UVRB_BACSK      ATSSLFERRDVIIIASVSCIY-----GLGSPEEYRIRTGMEMDRNSLLRKLVDIQYDRNDINFVRGTFRV
UVRB_STRT2      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDKLLNDLVDIQFERNDIDFQRGKFRV
UVRB_STRT1      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDKLLNDLVDIQFERNDIDFQRGKFRV
UVRB_CHLL2      ATSSLLSGRRDVIVVSSVSCIY----GLGSAQIIELRPGMEKDRDQFLQELVSLHYVRDDMKPGPGKFRV
UVRB_THICR      RLSATKALMERKDVVLIATV--SAIYGLGDPDQLQLRLGDTISQRDILQQLTTMQYTRNDVELWRGCFRV
UVRB_SYMTH      DEIDKLRHSATMALFERRDVIVSCIYGLGSPEDYRLRVGNQVDRDYILRRLVDIQYERNDHNFVRNKFRV
UVRB_STRTD      ATSALLERNDVIVVASVSCIY-----GLGSPKEVSLRPGQEISRDKLLNDLVDIQFERNDIDFQRGKFRV
UVRB_MYCUA      -----ATXXXXXXXXXXXXXXXXCIYGLGTPQSVELQVGTDVPRDGLLRLLVDVQYTRNDLSFTRGSFRV
PRIA_BACSU      ----------------------------------------------------------------------
UVRB_NITOC      ATKAFLERPDAIVVASVSAIY-----GLGDKDSLHLMVGDTVDHRGILRRLAELQYQRNDRELYRGTYRV
UVRB_MICAN      ATRSLFERRDVIVVASISCIYGLGMPAEYLKAAISLTVGQEFDQRQLLRALVSVQYNRNDLELTRGRFRL
UVRB_CYAP4      ATRSLFERKDVIVVASISCIYGLGIPSEYLNASVPLQVGIEVDQRQLLRDLTTIQYSRNDLDLGRGRFRV
PRIA_HAEIN      ----------------------------------------------------------------------
UVRB_SYNY3      ATRSLFERRDVIVVASISCIYGLGIPSQYLKAAVPLQVGAEYDPRLVIRDLVNVQYSRNDVELQRGRFRL
UVRB_MYCLE      -----ATXXXXXXXXXXXXXXXXCIYGLGTPQSVELAVSNEVPRDGLLRLLVDVQYTRNDLSFTRGSFRV
UVRB_METCA      MRLSATKALIEVIVATVSSIY-----GLGEPASLHLVRGDMIDQRTLVRRLAELQYTRNEAELRRGSYRV
UVRB_CLOB8      ATSALFERRDVIIVASVSCIY-----GLGNPDEISLRTGMEKERDEVIKKLIEIQYERNDIDFSRGTFRV
UVRB_THETN      ATAALFERRDVIIVASVSCIY-----GLGD--PISLRPGMVKDRDEIIRKLVEIQYERNDINFTRGKFRV
UVRB_PHOLL      MRLSATKALLEIVVASVSAIY-----GLGDPDSLHLTNGMMIDQRSILRRLAELQYTRNDQAFQRGTFRV
UVRB_NEIMB      ATKNLMTRNDVIIVATVSAIY-----GIGDQMVLSVKEGDTIEQRDIIATLVSMQYERGDLDFKRGSFRV
UVRB_VIBPA      MRLSATKALLEIIVASVSAIY-----GLGDPESLHLRRGDVIDQRDMLRRLAELQYSRNDVAFERGQFRV
UVRB_NEIMA      ATKNLMTRDDVIIVATVSAIY-----GIGDQMVLSVKEGDTIEQRDIIATLVSMQYERGDLDFKRGSFRV
UVRB_NEIGO      ATKNLMTRDDVIIVATVSAIY-----GIGDQMVLSVKEGDTIEQRDIIATLVSMQYERGDLDFKRGSFRV
UVRB_NEIG1      ATKNLMTRDDVIIVATVSAIY-----GIGDQMVLSVKEGDTIEQRDIIATLVSMQYERGDLDFKRGSFRV
UVRB_NATTJ      ATSALFERRDVIIVASVSCIY-----GLGSPEEYRLRCGMEKDRDEILKGLVDIQYSRNDVNFTRGTFRV
UVRB_BACHD      ATSALFERNDVIIVASVSCIY-----GLGSPEEYKLRTGMEIERNDLLRQLVDIQYDRNDVNFTRGTFRV
UVRB_AZOSE      EHIEQMRLSATKSLMERRDVVVSCIYGIGDAMILHLREGERIAHRDLVQRLVAMQYTRSDIDFRRGTFRV
UVRB_VIBVY      ATKALLERKDAIIVASVSAIY-----GLGDPEALHIRRGDVMDQRDILRRLAELQYSRNDIAFERGQFRV
UVRB_VIBVU      ATKALLERKDAIIVASVSAIY-----GLGDPEALHIRRGDVMDQRDILRRLAELQYSRNDIAFERGQFRV
UVRB_SYNPX      ATRSLFERRDVIVVASISCIYGLGIPSEYLKAAVKFEVGETLNIRSQLRELVNNQYSRNDTEIARGRFRM
UVRB_PHOPR      MRLSATKALLEIIIASVSAIY-----GLGDPDSLHVRRGDMLNQRDILRRLAELQYTRNDVSFERGHFRV
UVRB_CLOPS      ATSALLERRDVIIVASVSCIY-----GLGNPEEISLRPGMIKDRDEVIKKLIEIQYERNDIDFARGTFRV
UVRB_CLOPE      ATSALLERRDVIIVASVSCIY-----GLGNPEEISLRPGMIKDRDEVIKKLIEIQYERNDIDFARGTFRV
UVRB_CLOP1      ATSALLERRDVIIVASVSCIY-----GLGNPEEISLRPGMIKDRDEVIKKLIEIQYERNDIDFARGTFRV
UVRB_SYNJA      ATRSLFERRDVIVVASVSCIY-----GLGMPEEIPFQVGQEINQREVLRDLAGIQYERNDLELARGRFRV
UVRB_PROM4      ATRSLFERRDVIVVASISCIYGLGIPSEYLKASVKFQLGNDINVRESLRELVSNQYVRNDVDISRGNFRI
UVRB_ACAM1      ATRSLFERQDVIVVASISCIYGLGIPAEYLKASIPLKVGAEVDQRQLLRNLAAVQYTRNDVDLGRGRFRV
UVRB_HELHP      ATTSLLAYDDIIVIASVSANY-----GLGNLTMIHKFEGQEEAQKTLLLKLVDMGYTRNDTIFERGNFRV
UVRB_DECAR      DHIEQMRLSATKSLIERRDVVVSCIYGIGDRDELTMRVGDKLDQRAIVKRLTDMQYERNEMDFHRGTFRV
PRIA_RICBR      ----------------------------------------------------------------------
UVRB_OCEIH      ATSALFERQDVLIVASVSCIY-----GLGNSQVLSLRMGMEKDRDQLLRDLVEVQYARNDINFQRGTFRV
UVRB_LACAC      TTSALMERNDVIVVASVSCIY-----GLGDPKELMIHEGQEYERNTLLRDLVNLQYDRNDIDFQRGRFRV
UVRB_CARHZ      DEIDKLRHSATAALFERRDVIVSCIYGLGDPQEYRVRKGQIYEREAILRKLVDIQYERNEYDLTRGKFRV
PRIA_RICFE      ----------------------------------------------------------------------
UVRB_SYNS3      ATRSLFERRDVIVVASISCIYGLGIPSEYLKAAVPFKVGETLNLRGSLRDLVNNQYSRNDTEAGRGRFRV
UVRB_LEPIN      ATSSLLEREDVVIVSSVSCIY-----GLGSPEEVALKVGDTIERDTVIRKLLHIQYNRNDLDFSRGNFRV
UVRB_LEPIC      ATSSLLEREDVVIVSSVSCIY-----GLGSPEEVALKVGDTIERDTVIRKLLHIQYNRNDLDFSRGNFRV
UVRB_DEHE1      ATRALFERRDVVIVASVSCIY-----GLGEPEEYRLKKGQSXXXXXXXXXXVDMQYERNDIDFSRGKFRL
UVRB_SYNPW      ATRSLFERRDVIVVASISCIYGLGIPSEYLKAAVKFEVGETLNIRGQLRELVNNQYSRNDTEIARGRFRM
UVRB_PELCD      ATRSLLSRNDVLIVSSVSCIY-----GLGSPEAIRLETGMQLDRNALLKNLVEIQYDRNDVDFHRGTFRV
UVRB_LEPBL      ATSSLLEREDVVIVSSVSCIY-----GLGSPEEVALKTGDTIERDAVIRKLLHIQYNRNDIDFSRGNFRV
UVRB_LEPBJ      ATSSLLEREDVVIVSSVSCIY-----GLGSPEEVALKTGDTIERDAVIRKLLHIQYNRNDIDFSRGNFRV
UVRB_SYNJB      ATRSLFERRDVIVVASVSCIY-----GLGMPEEIPFKVGQEINQRDVLRDLASIQYERNDLELVRGRFRL
UVRB_PROMA      ATRSLFERDDVIVVASISCIYGLGIPSEYLKASVKFKVGNEINLRKSLRELVANQYFRNDFDIGRGKFRV
UVRB_FUSNN      DEIDKLTAALIIIVASVSSIY-----GLGSPDTYRIDKQTGISRKELMKRLIALRYDRNDVAFERGQFRI
UVRB_PSEAE      ATKALLERPDAIIVATVSSIY-----GLGDKMVLHLDRGDRIDQRELLRRLTSLQYTRNDMDFARATFRV
UVRB_METBU      ---------------------------------VILRTGDEVGRSDLFAALINIHYERNDIESAKGSFRS
PRIA_RICCN      ----------------------------------------------------------------------
UVRB_ZYMMO      ATRSLLEREDVIIVASVSCLY-----GIGSVDTYRLLKGQLVDQREIIRRLVALQYKRNEVAFGRGSFRV
UVRB_THENN      TLKSVRTRRDVIVVASVSCIYATGDPNDFDRMNIKLSVGERLDVFELAEKLAKIGYQRTEDVSLSGCFRI
UVRB_THEEB      ATRSLFERRDVIVVASISCIYGLGIPAEYLKAAIPLEVGRETEXXXXXXXXATIQYTRNDVELGRGRFRV
UVRB_STRAW      ATNSLLTRRDVVVVASVSCIY-----GLGTPQEVPXXXXXXXXXXXXXXXXXXIQYTRNDLAFTRGTFRV
UVRB_PASMU      ATKSFLERRDTIVVASVSAIY-----GLGDPDSLHLQTGAIINQRQILAQLAELQYTRNDQAFERGTFRV
UVRB_IDILO      MRLSATKALMEVLVASVSAIY-----GLGDPESLHLRRGDIIDQRDVLRRLAQLQYKRNDAAFERGTYRV
UVRB_TREDE      DEIDRLRLSATFSLMERRDVIVSCIYGLGDLR-ITIEKGENIEIEKLKKQLISLQYERNDAVLERGRFRV
UVRB_PECCP      MRLSATKALLEIVVASVSAIY-----GLGDKMMLHLTQGMLIDQRAILRRLAELQYSRNDQAFQRGTFRV
UVRB_CAMJR      --------------------------------------GMQISQKELLKKLVDMGYKRNDNFFDRADFRV
UVRB_CAMJE      --------------------------------------GMQISQKELLKKLVDMGYKRNDNFFDRADFRV
PRIA_CHLTR      ----------------------------------------------------------------------
UVRB_THESQ      TLKSVRTRRDVVVVASVSCIYATGDPNDFDRMNINLAVGDRIDVLELAERLARIGYQRTEDVSLSGCFRL
UVRB_THEP1      TLKSVRTRRDVVVVASVSCIYATGDPNDFDRMNINLAVGDRIDVLELAERLARIGYQRTEDVSLSGCFRL
UVRB_THEMA      TLKSVRTRRDVVVVASVSCIYATGDPNDFDRMNINLAVGDRIDVLELAERLARIGYQRTEDVSLSGCFRL
UVRB_THEAB      AIKSIMTRKDVIVVASVSAIYNP--KDFSDLNFV-LSVGQEIDLEGFLTHLARIGYERKEEVALGGTFRV
UVRB_CLAMS      T-----TNXXXXXXXXXXXXXXXCIYGLGQPEQVALQVGMQINRDTLIRKFVSMQYQRNDVDFSRGNFRV
UVRB_CLAM3      T-----TNXXXXXXXXXXXXXXXCIYGLGQPEQVALQVGMQIDRDTLIRKFVSMQYQRNDVDFSRGNFRV
UVRB_ACIAD      HIDQMRLSATRALLERRDAIIVASVSGLGDPEALHVVEGXXXXXXXXXXXXVEMQYTRNELEFLRGTYRI
PRIA_RICPR      ----------------------------------------------------------------------
UVRB_HAEIN      ATKSFLERRDTIVVASVSAIY-----GLGDPDSLHLQQGAIIDQRQILAKLAELQYTRNDQAFQRGTFRV
UVRB_HAEI8      ATKSFLERRDTIVVASVSAIY-----GLGDPDSLHLQQGAIIDQRQILAKLAELQYTRNDQAFQRGTFRV
UVRB_HAEDU      MRLSATKSFLEIVVASVSAIY-----GLGDVNALHLQVGAIINQRDILARLAELQYTRNDQAFQRSTFRV
UVRB_FRATT      MRLSATKAILEIIVATVSAIY-----GLGDPEQLHLKVGEELGLKKAQTKLVEMQYSRNDMDFSRGSFRV
UVRB_ERWCT      MRLSATKALLEIVVASVSAIY-----GLGDKMMLHLTQGMLIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_COXBU      HIEQMRLSATKAITERHDTIIIATVSGLGDPDSLHLTRGDQIDQRKILQRLAELQYTRNDLELRRATYRV
UVRB_COXBR      HIEQMRLSATKAITERHDTIIIATVSGLGDPDSLHLTRGDQIDQRKILQRLAELQYTRNDLELRRATYRV
UVRB_COXBN      HIEQMRLSATKAITERHDTIIIATVSGLGDPDSLHLTRGDQIDQRKILQRLAELQYTRNDLELRRATYRV
UVRB_COXB2      HIEQMRLSATKAITERHDTIIIATVSGLGDPDSLHLTRGDQIDQRKILQRLAELQYTRNDLELRRATYRV
UVRB_COXB1      HIEQMRLSATKAITERHDTIIIATVSGLGDPDSLHLTRGDQIDQRKILQRLAELQYTRNDLELRRATYRV
UVRB_CAMFF      ---------------------------------------------ELLLKLVDMGYKRNDAYFDRGDFRV
UVRB_CLOAB      ATSALFERRDVIVVASVSCIY-----GLGNPEEISLRTGMNKDRDEILEKLVEMQYERNEINFVRGTFKV
UVRB_CHLPD      -------------------------------QIVELRSGMEKDRDLFLQELVSLHYIRDDVDPGPGKFRV
UVRB_ACTP2      MRLSATKSFLEIVVASVSAIY-----GLGDVDALHLQLGAIIDQREILARLAELQYTRNDQAFQRSTFRV
DDX52_MOUSE     ----------------------------------------------------------------------
UVRB_PROMH      MRLSATKALLEIVVSSVSAIY-----GLGDPDSLHLSNGMIIDQRAILRRLADLQYTRNDQAFQRGTFRV
UVRB_HAMD5      MRLSATKALLEIVVASVSAIY-----GLGDKMMLHLTKGMIIDQRAILARLSELQYSRNDQVFQRGTFRV
UVRB_FERNB      DINDVIA---RMRMSAIKSIMTXXXYACGDPRDIKLEVGQRINLSEFVKKLVKIGYERKEDIGLTGSFRL
UVRB_CHLTE      -------------------------------QIVELRQGMELDRDEFLQRLVALHYFRDDVDLSPGRFRV
UVRB_CHLCH      XXXXXXXXXXXIVVSSVSCIY-----GLGSAQIIKLRAGMEKDRDEFLRELISLHYLRDDVQPTSGRFRV
PRIA_RICTY      ----------------------------------------------------------------------
DDX52_RAT       ----------------------------------------------------------------------
DDX42_XENLA     ----------------------------------------------------------------------
UVRB_RICRS      ATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMVVNLEPGQSYLRDQLLNDLINLQYERNDIGFERGCFRV
UVRB_RICRO      ATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMVVNLEPGQSYLRDQLLNDLINLQYERNDIGFERGCFRV
UVRB_RICPU      ATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMMVNLEPGQSYLRDQLLNDLINLQYERNDIGFERGCFRV
UVRB_RICCN      ATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMMVNLEPGQSYPRDQLLNDLINLQYERNDIGFERGCFRV
UVRB_RICAE      ATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMMVNLEPGQSYPRDQLLNDLINLQYERNDIGFERGCFRV
UVRB_HELPY      ----------------------------------KIKVGEKRAYKSFLLKLVEMGYSRNEVVFDRGSFRA
UVRB_HELPJ      ----------------------------------KIKVGEKRAYKSFLLKLVEMGYSRNEVVFDRGSFRA
UVRB_HELPH      ----------------------------------KIKVGEKRAYKNFLLKLVEMGYSRNEVVFDRGSFRA
UVRB_HELAH      ----------------------------------KIKVGEKRAYKSFLLKLVEMGYSRNEVVFDRGSFRA
UVRB_CAMHC      ---------------------------------------------------VDMGYSRNDTYFDRGDFRV
PRIA_CHLMU      ----------------------------------------------------------------------
UVRB_METST      -----------------------------------------ISREDILKELVKMQYSRNDIEFIRGQFRV
DDX52_HUMAN     ----------------------------------------------------------------------
DDX42_MOUSE     ----------------------------------------------------------------------
UVRB_YERE8      ----------QMRLSATKALLEXXIYGLGDKMMLHLTKGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_THIDA      -----LERRDTVIVCTVSAIY-----GIGDPSDYHLRQNDKMTQREVIARLTQMQYDRNDVDFKRGVFRV
UVRB_THET8      EIEXXXXXXXXIVVASVSAIY-----GLGDPREYRARNGKPYPXXXXXXXXXXXGYQRNDIDLSPGRFRA
UVRB_SERP5      MRLSATKALLEIVVASVSAIY-----GLGDKMMLHLTKGMIIDQRSILRRLAELQYARNDQAFQRATFRV
UVRB_PSEPF      MRLSATKALLERKDAIIVTTVS-CIYGLGSPETLHVDRGDKLDQRALVRRLADLQYTRNDMDFARATFRV
UVRB_ENT38      MRLSATKALLEIVVASVSAIY-----GLGDKMMLHLTNGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_SHIFL      MRLSATKAMLEIVVASVSAIY-----GLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_SHIF8      MRLSATKAMLEIVVASVSAIY-----GLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_RICFE      ATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMTVNLEPGKSYPRDKLLNDLINLQYERNDIGFERGCFRV
UVRB_RICBR      ATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMTVNLEPGKSYPRDKLLNDLVNLQYERNDIGFERGCFRV
UVRB_RICB8      ATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMTVNLEPGKSYPRDKLLNDLVNLQYERNDIGFERGCFRV
UVRB_LEPBP      EEIDKLTSSLRDDVIIVSSV--SCIYGLGSPEDVMLQVGDKIDRDQIIRKFLHIQYARNDIDFSRGNFRV
UVRB_LEPBA      EEIDKLTSSLRDDVIIVSSV--SCIYGLGSPEDVMLQVGDKIDRDQIIRKFLHIQYARNDIDFSRGNFRV
UVRB_CHLPB      ATSSLLSGRKDVIVVSSVSCIY----GLGKAQIIELRVNMEKERDSFLQELISLHFVRDDSDLAPGKFRV
UVRB_RICM5      ATRSLLERRDVIVVSSVSCIYGLGSPDLYYQMMVNLEPGQSYPRDQLLNDLINLQYERNDIGFERGCFRV
UVRB_MANSM      ATKSFLERRDTIVVASVSAIY-----GLGDPDSLHLQTGAIIDQRQILVRLAELQYTRNDQAFQRGTFRV
UVRB_CHRVO      ATKSILERPDCIIVATVSAIY-----GIGDPSDLHLKEGETTPQRDIISRLTTMQYSRNDLDFGRGTFRV
DDX52_BOVIN     ----------------------------------------------------------------------
DDX42_PONAB     ----------------------------------------------------------------------
DDX42_HUMAN     ----------------------------------------------------------------------
UVRB_YERPY      ----------QMRLSATKALLEXXIYGLGDKMMLHLTRGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_YERPS      ----------QMRLSATKALLEXXIYGLGDKMMLHLTRGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_YERPP      ----------QMRLSATKALLEXXIYGLGDKMMLHLTRGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_YERPN      ----------QMRLSATKALLEXXIYGLGDKMMLHLTRGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_YERPG      ----------QMRLSATKALLEXXIYGLGDKMMLHLTRGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_YERPE      ----------QMRLSATKALLEXXIYGLGDKMMLHLTRGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_YERPB      ----------QMRLSATKALLEXXIYGLGDKMMLHLTRGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_YERP3      ----------QMRLSATKALLEXXIYGLGDKMMLHLTRGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_KOSOT      --------------------------------------GQRIPRNELALKLASIQYSRSEDISSGGVFHL
RH3_ARATH       ----------------------------------------------------------------------
UVRB_RICAH      ATRSLLERRDVIVVASVSCIYGLGSPDLYYQMTVNLEPGKSYPRDKLLNDLINLQYKRNDMGFERGCFRV
DDX42_CHICK     ----------------------------------------------------------------------
UVRB_PARUW      DKIDKMR------LSATRSLLEXXXYGLGSPEYYRLSQGQMRRRDDILLHLVEMQYKRNDFEFIRSTFRV
UVRB_LEGPL      MRLSATKALIEIIVATVSAIY-----GLGDPDSLHLSRGEQSDQRKILKRLAEMQYTRTNLSLERGQFRV
UVRB_LEGPH      MRLSATKALIEIIVATVSAIY-----GLGDPDSLHLSRGEQSDQRKILKRLAEMQYTRTNLSLERGQFRV
UVRB_LEGPC      MRLSATKALIEIIVATVSAIY-----GLGDPDSLHLSRGEQSDQRKILKRLAEMQYTRTNLSLERGQFRV
UVRB_LEGPA      MRLSATKALIEIIVATVSAIY-----GLGDPDSLHLSRGEQSDQRKILKRLAEMQYTRTNLSLERGQFRV
UVRB_RICPR      ATRSLLERRDVIVISSVSCIYGLGAPDLYYQMTVHLEPGQNYPRDKLLNDLINLQYKRNDIGFERGCFRV
UVRB_RALEJ      ATKSLLERRDTIIVATVSAIY-----GIGNPNELTLRTGDKISQRDVIARLIAMQYTRNETDFQRGTFRV
UVRB_NITEU      ED--------AIIVATVSCIY-----GIGD--PVHVREHEKISQRDIIQRLTGMQYQRNEFEFARGTFRV
UVRB_MYCMO      TLNSISTKRDTIVVASVASIY-------GALKPYNISIAQKISRKEFLLDLVQRGYKRNNVASEPGSFNA
UVRB_COLP3      MRLSATKALLEIIIASVSAIY-----GLGDPDSLHISRGDIINQRDILRRLAELQYTRNDVAFARATYRV
UVRB_XANAC      ATKTLLSRRDSLVVATVSAIY-----GLGDYLSLRLSVGEHIDQRQLIRHLTDLQYTRNEFELTRGAFRV
UVRB_RICTY      ATRSLLERRDVIVIASVSCIYGLGAPDLYYQMTVHLELGQSYPRDKLLNDLINLQYKRNDIGFERGCFRV
RH51_ORYSJ      ----------------------------------------------------------------------
PRIA_HELPY      ----------------------------------------------------------------------
PRIA_HELPJ      ----------------------------------------------------------------------
UVRB_YERPA      MRLSATKALLERRDXXXXXXXXXIYGGVPDLMMLHLTRGMIIDQRSILRRLSELQYSRNDQVFQRGTFRV
UVRB_WOLSU      SATTSLLAHEDVIVVASVSANYGLGSPAEYVQMIQKLEGXXXXXXXXXXXXXXMGYKRNDNFFDRGDFRV
UVRB_THELT      -----------------------------DRMNIQLSTGLKISPHAVAQHLAKIGYERSNEITVKGCFRL
DDX55_MOUSE     ----------------------------------------------------------------------
UVRB_METMP      -----------------------------------LKVGEKIKRSDIIEKLVDIQYERNDMELVPGRFRV
UVRB_ERWT9      ----------QMRLSATKALLEXXIYGLGDKMMLHLSRGMVIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_ANATD      ATSALFERRDVIIVASV-SCIYSLGSPEDYLNTISLRPGMTKDRDEVIRDLIRMQYERNDIXXXXXXXXX
MS116_CANGA     ----------------------------------------------------------------------
DDX55_BOVIN     ----------------------------------------------------------------------
UVRB_RICCK      ATRSLLERRDVIVVSSVSCIYGLGSPNLYYQMTVNLESGKSYPRDKLLSDLVNLQYERNDIGFERGCFRV
RH9_ORYSJ       ----------------------------------------------------------------------
RH53_ORYSJ      ----------------------------------------------------------------------
DDX42_DICDI     ----------------------------------------------------------------------
UVRB_XANOR      ATKTLLSRRDSLVVATVSAIY-----GLGDYLSLRLSIGEHIDQRQLIRHLTDLQYTRNEFELTRGAFRV
UVRB_XANOP      ATKTLLSRRDSLVVATVSAIY-----GLGDYLSLRLSIGEHIDQRQLIRHLTDLQYTRNEFELTRGAFRV
UVRB_XANOM      ATKTLLSRRDSLVVATVSAIY-----GLGDYLSLRLSIGEHIDQRQLIRHLTDLQYTRNEFELTRGAFRV
UVRB_XANCP      ATKTLLSRRDSLVVATVSAIY-----GLGDYLSLRLSIGEHIDQRQLIRHLTDLQYTRNEFELTRGAFRV
UVRB_XANCB      ATKTLLSRRDSLVVATVSAIY-----GLGDYLSLRLSIGEHIDQRQLIRHLTDLQYTRNEFELTRGAFRV
UVRB_XANC8      ATKTLLSRRDSLVVATVSAIY-----GLGDYLSLRLSIGEHIDQRQLIRHLTDLQYTRNEFELTRGAFRV
UVRB_RALSO      SLLERRDVVIVATVSAIYGIGNPTEY---HQMILTLRTGDKISQRDVIARLIAMQYTRNETDFQRGTFRV
UVRB_BORPD      SLLERRDTVIVGTVSCIYGIGNP-----GDYHAMVLRAGDRISRREVLARLVAMQYTRNDADFARGTFRV
UVRB_ANAMM      ATRSLLERRDVVVVASVSCIYGLGSPELYSEMTVPIALGMKLDMCQLQERLVELQYKHGNRYE-RGNFSV
RH3_ORYSJ       ----------------------------------------------------------------------
UVRB_GLOVI      ATRSLFERRDVIVVASVSCIY-----GLGMPEEIPLKVGSNIDQRELLRQLVTVQYERNDIDLXXXXXXX
UVRB_ANAMF      ATRSLLERRDVVVVASVSCIYGLGSPELYSEMTVPIALGMKLDMCQLQERLVELQYKHGNRYE-RGSFSV
DDX55_DANRE     ----------------------------------------------------------------------
UVRB_PSEHT      MRLSATKALLEIIVASVSAIY-----GLGDPKSLLLKVGEKVDQRDMLRRLAEIQYTRNDVDFSRGTYRV
UVRB_METTH      --------------------------------------GSGPGREEVLEGLINMQYERNDVEFDRGQFRV
UVRB_BACFR      RKDV-------VVVSSVSCIY-----GMGNPSDIEIERGRTINRNVFLRRLVDSLYMRNDIELNRGNFRV
UVRB_BACFN      RKDV-------VVVSSVSCIY-----GMGNPSDIEIERGRTINRNVFLRRLVDSLYMRNDIELNRGNFRV
RH51_ARATH      ----------------------------------------------------------------------
DDX55_CHICK     ----------------------------------------------------------------------
UVRB_XYLFT      MRLAATKALLSLVVATVSAIY-----GLGDYLSLRLSLGEHIEQRQLIRHLTELQYTRNELDLVRGSFRV
UVRB_XYLFM      MRLAATKALLSLVVATVSAIY-----GLGDYLSLRLSLGEHIEQRQLIRHLTELQYTRNELDLVRGSFRV
UVRB_XYLFA      MRLAATKALLSLVVATVSAIY-----GLGDYLSLRLSLGEHIEQRQLIRHLTELQYTRNELDLVRGSFRV
UVRB_XYLF2      MRLAATKALLSLVVATVSAIY-----GLGDYLSLRLSLGEHIEQRQLIRHLTELQYTRNELDLVRGSFRV
UVRB_METMA      KIEQMRLAATASLMSRQDVIVVASVSGLGNPENFQLKVGDKVHRKEILEKLIDIQFERNDLELMPGRFRV
UVRB_EDWI9      ----------QMRLSATKALLEXXIYGLGDKMMLHLTQGMLIDQRSILRRLSELQYVRNDQAFARGTFRV
UVRB_BORA1      SLLERRDTIIVGTVSCIYGIGNP-----GDYHAMVLRAGDRISRREVLARLVAMQYTRNDADFTRGAFRV
PRIA_RHORU      ----------------------------------------------------------------------
DRS1_YARLI      ----------------------------------------------------------------------
UVRB_KLEP7      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_KLEP3      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_BORPA      SLLERRDTVIVGTVSCIYGIGNP-----GDYHAMVLRTGDRISRREVLARLVAMQYTRNDADFTRGVFRV
UVRB_BORBR      SLLERRDTVIVGTVSCIYGIGNP-----GDYHAMVLRTGDRISRREVLARLVAMQYTRNDADFTRGVFRV
DDX55_HUMAN     ----------------------------------------------------------------------
UVRB_SALPK      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALPA      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_METS3      XXXXXXXXXXXXXXXCIYGIGSP--EDYGEFA-FGIAVGDNYDRSDIIRKLVFMQYERNDIEFARGHFRV
MPH1_KLULA      ----------------------------------------------------------------------
DRS1_PICGU      ----------------------------------------------------------------------
DDX55_XENLA     ----------------------------------------------------------------------
UVRB_SHISS      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_SHIDS      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_SHIBS      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_SHIB3      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_SALTY      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALTI      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALSV      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALPC      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALPB      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALNS      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALHS      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALG2      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALEP      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALDC      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALCH      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALAR      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_SALA4      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMLIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_RHILO      ATRSLLERDDVIIVASVSCIY-----GIGSVETYQMQIGXXXXXXXXXXXXXXXXYKRQDINFVRGSFRV
UVRB_METAC      -----------------------------------LKVGDKVQRKEILEKLIDIQFERNDMELMPGRFRV
UVRB_ESCF3      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYTRNDQAFQRGTFRV
UVRB_ECOUT      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECOSM      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECOSE      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECOLU      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECOLI      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECOLC      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECOL5      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECOK1      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECOHS      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECODH      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECOBW      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECO8A      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECO81      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECO7I      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECO5E      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECO57      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECO55      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECO45      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECO27      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_ECO24      MRLSATKAMLERR-DXXXXXXXXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYARNDQAFQRGTFRV
UVRB_CALS8      ATSALFERRDVIIVASV-SCIYSLGSPEDYLNTLSLRPGMIKDRDEVIRELIRMQYERNDIXXXXXXXXX
UVRB_BACTN      ATSSLLSGRKDVVVVSSVSCIY----GMGNPSDIEIERGRMLDRNVFLRRLVDSLYVRNDIDLNRGNFRV
RH55_ARATH      ----------------------------------------------------------------------
RH49_ARATH      ----------------------------------------------------------------------
PRIA_TREPA      ----------------------------------------------------------------------
UVRB_WOLTR      AVCSLLERRDTIVVASVSCIY-----GLGSPESITLSTGDRIRINDFLNDLANLQYKRSDIRFERGYFRM
UVRB_CITK8      ----------QMRLSATKALLEXXIYGLGDKMMLHLTVGMIIDQRAILRRLAELQYTRNDQAFQRGTFRV
ROK1_SCHPO      ----------------------------------------------------------------------
DRS1_PICST      ----------------------------------------------------------------------
DRS1_ASHGO      ----------------------------------------------------------------------
DDX55_DROME     ----------------------------------------------------------------------
UVRB_ANAPZ      ATRSILERRDVIVVASVSCIYGLGSPELYSEMTIPLSIGMQIDLCQLKEKLVELQYKSGSQCE-RGTFSV
RRP3_PICGU      ----------------------------------------------------------------------
PRIA_SYNY3      ----------------------------------------------------------------------
HAS1_MAGGR      ----------------------------------------------------------------------
DRS1_NEUCR      ----------------------------------------------------------------------
UVRB_BURPS      SLMERRDV---VIVATVSAIY-----GIGNPSELTLRTGDKIGQREVIARLIAMQYTRNEQDFQRGTFRV
UVRB_BURMA      SLMERRDV---VIVATVSAIY-----GIGNPSELTLRTGDKIGQREVIARLIAMQYTRNEQDFQRGTFRV
RRP3_ENCCU      ----------------------------------------------------------------------
MPH1_CANGA      ----------------------------------------------------------------------
IF4A_DROME      ----------------------------------------------------------------------
HAS1_GIBZE      ----------------------------------------------------------------------
DRS1_CANAL      ----------------------------------------------------------------------
DDX52_DICDI     ----------------------------------------------------------------------
UVRB_MYCPE      ---------------------------------VAYKKNQVIPIKQVQYELVNLNYQRNDVDVTHGRFSV
RHLB_ALISL      ----------------------------------------------------------------------
RH53_ARATH      ----------------------------------------------------------------------
RH7_ORYSJ       ----------------------------------------------------------------------
MFH1_SCHPO      ----------------------------------------------------------------------
UVRB_EUBR3      DEIDKLRLSATAALTERKDVIVSCIYGLGSPDEISLRPGQEXXXXXXXXXXXXXQYTRNDMDFHRGTFRV
UVRB_CHLCV      EIDKLRLSATRSILERRDTLIVSSVSGIGSPEALELKVGKEYPRTLLAAQLVKMNY-QASPVAQRSTFRE
UVRB_BORPE      SLLERRDTVIVGTVSCIYGIGNP-----GDYHAMVLRTGDRISRREVLARLVAMQYTRNDADFTRGVFRV
RH9_ARATH       ----------------------------------------------------------------------
DRS1_KLULA      ----------------------------------------------------------------------
DRS1_CANGA      ----------------------------------------------------------------------
UVRB_MYCPN      ----------------------------------------------------------------------
RRP3_CANAL      ----------------------------------------------------------------------
RH32_ARATH      ----------------------------------------------------------------------
PRP28_SCHPO     ----------------------------------------------------------------------
MPH1_MAGGR      ----------------------------------------------------------------------
DDX4_MOUSE      ----------------------------------------------------------------------
DDX4_BOVIN      ----------------------------------------------------------------------
DBP7_ASPTN      ----------------------------------------------------------------------
UVRB_CORDI      -----------------------------------------------------IQYDRNDVGFTRGTFRV
ROK1_YARLI      ----------------------------------------------------------------------
RH5_ORYSJ       ----------------------------------------------------------------------
IF4A_TRYBB      ----------------------------------------------------------------------
DDX4_MACFA      ----------------------------------------------------------------------
DDX4_HUMAN      ----------------------------------------------------------------------
DBP3_KLULA      ----------------------------------------------------------------------
Y383_METJA      ----------------------------------------------------------------------
RH18_ARATH      ----------------------------------------------------------------------
IRC3_SCHPO      ----------------------------------------------------------------------
IF4A_TRYCR      ----------------------------------------------------------------------
DDX4_RAT        ----------------------------------------------------------------------
DBP4_ENCCU      ----------------------------------------------------------------------
DBP3_SCHPO      ----------------------------------------------------------------------
UVRB_TREPS      ---------------------------------IHVEVNQCLDLEDLKRQLVSLQYERNDAVLECGRFRV
UVRB_TREPA      ---------------------------------IHVEVNQCLDLEDLKRQLVSLQYERNDAVLECGRFRV
RHLB_PSEA6      ----------------------------------------------------------------------
DRS1_GIBZE      ----------------------------------------------------------------------
DRS1_DEBHA      ----------------------------------------------------------------------
DDX4_PIG        ----------------------------------------------------------------------
DDX10_CHICK     ----------------------------------------------------------------------
UVRB_PSEPK      MRLSATKALLERRDAIIVTTVS-CIYGLGSPETLHVDRGDKXXXXXXXXXXXXXXYTRNEMDFARATFRV
UVRB_PSEF5      MRLSATKALLERKDAIIVTTVS-CIYGLGSPETLHVDRGDKXXXXXXXXXXXXXXYTRNDMDFARATFRV
MPH1_YEAST      ----------------------------------------------------------------------
MPH1_YEAS7      ----------------------------------------------------------------------
UVRB_ONYPE      AAGSLLNRDDVIVVASVSCIY-----GVGDLKDLHLQIGDKYERQALINKLIELKYQRNEINFQRGTFRV
UVRB_AYWBP      ----------------------------------------------------------------------
RH7_ARATH       ----------------------------------------------------------------------
PRP11_SCHPO     ----------------------------------------------------------------------
MPH1_VANPO      ----------------------------------------------------------------------
IF4A_LEIBR      ----------------------------------------------------------------------
DRS1_PHANO      ----------------------------------------------------------------------
DRS1_NEOFI      ----------------------------------------------------------------------
DRS1_ASPFU      ----------------------------------------------------------------------
DCL1_NEUCR      ----------------------------------------------------------------------
DBP3_CANGA      ----------------------------------------------------------------------
DBP3_ASPFU      ----------------------------------------------------------------------
VF509_ASFP4     ----------------------------------------------------------------------
VASA_DROME      ----------------------------------------------------------------------
UVRB_PSESM      MRLSATKALLERKDAIIVTTVS-CIYGLGSPETLHVDRGDKXXXXXXXXXXXXXXYTRNDMDFARATFRV
UVRB_CHLAB      EIDKLRLSATRSILERRDTLIVSSVSGIGSPEALELTVGTEYPRALLASQLVKMHY-QASSVPQRSTFRE
ROK1_PICGU      ----------------------------------------------------------------------
RH21_ORYSJ      ----------------------------------------------------------------------
RH21_ARATH      ----------------------------------------------------------------------
PRP28_PICGU     ----------------------------------------------------------------------
FAL1_USTMA      ----------------------------------------------------------------------
DRS1_SCLS1      ----------------------------------------------------------------------
DHH1_DEBHA      ----------------------------------------------------------------------
DDX18_DICDI     ----------------------------------------------------------------------
VF509_ASFWA     ----------------------------------------------------------------------
VF509_ASFB7     ----------------------------------------------------------------------
UVRB_THEYD      ----------------------------------------------------------------------
UVRB_PSEU2      MRLSATKALLERKDAIIVTTVS-CIYGLGSPETMHIDRGDKXXXXXXXXXXXXXXYTRNDMDFARATFRV
RGYR1_SULSO     ----------------------------------------------------------------------
IF4A_CRYPV      ----------------------------------------------------------------------
DHX58_HUMAN     ----------------------------------------------------------------------
DDX10_HUMAN     ----------------------------------------------------------------------
DBP3_YEAST      ----------------------------------------------------------------------
DBP3_LODEL      ----------------------------------------------------------------------
UVRB_PSE14      MRLSATKALLERKDAIIVTTVS-CIYGLGSPETMHIDRGDKXXXXXXXXXXXXXXYTRNDMDFARATFRV
ROK1_ASPTN      ----------------------------------------------------------------------
RH8_ORYSJ       ----------------------------------------------------------------------
RH6_ORYSJ       ----------------------------------------------------------------------
PRP28_MAGGR     ----------------------------------------------------------------------
IF4A_LEIMA      ----------------------------------------------------------------------
IF4A_LEIIN      ----------------------------------------------------------------------
FAL1_SCHPO      ----------------------------------------------------------------------
DRS1_CRYNE      ----------------------------------------------------------------------
DRS1_BOTFB      ----------------------------------------------------------------------
DDX4_XENLA      ----------------------------------------------------------------------
DBP5_YEAST      ----------------------------------------------------------------------
DBP5_YEAS7      ----------------------------------------------------------------------
DBP3_YEAS7      ----------------------------------------------------------------------
DBP3_PICGU      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RGGILDVFPPTEEHPLRLEFWGDTVEEIRYFQVADQRSISKPGAAEAGLFAPPCRELLLTDTVRKXXXXX
MFD_MYCTU       RGGILDIFAPTAEHPVRVEFWGDEITEMRMFSVADQRSIPEIDIHTLVAFA--CRELLLSEDVXXXXXXX
MFD_MYCBO       RGGILDIFAPTAEHPVRVEFWGDEITEMRMFSVADQRSIPEIDIHTLVAFA--CRELLLSEDVXXXXXXX
MFD_BACSU       RGGIIDIYPLTSENPVRIELFDTEVDSIRSFNSDDQRSIETLTSINIG----PAKELII-----------
MFD_STAAB       RGGIIDIFPLIGE-PIRIELFDTEIDSIRDFDVETQR--SKDNIEEVDITT--ASDYIITEEVKEELKTA
MFD_STAAW       RGGIIDIFPLIGE-PIRIELFDTKIDSIRDFDVETQR--SKDNVEEVDITT--ASDYIITEEVKEELKTA
MFD_STAAS       RGGIIDIFPLIGE-PIRIELFDTKIDSIRDFDVETQR--SKDNVEEVDITT--ASDYIITEEVKEELKTA
MFD_STAA8       RGGIIDIFPLIGE-PIRIELFDTEIDSIRDFDVETQR--SKDNVEEVDITT--ASDYIITEEVKEELKTA
MFD_STAA3       RGGIIDIFPLIGE-PIRIELFDTEIDSIRDFDVETQR--SKDNVEEVDITT--ASDYIITEEVKEELKTA
MFD_STAAN       RGGIIDIFPLIGE-PIRIELFDTEIDSIRDFDVETQR--SKDNIEEVDITT--ASDYIITEEVKEELKTA
MFD_STAAM       RGGIIDIFPLIGE-PIRIELFDTEIDSIRDFDVETQR--SKDNIEEVDITT--ASDYIITEEVKEELKTA
MFD_STAAR       RGGIIDIFPLIGE-PIRIELFDTEIDSIRDFDVETQR--SKDNIEEVDITT--ASDYIITEEVKEELKTA
MFD_STAS1       RGGIVDIYPLIGK-PVRIEFFDTEVDSIRDFDVESQRS---EGNIEHVDITTASDYIITEDVLKHTKHKL
MFD_STAHJ       RGGIIDIYPLIGQ-PVRIELFDTEVDSIRDFDVETQRSNDN---IEEVSITTASDYVITDDVIQHLQSEL
MFD_HAEIN       RGALLDLFPMGSAVPFRLDFFDDEIDSIRTFDVDTQRTLDEISSINL----LPAHEFPTDDKGAQFRETF
MFD_STAES       RGGIIDIYPLIGT-PVRIELFDTEVDSIRDFDVETQRS--------------------------------
MFD_STAEQ       RGGIIDIYPLIGT-PVRIELFDTEVDSIRDFDVETQRS--------------------------------
MFD_SYNY3       RGDIVDIFPVSAELPVRLEWFGDELEKIREFDPASQRSL-------------------------------
MFD_STAAC       RGGIIDIFPLIGE-PIRIELFDTEIDSIRDFDVETQRS--------------------------------
MFD_MYXXA       RGDLLDVFSPLYDKPVRLEFFGDTIESIRAFDPQSQRTVD--ALKEVDLV--PAREVLLTDETR------
MFD_ECOLI       RGALLDLFPMGSELPYRLDFFDDEIDSLRVFDVDSQRTLEE-----------------------------
MFD_BORBU       KGEIIDIYPFGEQNPIRIALNFDKIEEIKKFNPLTQ----------------------------------
MFD_BUCAI       ----------------------------------------------------------------------
MFD_RICFE       RGEIIDIILPGPK-AYRINFSWDYIESIKEFDIDTQ--ISTKSCSE--LVISPANEIVL-----------
MFD_RICBR       RGEIVDLILP-ESKGYRINFSWDYVESIKQFDIDTQ--ISTRSCNE--LIISPANEIVL-----------
MFD_RICCN       ----------------------------------------------------------------------
MFD_HELPJ       RGDIVDIYIPNSK-AYRLSFFDAECESIKELDPATQMSLKE-----------------------------
MFD_BUCBP       ----------------------------------------------------------------------
MFD_HELPY       RGDIVDIYAPNSK-AYRLSFFDTECESIKEFDPITQMSLKE-----------------------------
MFD_RICPR       ----------------------------------------------------------------------
MFD_RICTY       ----------------------------------------------------------------------
RECG_BORBU      ----------------------------------------------------------------------
RECG_STRPN      ----------------------------------------------------------------------
RECG_PASMU      ----------------------------------------------------------------------
RECG_TREPA      ----------------------------------------------------------------------
RECG_SYNY3      ----------------------------------------------------------------------
RECG_AQUAE      ----------------------------------------------------------------------
RECG_HAEIN      ----------------------------------------------------------------------
RECG_ECOLI      ----------------------------------------------------------------------
RECG_ECO57      ----------------------------------------------------------------------
RECG_STAES      ----------------------------------------------------------------------
RECG_STAEQ      ----------------------------------------------------------------------
RECG_BACSU      ----------------------------------------------------------------------
RECG_STAAW      ----------------------------------------------------------------------
RECG_STAAS      ----------------------------------------------------------------------
RECG_STAAN      ----------------------------------------------------------------------
RECG_STAAM      ----------------------------------------------------------------------
RECG_STAAR      ----------------------------------------------------------------------
RECG_MYCLE      ----------------------------------------------------------------------
RECG_STAAC      ----------------------------------------------------------------------
RECG_STAA8      ----------------------------------------------------------------------
RECG_MYCTU      ----------------------------------------------------------------------
RECG_MYCBO      ----------------------------------------------------------------------
RECG_HELPJ      ----------------------------------------------------------------------
RECG_HELPY      ----------------------------------------------------------------------
RECG_THIFE      ----------------------------------------------------------------------
UVRB_GEMAT      RGDTVEILPAYEEQAVRIELWGDEIERI------------------------------------------
UVRB_BEUC1      RGDTVEIIPVYEELALRIEFFGDEVEAI------------------------------------------
UVRB_STRCO      RGDTIEIFPVYEELAVRIEMFGDEIEAL------------------------------------------
UVRB_GEOSL      RGDIVEIFPAHEERAYRIEFFGDTVDAI------------------------------------------
UVRB_NATPD      RGDTVEIYPMYGRHAVRVEFWGDEIDRLLKVDIVDGEVVSEEPA--------------------------
UVRB_HALSA      RGDTVEVYPMYGRYPVRVEFWGDEIDRM------------------------------------------
Y1401_METJA     ----------------------------------------------------------------------
UVRB_RENSM      RGDTVEITPMYEEQALRIEFFGDEIEKI------------------------------------------
UVRB_ENTFA      RGDVVEIFPASDEHALRVEFFGDEIDRIR-----------------------------------------
UVRB_LACLS      RGDVVEVFPASDEHAFRVEFFGDEIDRIREIEV-------------------------------------
UVRB_LACLM      RGDVVEVFPASDEHAFRVEFFGDEIDRIREIEV-------------------------------------
UVRB_LACLA      RGDVVEVFPASDEHAFRVEFFGDEIDRIREIEV-------------------------------------
UVRB_CHLAD      RGDTLDIIPANAETAIRVEFWGDEIERI------------------------------------------
UVRB_CLONN      RGDVLDIFPASSTNGIRVEFFGDEIDKIREFDVLTGNIIS------------------------------
UVRB_CLOB6      KGDVLDIFPSSSSKAIRVEFFGDEIDRIKEFDVLTGETITK-----------------------------
UVRB_BACHK      RGDVVEIFPASDEHCIRIEFFGDEIDRIR-----------------------------------------
UVRB_BACCZ      RGDVVEIFPASDEHCIRIEFFGDEIDRIR-----------------------------------------
UVRB_BACCR      RGDVVEIFPASDEHCIRIEFFGDEIDRIR-----------------------------------------
UVRB_BACC1      RGDVVEIFPASDEHCIRIEFFGDEIDRIR-----------------------------------------
UVRB_BACAN      RGDVVEIFPASDEHCIRIEFFGDEIDRIR-----------------------------------------
UVRB_STRS7      RGDVVEVFPASDEHAFRIEFFGDEIDRIR-----------------------------------------
UVRB_STRS2      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STREM      RGDVVEVFPASDEHAFRIEFFGDEIDRIR-----------------------------------------
UVRB_STRA5      RGDVVEVFPASDEHAFRIEFFGDEIDRIR-----------------------------------------
UVRB_STRA3      RGDVVEVFPASDEHAFRIEFFGDEIDRIR-----------------------------------------
UVRB_STRA1      RGDVVEVFPASDEHAFRIEFFGDEIDRIR-----------------------------------------
UVRB_LISMO      RGDVVEIFPASDEHCMRIEFFGDEIERIR-----------------------------------------
UVRB_LISMF      RGDVVEIFPASDEHCMRIEFFGDEIERIR-----------------------------------------
UVRB_LISIN      RGDVVEIFPASDEHCMRIEFFGDEIERIR-----------------------------------------
UVRB_STRE4      RGDVVEVFPASDEHAFRIEFFGDEIDRIR-----------------------------------------
UVRB_PROAC      RGDTLEIFPVYEENALRVEFFGDEIEAL------------------------------------------
UVRB_CLOBM      KGDVLDIFPSSSSKAVRIEFFGDEIDRIKEFDVLTGETITK-----------------------------
UVRB_CLOBL      KGDVLDIFPSSSSKAVRVEFFGDEIDRIKEFDVLTGETITK-----------------------------
UVRB_CLOBK      KGDVLDIFPSSSSKAVRVEFFGDEIDRIKEFDVLTGETITK-----------------------------
UVRB_CLOBJ      KGDVLDIFPSSSSKAVRVEFFGDEIDRIKEFDVLTGETITK-----------------------------
UVRB_CLOB1      KGDVLDIFPSSSSKAVRVEFFGDEIDRIKEFDVLTGETITK-----------------------------
UVRB_SYNP6      KGDVLEIGPAYEDRIIRVEFFGDEIDAIRY----------------------------------------
UVRB_SYNE7      KGDVLEIGPAYEDRIIRVEFFGDEIDAIRY----------------------------------------
UVRB_STRU0      RGDVVEVFPASDEHAFRIEFFGDEIDRIR-----------------------------------------
UVRB_LACPL      HGDVVEIFPASDDHALRVEFFGDEIDRIR-----------------------------------------
UVRB_GEOKA      RGDVVEIFPASDEHCIRVEFFGDEIERIR-----------------------------------------
UVRB_PROM3      RGDVLEIGPAYEDRLVRIELFGDEVEAIRY----------------------------------------
UVRB_HALMA      RGDTLEIYPMYARYALRVEFWGDEIDRM------------------------------------------
UVRB_STAES      RGDVVEIFPASEEMCIRVEFFGDEIDRIR-----------------------------------------
UVRB_STAEQ      RGDVVEIFPASEEMCIRVEFFGDEIDRIR-----------------------------------------
UVRB_DESDG      RGDVLEVIPAHHERALRLEFFGDEIDSIK-----------------------------------------
UVRB_DESVM      RGDVLEIIPAHHERALRIEFFGDDIDAI------------------------------------------
UVRB_CLOTE      RGDVLDIFPASSSNAIRVEFFGDEIEKIREF---------------------------------------
UVRB_BACA2      RGDVVEIFPASDEHCIRVEFFGDEIERIR-----------------------------------------
UVRB_CLOBB      RGDLLDIIPSTSSKGIRIEFFGDEIDRIREFDV-------------------------------------
UVRB_CLOBA      RGDLLDIIPSTSSKGIRIEFFGDEIDRIREFDV-------------------------------------
UVRB_BACLD      RGDVVEIFPASDEHCVRVEFFGDEIERIR-----------------------------------------
UVRB_ARTCA      RGDTVEIIPMYEELAIRIEFFGDEIENIQ-----------------------------------------
UVRB_AQUAE      RGDVVEIVPSTEDYLVRVEFWDDEVERI------------------------------------------
UVRB_STAS1      RGDVVEIFPASEEMCIRVEFFGDEIDRIR-----------------------------------------
UVRB_STAHJ      RGDVVEIFPASEEMCIRVEFFGDEIDRIR-----------------------------------------
UVRB_BIFLI      RGDTVEIIPVYEELAIRIEFFGDEIDRI------------------------------------------
UVRB_STRSV      RGDVVEIFPASDEHAFRVEFFGDEIDRIREVEALTGRVLGE-----------------------------
UVRB_STRGC      RGDVVEIFPASDEHAFRVEFFGDEIDRIREVEALTGRVLGE-----------------------------
UVRB_MICLC      RGDTVEIIPMYEELAVRIEFFGDEIESIQ-----------------------------------------
UVRB_LACJO      RGDVVEIFPAYSDHAFRVEFFGDEIDRI------------------------------------------
UVRB_BACSU      RGDVVEIFPASDEHCVRVEFFGDEIERIR-----------------------------------------
UVRB_STRZT      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRZP      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRZJ      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRR6      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRPS      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRPN      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRPJ      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRPI      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRP7      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRP4      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_STRP2      RGDVVEIFPASDEHAFRVEFFGDEIDRIR-----------------------------------------
UVRB_PROMM      RGDVLEIGPAYEDRLVRIELFGDEVEAIRY----------------------------------------
UVRB_PROM0      KGDVLEIGPAYEDRLIRIELFGDEVEAIRY----------------------------------------
UVRB_LACSS      RGDVVEIFPASDDHALRVEFFGDEIDRI------------------------------------------
UVRB_ARTS2      RGDTVEIIPMYEELAIRIEFFGDEIENI------------------------------------------
UVRB_ARTAT      RGDTVEIIPMYEELAIRIEFFGDEIENIQ-----------------------------------------
PRIA_ECOLI      ----------------------------------------------------------------------
UVRB_CYAP7      RGDVLELVPAYEDRVIRVEFFGDEIDAIRYLDPVTGNSL-------------------------------
UVRB_BACCA      RGDVVEIFPASDEHCIRVEFFGDEIERIR-----------------------------------------
UVRB_VIBF1      RGEVLDIFPAESEHAIRIEMFDDEVERISKFDP