[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54591.1

[Show Plain Result]


## Summary of Sequence Search
    1::553
   10::544     e-110  44%  547 aa  ILVG_MYCTU RecName: Full=Probable acetolactate synthase;       
   10::544     e-110  44%  547 aa  ILVG_MYCBO RecName: Full=Probable acetolactate synthase;       
   53::551     4e-61  35%  632 aa  ILVBL_HUMAN RecName: Full=Acetolactate synthase-like protein;      
   57::598     2e-55  33%  640 aa  ILVBL_CAEEL RecName: Full=Acetolactate synthase-like protein;      
   53::590     4e-50  32%  632 aa  ILVBL_MOUSE RecName: Full=Acetolactate synthase-like protein;      
   15::544     2e-49  31%  564 aa  OXC_ECOLI RecName: Full=Probable oxalyl-CoA decarboxylase;       
   15::544     2e-49  31%  564 aa  OXC_ECO57 RecName: Full=Probable oxalyl-CoA decarboxylase;       
   51::551     1e-48  32%  632 aa  ILVBL_BOVIN RecName: Full=Acetolactate synthase-like protein;      
   42::613     2e-47  30%  621 aa  ILVBL_DANRE RecName: Full=Acetolactate synthase-like protein;      
   40::592     3e-47  32%  649 aa  ILVBL_XENLA RecName: Full=Acetolactate synthase-like protein;      
    3::550     6e-45  27%  591 aa  ILVB_METJA RecName: Full=Probable acetolactate synthase large
   23::568     3e-44  29%  617 aa  ILVB_SYNPX RecName: Full=Acetolactate synthase large subunit;      
   19::566     8e-43  27%  581 aa  HACL1_MOUSE RecName: Full=2-hydroxyacyl-CoA lyase 1;       
    2::555     3e-42  28%  599 aa  ILVB_METAO RecName: Full=Probable acetolactate synthase large
   23::564     3e-40  25%  575 aa  ILVB_GUITH RecName: Full=Acetolactate synthase large subunit;      
    6::557     4e-40  24%  573 aa  ILVI_HAEIN RecName: Full=Acetolactate synthase large subunit;      
   40::521     1e-39  28%  618 aa  ILVB_MYCTU RecName: Full=Acetolactate synthase;       
   40::521     1e-39  28%  618 aa  ILVB_MYCBO RecName: Full=Acetolactate synthase;       
    6::489     1e-39  23%  574 aa  ILVI_BUCSC RecName: Full=Acetolactate synthase large subunit;      
   17::548     2e-39  27%  568 aa  OXC_OXAFO RecName: Full=Oxalyl-CoA decarboxylase;       
   23::561     3e-39  27%  603 aa  XSC_ALCXX RecName: Full=Sulfoacetaldehyde acetyltransferase;       
   16::562     1e-38  25%  578 aa  HACL1_HUMAN RecName: Full=2-hydroxyacyl-CoA lyase 1;       
   99::649     2e-38  27%  670 aa  ILVB_ARATH RecName: Full=Acetolactate synthase, chloroplastic;     
   93::643     6e-38  27%  664 aa  ILVB2_TOBAC RecName: Full=Acetolactate synthase 2, chloroplastic;  
   96::646     7e-38  27%  667 aa  ILVB1_TOBAC RecName: Full=Acetolactate synthase 1, chloroplastic;  
   19::566     1e-37  25%  581 aa  HACL1_RAT RecName: Full=2-hydroxyacyl-CoA lyase 1;       
   81::631     3e-37  28%  652 aa  ILVB3_BRANA RecName: Full=Acetolactate synthase 3, chloroplastic;  
   84::634     4e-37  28%  655 aa  ILVB1_BRANA RecName: Full=Acetolactate synthase 1, chloroplastic;  
   47::554     5e-37  26%  625 aa  ILVB_MYCLE RecName: Full=Acetolactate synthase;       
   18::499     4e-36  25%  579 aa  ILVB_SPIPL RecName: Full=Acetolactate synthase;       
   24::565     1e-35  25%  590 aa  ILVB_PORYE RecName: Full=Acetolactate synthase large subunit;      
   28::581     1e-35  27%  626 aa  ILVB_CORGL RecName: Full=Acetolactate synthase large subunit;      
    6::560     2e-35  24%  574 aa  ILVI_SALTY RecName: Full=Acetolactate synthase isozyme 3 large
   24::565     3e-35  25%  590 aa  ILVB_PORUM RecName: Full=Acetolactate synthase large subunit;      
   24::565     3e-35  25%  590 aa  ILVB_PORPU RecName: Full=Acetolactate synthase large subunit;      
   15::548     3e-35  25%  562 aa  ILVB_ECOLI RecName: Full=Acetolactate synthase isozyme 1 large
   22::557     8e-35  29%  598 aa  XSC_ALCDF RecName: Full=Sulfoacetaldehyde acetyltransferase;       
    2::532     8e-35  26%  548 aa  ILVG_ECOLI RecName: Full=Acetolactate synthase isozyme 2 large
    6::555     1e-34  23%  576 aa  ILVI_BUCBP RecName: Full=Acetolactate synthase large subunit;      
   17::563     1e-34  24%  574 aa  ILVB_BACSU RecName: Full=Acetolactate synthase large subunit;      
    6::560     3e-34  24%  574 aa  ILVI_ECOLI RecName: Full=Acetolactate synthase isozyme 3 large
   44::597     3e-34  26%  621 aa  ILVB_MYCAV RecName: Full=Acetolactate synthase;       
   12::542     1e-33  26%  559 aa  ILVB_KLEPN RecName: Full=Acetolactate synthase, catabolic;       
   17::562     7e-33  23%  585 aa  ILVB_CYACA RecName: Full=Acetolactate synthase large subunit;      
   94::646     1e-32  25%  687 aa  ILVB_YEAST RecName: Full=Acetolactate synthase catalytic subunit,
   64::615     4e-32  25%  637 aa  ILVB2_BRANA RecName: Full=Acetolactate synthase 2, chloroplastic;  
   44::550     4e-31  26%  584 aa  XSC_DESTI RecName: Full=Sulfoacetaldehyde acetyltransferase;       
   83::651     4e-31  25%  669 aa  ILVB_SCHPO RecName: Full=Acetolactate synthase, mitochondrial;     
   67::617     1e-30  26%  638 aa  ILVB1_MAIZE RecName: Full=Acetolactate synthase 1, chloroplastic;  
   73::623     2e-30  25%  644 aa  ILVB1_ORYSJ RecName: Full=Acetolactate synthase 1, chloroplastic;  
   87::561     7e-30  27%  663 aa  ILVB2_ORYSJ RecName: Full=Probable acetolactate synthase 2,
   16::545     4e-29  23%  570 aa  ILVX_BACSU RecName: Full=Acetolactate synthase;       
    6::557     6e-29  23%  571 aa  ILVI_BUCAI RecName: Full=Acetolactate synthase large subunit;      
  128::696     2e-28  24%  718 aa  ILVB_CRYNE RecName: Full=Acetolactate synthase, mitochondrial;     
  128::696     2e-28  24%  718 aa  ILVB_CRYNV RecName: Full=Acetolactate synthase, mitochondrial;     
   41::549     5e-28  24%  568 aa  YGK4_SCHPO RecName: Full=Putative 2-hydroxyacyl-CoA lyase;       
   10::561     5e-28  26%  591 aa  XSC_RHIME RecName: Full=Probable sulfoacetaldehyde
   12::487     3e-27  24%  575 aa  ILVB_LACLA RecName: Full=Acetolactate synthase large subunit;      
   10::538     3e-27  24%  593 aa  GCL_ECOLI RecName: Full=Glyoxylate carboligase;       
   10::538     3e-27  24%  593 aa  GCL_ECO57 RecName: Full=Glyoxylate carboligase;       
   67::617     5e-27  25%  638 aa  ILVB2_MAIZE RecName: Full=Acetolactate synthase 2, chloroplastic;  
    7::538     4e-26  23%  574 aa  YDAP_BACSU RecName: Full=Putative thiamine pyrophosphate-containing
   14::481     2e-25  24%  603 aa  POXB_LACPL RecName: Full=Pyruvate oxidase;       
    6::486     2e-25  24%  571 aa  ILVI_BUCAP RecName: Full=Acetolactate synthase large subunit;      
    5::459     4e-24  26%  528 aa  MDLC_PSEPU RecName: Full=Benzoylformate decarboxylase;       
    4::475     4e-22  22%  591 aa  POXB_STRPN RecName: Full=Pyruvate oxidase;       
   12::542     6e-22  27%  559 aa  ILVB_KLETE RecName: Full=Acetolactate synthase, catabolic;       
    1::544     2e-21  21%  560 aa  YEC0_YEAST RecName: Full=Putative 2-hydroxyacyl-CoA lyase;       
   45::532     3e-21  24%  572 aa  POXB_ECOLI RecName: Full=Pyruvate dehydrogenase [cytochrome];      
    6::553     4e-21  26%  563 aa  BZNB_PSEFL RecName: Full=Benzaldehyde lyase;       
   12::538     9e-20  28%  580 aa  HACL1_DICDI RecName: Full=Probable 2-hydroxyacyl-CoA lyase 1;      
   10::523     7e-18  25%  528 aa  MDLC_PSEAE RecName: Full=Benzoylformate decarboxylase;       
   12::459     5e-16  24%  545 aa  DCIP_AZOBR RecName: Full=Indole-3-pyruvate decarboxylase;       
   31::522     2e-11  23%  644 aa  IOLD_BACHK RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   31::522     2e-11  23%  644 aa  IOLD_BACC0 RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   31::522     2e-11  23%  644 aa  IOLD_BACAN RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   31::522     2e-11  23%  644 aa  IOLD_BACAC RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   31::522     2e-11  23%  644 aa  IOLD_BACAA RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   34::522     6e-11  23%  644 aa  IOLD2_BACCZ RecName:
   14::128     8e-11  35%  265 aa  Y737_HAEIN RecName: Full=Putative uncharacterized protein HI0737;
   19::181     2e-10  31%  494 aa  Y663_METJA RecName: Full=Uncharacterized protein MJ0663;
   31::519     3e-10  23%  639 aa  IOLD_GEOTN RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
    6::224     2e-09  27%  537 aa  MEND_DESPS RecName:
   34::522     3e-08  23%  644 aa  IOLD_BACC3 RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   34::522     3e-08  23%  644 aa  IOLD_BACAH RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   34::522     8e-08  24%  644 aa  IOLD1_BACCZ RecName:
   40::236     1e-07  27%  582 aa  MEND_CHLTE RecName:
   15::124     3e-07  32%  589 aa  MEND_CORJK RecName:
   37::281     4e-07  26%  642 aa  IOLD_LACCA RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   24::236     1e-06  27%  583 aa  MEND_PELLD RecName:
   33::272     1e-06  25%  638 aa  IOLD_LISMF RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   40::236     2e-06  27%  583 aa  MEND_CHLP8 RecName:
   13::167     2e-06  24%  554 aa  MEND_FLAJ1 RecName:
   13::232     6e-06  26%  574 aa  MEND_RUBXD RecName:
   33::272     6e-06  24%  638 aa  IOLD_LISIN RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
   12::170     8e-06  25%  555 aa  MEND_BACTN RecName:
   53::162     1e-05  28%  543 aa  MEND_COREF RecName:
   54::227     1e-05  28%  580 aa  MEND_BACP2 RecName:
    9::181     2e-05  22%  559 aa  MEND_CYTH3 RecName:
   57::176     2e-05  28%  541 aa  MEND_LEUMM RecName:
   13::175     2e-05  24%  550 aa  MEND_FLAPJ RecName:
   55::235     2e-05  20%  583 aa  MEND_CHLL2 RecName:
   22::224     3e-05  23%  571 aa  MEND_LYSSC RecName:
   33::359     3e-05  28%  638 aa  IOLD_LISMO RecName: Full=3D-(3,5/4)-trihydroxycyclohexane-1,2-dione
  419::497     4e-05  35%  563 aa  PDC5_YEAST RecName: Full=Pyruvate decarboxylase isozyme 2;       
   19::181     5e-05  29%  556 aa  MEND_MYCLE RecName:
   19::181     5e-05  29%  556 aa  MEND_MYCLB RecName:
   54::227     6e-05  25%  580 aa  MEND_BACSU RecName:
  431::549     8e-05  34%  572 aa  PDC3_SCHPO RecName: Full=Probable pyruvate decarboxylase C186.09;  
   56::215     8e-05  24%  537 aa  MEND_DECAR RecName:
   43::214     8e-05  28%  587 aa  MEND_CHLAA RecName:
  427::479     1e-04  34%  569 aa  PDC2_SCHPO RecName: Full=Probable pyruvate decarboxylase C1F8.07c; 
  417::479     1e-04  32%  571 aa  PDC1_SCHPO RecName: Full=Putative pyruvate decarboxylase C13A11.06;
  420::497     1e-04  37%  564 aa  PDC1_CANGA RecName: Full=Pyruvate decarboxylase;       
   19::185     1e-04  30%  546 aa  MEND_MYCS2 RecName:
   19::181     1e-04  31%  540 aa  MEND_MYCA9 RecName:
  416::479     1e-04  31%  563 aa  KDC_MYCPA RecName: Full=Alpha-keto-acid decarboxylase;       
  416::479     1e-04  31%  563 aa  KDC_MYCA1 RecName: Full=Alpha-keto-acid decarboxylase;       
    3::131     1e-04  26%  579 aa  MEND_OCEIH RecName:
  418::481     1e-04  31%  560 aa  KDC_MYCTU RecName: Full=Alpha-keto-acid decarboxylase;       
  418::481     1e-04  31%  560 aa  KDC_MYCTA RecName: Full=Alpha-keto-acid decarboxylase;       
  418::481     1e-04  31%  560 aa  KDC_MYCBP RecName: Full=Alpha-keto-acid decarboxylase;       
  418::481     1e-04  31%  560 aa  KDC_MYCBO RecName: Full=Alpha-keto-acid decarboxylase;       
   19::184     2e-04  30%  548 aa  MEND_MYCVP RecName:
   19::181     2e-04  29%  548 aa  MEND_MYCMM RecName:
   56::232     2e-04  27%  584 aa  MEND_BACCR RecName:
   19::180     2e-04  30%  544 aa  MEND_MYCGI RecName:
   19::195     3e-04  30%  548 aa  MEND_MYCUA RecName:
   26::235     3e-04  23%  587 aa  MEND_CHLPD RecName:
   56::232     3e-04  26%  584 aa  MEND_BACC1 RecName:
   53::226     3e-04  26%  578 aa  MEND_BACA2 RecName:
   41::177     4e-04  27%  560 aa  MEND_STAS1 RecName:
   22::189     4e-04  29%  614 aa  MEND_SORC5 RecName:
   18::170     4e-04  25%  562 aa  MEND_PARD8 RecName:
   76::181     4e-04  32%  545 aa  MEND_MYCPA RecName:
   76::181     4e-04  32%  545 aa  MEND_MYCA1 RecName:
   56::232     4e-04  25%  584 aa  MEND_BACAN RecName:
   56::232     4e-04  25%  584 aa  MEND_BACAH RecName:
   28::205     4e-04  30%  599 aa  MEND_ARTS2 RecName:
   69::235     5e-04  24%  578 aa  MEND_PROA2 RecName:
   43::203     5e-04  32%  537 aa  MEND_NOCSJ RecName:
  418::505     5e-04  28%  566 aa  KDC_MYCUA RecName: Full=Alpha-keto-acid decarboxylase;       
  254::315     7e-04  27%  405 aa  PDC2_PEA RecName: Full=Pyruvate decarboxylase isozyme 2;       
   23::209     7e-04  23%  591 aa  MEND_SALRD RecName:
   56::230     7e-04  27%  584 aa  MEND_BACWK RecName:
   56::232     7e-04  25%  584 aa  MEND_BACCZ RecName:
  414::501     7e-04  27%  569 aa  KDC_MYCLE RecName: Full=Alpha-keto-acid decarboxylase;       
   56::193     0.001  27%  580 aa  MEND_LISMO RecName:
   56::193     0.001  27%  580 aa  MEND_LISMF RecName:
   53::165     0.001  29%  543 aa  MEND_CORGB RecName:
    1::553

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xGSPSFSGKLTGHGGNHAVEVARHHGVDTLFTLSGGHIFPIYDGAVKADPPMRLLDVRHEQTAVFAAEAV
ILVG_MYCTU      ----------TMHAGRLIARRLKASGIDTVFTLSGGHLFSIYDGC--REEGIRLIDTRHEQTAAFAAEGW
ILVG_MYCBO      ----------TMHAGRLIARRLKASGIDTVFTLSGGHLFSIYDGC--REEGIRLIDTRHEQTAAFAAEGW
ILVBL_HUMAN     ------------HGGENVAAVLRAHGVRFIFTLVGGHISPLLVACEKLG--IRVVDTRHEVTAVFAADAM
ILVBL_CAEEL     ------------HGGELVASVLKAHDVEEIFVLCGGHISPILVAAEKLG--IKIVDTRHEVTAVFAADAV
ILVBL_MOUSE     ------------HGGESVAAVLRAHGVRFVFTLVGGHISPLLVACEKLG--IRVVDTRHEVTAVFAADXX
OXC_ECOLI       ------------------VEALKQNNIDTIYGVVG---IPVTDMARHAQAEIRYIGFRHEQSAGYAAAAS
OXC_ECO57       ------------------VEALKQNNIDTIYGVVG---IPVTDMARHAQAEIRYIGFRHEQSAGYAAAAS
ILVBL_BOVIN     ----------TRHGGENVAAVLKAHGVRFLFTLVGGHISPLLVACEKLG--IRVVDTRHEVTAVFAADXX
ILVBL_DANRE     ------------HGGESVAEVLRSHGVKFVFTLVGGHISPILVACEKLG--IRIVDTRHEXXXXXXXXXX
ILVBL_XENLA     -------------GGELVADVLKAHDVRFLFTLCGGHISPILVAAERQN--IRVIDVRHEASAVFAADAV
ILVB_METJA      -------------GAEAIIKALEAEGVKIIFGYPGGAMLPFYDALYDSDLVHIL--TRHEQXXXXXXXXX
ILVB_SYNPX      -------------GAAALMDALRRHGVDTIFGYPGGAILPIYDALHIAESEVKHILVRHEQAGTHAADAY
HACL1_MOUSE     -------------GAKVIAQALKTQDVEYMFGVVG---IPVTEIALAAQEGIKYIGMRNEQAACYAASAV
ILVB_METAO      ------------NGAEAMIKALEAEKVEILFGYPGGALLPFYDALHHSD--LIHLLTRHEQXXXXXXXXX
ILVB_GUITH      ------------------------HGVKHIFGYPGGAILPIYDEAWEKEGFIEHILVRHEQGAAHASDGY
ILVI_HAEIN      -------------GAEMVVQSLRDEGVEYVFGYPGGAVLDIYD-AIHTLGGIEHILVRHEQAAVHMADGY
ILVB_MYCTU      -------------GAQAVIRSLEELGVDVIFGIPGGAVLPVYDPLFDSKKLRHVL-VRHEQGAGHAASGY
ILVB_MYCBO      -------------GAQAVIRSLEELGVDVIFGIPGGAVLPVYDPLFDSKKLRHVL-VRHEQGAGHAASGY
ILVI_BUCSC      -------------GSEMIIQSLIDQGIKYIFGYPGGAVLDIYD-SLKSTKKIKHILVRHEQGATHMADGY
OXC_OXAFO       ------------------IDALKMNDIDTMYGVVG---IPITNLAMWQDDGQRFYSFRHEQHAGYAASIA
XSC_ALCXX       ------------------VETCVANGVSEMFGIMGSAFMDAMD--IFAPAGIRLIPVVHEQGAAHMADGY
HACL1_HUMAN     -------------GAKVIAQALKTQDVEYIFGIVG---IPVTEIAIAAQQGIKYIGMRNEQAACYAASAI
ILVB_ARATH      -------------GADILVEALERQGVETVFAYPGGASMEIHQALTRSSSIRNVLP-RHEQGGVFAAEGY
ILVB2_TOBAC     -------------GSDVLVEALEREGVTDVFAYPGGASMEIHQALTRSSIIRNVLP-RHEQGGVFAAEGY
ILVB1_TOBAC     -------------GSDVLVEALEREGVTDVFAYPGGASMEIHQALTRSSIIRNVLP-RHEQGGVFAAEGY
HACL1_RAT       -------------GAKVIAQALKTQDVEYMFGVVG---IPVTEIALAAQEGIKYIGMRNEQAACYAASAV
ILVB3_BRANA     -------------GADILVEALERQGVETVFAYPGGASMEIHQALTRSSTIRNVLP-RHEQGGVFAAEGY
ILVB1_BRANA     -------------GADILVEALERQGVETVFAYPGGASMEIHQALTRSSTIRNVLP-RHEQGGVFAAEGY
ILVB_MYCLE      -------------GAQSVIRSLEELDVEVIFGIPGGAVLLVYDPLFYSKKLRHVL-VRHEQGAGHAASGY
ILVB_SPIPL      ------------------IDSLRRHGVQHIFGYPGGSNLPIYDEIYRAEQAGEIKHVRHEQGAAHAADGY
ILVB_PORYE      ------------------------HGVKHIFGYPGGAILPIYDEAWEEASLIKHILVRHEQGAAHAADSY
ILVB_CORGL      -------------GAKAIVRSLEELNADIVFGIPGGAVLPVYDPLYSSTKVRHVL-VRHEQGAGHAATGY
ILVI_SALTY      -------------GAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVL-VRHEQAAVHMADGL
ILVB_PORUM      ------------------------HGVIHIFGYPGGAILPIYDEAWEELSLIKNILVRHEQGASHAADAY
ILVB_PORPU      ------------------------HGVIHIFGYPGGAILPIYDEAWEELSLIKNILVRHEQGASHAADAY
ILVB_ECOLI      -------------GAEFIVHFLEQQGIKIVTGIPGGSILPVYD-ALSQSTQIRHILARHEQGAGFIAQGM
XSC_ALCDF       ------------------VETMVANGVTEIFGIMGSAFMDAMD--IFAPAGIKLIPVVHEQGAAHMADGF
ILVG_ECOLI      ------------NGAQWVVHALRAQGVNTVFGYPGGAIMPVYDALY--DGGVEHLLCRHEQXXXXXXXXX
ILVI_BUCBP      -------------GSDMVIRSLIDQGIKYIFGYPGGAVLDIYD-SLKQMHGIKHILVRHEQSATHMADGY
ILVB_BACSU      ----------TMSGALMLIESLKKEKVEMIFGYPGGAVLPIYDGLVHILP-------RHEQGAIHAAEGY
ILVI_ECOLI      -------------GAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVL-VRHEQAAVHMADGL
ILVB_MYCAV      -------------GAQSVIRSLEELGVEVIFGIPGGAVLPVYDPLFDSKKLRHVL-VRHEQXXXXXXXXX
ILVB_KLEPN      ------------HGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLL--DSSIRIIPVRHEANAAFMAAAV
ILVB_CYACA      ------------------IDMLVKHKVKNIFGYPGGAILPIYDELYHWEKKKLIKHVRHEQSXXXXXXXX
ILVB_YEAST      -------------GGQIFNEMMSRQNVDTVFGYPGGAILPVYDAIHNSDKFNFVLP-KHEQGAGHMAEGY
ILVB2_BRANA     --SSKYAPNVPRSGADILVEALERQGVDVVFAYPGGASMEIHQALTRSNTIRNVLP-RHEQGGIFAAEGY
XSC_DESTI       ---------------------------------------------------IEFIAVRHEQTAGHMQDAY
ILVB_SCHPO      ----SFVGKT---GGEIFHDMMLKHNVKHVFGYPGGAILPVFD-AIYRSPHFEFILPRHEQAAGHAAQAY
ILVB1_MAIZE     -------------GADILVESLERCGVRDVFAYPGGASMEIHQ-ALTRSPVIANHLFRHEQGEAFAASGY
ILVB1_ORYSJ     -------------GADILVEALERCGVSDVFAYPGGASMEIHQ-ALTRSPVITNHLFRHEQGEAFAASGY
ILVB2_ORYSJ     -------------GADIVVEALERCGVRDVFEYPGGASMEIHQ-ALTRSPVIRNHLLRHEQGEAFAASGY
ILVX_BACSU      -------------GAELVVDCLVEQGVTHVFGIPGAKIDAVFDALQDKGP--EIIVARHEQNAAFMAQAV
ILVI_BUCAI      -------------GAEMVVRSLIDQGIQHIFGYPGGAVLDIYD-ALKTVGGIEHILVRHEQAATHMADGY
ILVB_CRYNE      -------------GGQIFQEMMLRHDVKQVFGYPGGAILPVFD-AIYNSPHFDFVLPRHEQGAGHMAEGY
ILVB_CRYNV      -------------GGQIFQEMMLRHDVKQVFGYPGGAILPVFD-AIYNSPHFEFVLPRHEQGAGHMAEGY
YGK4_SCHPO      ---------------------------------------------------IRFVGFRNEQSXXXXXXXX
XSC_RHIME       ------------------VKVLQMHGIEHAFGIIGSAMMPVSDLFPKAG--IRFWDCAHETNAGMMADGF
ILVB_LACLA      -------------GSQLVLQTLKELGVEIIFGYPGGAMLPLYDAIHNFEGIQHIL-ARHEQGATHEAEGY
GCL_ECOLI       -----------------AMYVLEKEGITTAFGVPGAAINPFYS-AMRKHGGIRHILARHVEGASHMAEGY
GCL_ECO57       -----------------AMYVLEKEGITTAFGVPGAAINPFYS-AMRKHGGIRHILARHVEGASHMAEGY
ILVB2_MAIZE     -------------GSDILVEALERCGVRDVFAYPGGASMEIHQ-ALTRSPVIANHLFRHEQGEAFAASAY
YDAP_BACSU      --------------GQAMTELLEQWGVDHVYGIPGDSINEFIEELRHERNQLKFIQTRHXXXXXXXXXXX
POXB_LACPL      --------------GAAVIKVLEAWGVDHLYGIPGGSINSIMDALSAERDRIHYIQVRHEEVGXXXXXXX
ILVI_BUCAP      -------------GAEMVIRSLINQGIQHIFGYPGGAVLDIYD-ALKTVGGVEHILVRHEQAATHMADGY
MDLC_PSEPU      ------------HGTTY--ELLRRQGIDTVFGNPGSNELPF----LKDFPEFRYILALQEACVVGIADGY
POXB_STRPN      -------GKITASAA--MLNVLKTWGVDTIYGIPSGTLSSLMD-ALAEDKDIRFLQVRHEETGALAAVMQ
ILVB_KLETE      ------------HGADLIVSQLEAQGVRQVFGIPGAKIDKVFDSLL--DSSIRIIPVRHEANAAFMAAAV
YEC0_YEAST      ---------MTTTATQHFAQLLQKYGIDTVFGIVGIPIVQLADTMVANG--IKFIPCRNEQXXXXXXXXX
POXB_ECOLI      ------------------------------------------------------MSTRHXXXXXXXXXXX
BZNB_PSEFL      -------------GGELVVRTLIKAGVEHLFGLHGAHIDTIFQACLDHDVP--IIDTXXXXXXXXXXXXX
HACL1_DICDI     ----------------------KNSAIEKVFGIVGVPITPIYELQAQG---VGFFGFRNEQSCSYAASIV
MDLC_PSEAE      -------------------EILRRHGLTTVFGNPGSNELPF----LKDFPEFRYILGLHEGAVVGMADGF
DCIP_AZOBR      ----------------------KDRGAQAMFGIPGDFALPFFKVAEETQI-LPLHTLSHEPAVGFAADAA
IOLD_BACHK      --------------------------VKGIFTIFGGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAF
IOLD_BACC0      --------------------------VKGIFTIFGGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAF
IOLD_BACAN      --------------------------VKGIFTIFGGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAF
IOLD_BACAC      --------------------------VKGIFTIFGGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAF
IOLD_BACAA      --------------------------VKGIFTIFGGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAF
IOLD2_BACCZ     -----------------------------IFTIFGGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAF
Y737_HAEIN      ------------------------HHVTTLFGYPGGAIMPTYDALY--DAGLDHLLCRNEQGTAMAAIGY
Y663_METJA      --------------------------VKTIFSYPGEQILPLYNEIEGSS--IKNIMVRDERGAGFMADGY
IOLD_GEOTN      --------------------------VKGIFTIFGGNVLGLGQ-ALEEDPELEVYQGRNEQGMANAAIAF
MEND_DESPS      ----------------HISDLAHHHGMRHLVISPGSRNAPLIR-AFAASSQIECLSIVDERSAAFVALGL
IOLD_BACC3      -----------------------------IFTIFGGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAF
IOLD_BACAH      -----------------------------IFTIFGGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAF
IOLD1_BACCZ     -----------------------------IFTIFGGNVVGLGQALEEDAGELEVYQGRNEQGMANAAMAF
MEND_CHLTE      --------------------------------------------AVASNPKARFRMFPDERSAGFYALGY
MEND_CORJK      -------------------------GVREAVLCPGSRNSPLNLAFVEAERVGRVLHVRDERSAAFLALGL
IOLD_LACCA      --------------------------VEGLFAIFGGNVLGLGE-ALQEDPGLKVYQGHNEQGMASTAIAY
MEND_PELLD      ----------------------------SMFCISPGSRSTPLTAAVARNPRASWKMFPDERSAGFFALGH
IOLD_LISMF      --------------------------VDGIFTLFGGNVVGIGQALEEAPGHLKVYQGKNEQGMAHAAIAY
MEND_CHLP8      --------------------------------------------AVAANPNARFRMFPDERSAGFYALGY
MEND_FLAJ1      ------------------IEICSAKGIYNIIISPGSRNAPLTIGFAQ-NPNFKCYSIADERCAAFFALGI
MEND_RUBXD      --------------GRLLVEELLRCGVGLFCVAPGSRSTPLV-AAIAEHPRARALVHYDERGTAFAALGY
IOLD_LISIN      --------------------------VDGIFTLFGGNVVGIGQALEENPGHLKVYQGKNEQGMAHAAIAY
MEND_BACTN      ------------------VALLEAHGITKVVLCPGSRNAPIVH-TLSTHPGFTCYAMTDERSAGYFAIGL
MEND_COREF      -----------------------------------------------------------ERSAAFLALGL
MEND_BACP2      -----------------------------------------------------------ERSAAFYALGL
MEND_CYTH3      -------------------EILFQHGVTDVVLSPGSRCAPL-SIAFSRHKKLQIKVVPDERSAAFIALGM
MEND_LEUMM      -----------------------------------------------------------ERSAGFFALGI
MEND_FLAPJ      ------------------IEICNTKGLHHIVISPGSRNAPLTIGFTN-NPVFTCYSIADERCAAFFALGI
MEND_CHLL2      -----------------------------------------------------------ERSAGFFALGY
MEND_LYSSC      -------------------------GVENVVVSPGSRSTPLAY-AVASTKQIKMYRQVDERSAAFFALGL
IOLD_LISMO      --------------------------VDGIFTVFGGNVVGIGQ-ALEEDPGLNVYQGKNEQGMAHAAIAY
PDC5_YEAST      ----------------------------------------------------------------------
MEND_MYCLE      -------------------------GVRDVVLCPGSRNAPLAFALQDADHAGRILHVRDERTAGYLAIGL
MEND_MYCLB      -------------------------GVRDVVLCPGSRNAPLAFALQDADHAGRILHVRDERTAGYLAIGL
MEND_BACSU      -----------------------------------------------------------ERSAGFFALGL
PDC3_SCHPO      ----------------------------------------------------------------------
MEND_DECAR      -----------------------------------------------------------ERSAAFFGLGL
MEND_CHLAA      --------------------------------------------AVARHPSLRVWMHLDERSAGFFALGM
PDC2_SCHPO      ----------------------------------------------------------------------
PDC1_SCHPO      ----------------------------------------------------------------------
PDC1_CANGA      ----------------------------------------------------------------------
MEND_MYCS2      -------------------------GVRDVVLCPGSRNAPLAFALSDADRAGRILHVRDERTAGYLAIGL
MEND_MYCA9      -------------------------GVRDVVLCPGSRNAPLAFALHDADKAGRLLHVRDERTAGFLAVGL
KDC_MYCPA       ----------------------------------------------------------------------
KDC_MYCA1       ----------------------------------------------------------------------
MEND_OCEIH      -----YTEKLTRYVANFVDELAKS-GVTDVVVSPGSRSTPLAL-VFTEHPSIKEWIIVDERSAAFFALGL
KDC_MYCTU       ----------------------------------------------------------------------
KDC_MYCTA       ----------------------------------------------------------------------
KDC_MYCBP       ----------------------------------------------------------------------
KDC_MYCBO       ----------------------------------------------------------------------
MEND_MYCVP      -------------------------GVRDVVLCPGSRNAPLAFALHDADRAGRLLHVRDERTAGFLAIGL
MEND_MYCMM      -------------------------GVRDVVLCPGSRNAPLAFALQDADRSGRILHVRDERTAGFLAIGL
MEND_BACCR      -----------------------------------------------------------ERSAGFFALGI
MEND_MYCGI      -------------------------GVRDVVLCPGSRNAPLAFALHDADRAGRLLHVRDERTAGFLAIGL
MEND_MYCUA      -------------------------GVRDVVLCPGSRNAPLAFALQDADRSGRILHVRDERTAGFLAIGL
MEND_CHLPD      ------------------------------FCLSPGSRSTPLTVAVARNPMAKWKTFPDERSAGFFALGH
MEND_BACC1      -----------------------------------------------------------ERSAGFFALGI
MEND_BACA2      -----------------------------------------------------------ERSAGFFALGL
MEND_STAS1      --------------------------------------------AIEAHPKLKSWIHPDERSAAFFAMGL
MEND_SORC5      -------------------------GVRDLVLCPGSRSTPLAIAAMESEE-VRCHSVVDERAAAFFALGQ
MEND_PARD8      ------------------------HGVSNIVLCPGSRNSPIVH-TLANHSFFNCHSVTDERSAGFFAVGL
MEND_MYCPA      ----------------------------------------------------------------------
MEND_MYCA1      ----------------------------------------------------------------------
MEND_BACAN      -----------------------------------------------------------ERSAGFFALGI
MEND_BACAH      -----------------------------------------------------------ERSAGFFALGI
MEND_ARTS2      -GAPADSGSLTAQAARVAVKTLLDGGVRYVVVSPGSRSAPMAYALAEADAAGRVLLVRDERSAGFTALGL
MEND_PROA2      ----------------------------------------------------------------------
MEND_NOCSJ      --------------------------------------FAAYDAA--AAGLVRLHTRLDERTAGFLALGL
KDC_MYCUA       ----------------------------------------------------------------------
PDC2_PEA        ----------------------------------------------------------------------
MEND_SALRD      ------------------VEELVRNGVHTFFVAPGSRSTPLTVAIARHPEAESVLHVDEXXXXXXXXXXX
MEND_BACWK      -----------------------------------------------------------ERSAGFFALGI
MEND_BACCZ      -----------------------------------------------------------ERSAGFFALGI
KDC_MYCLE       ----------------------------------------------------------------------
MEND_LISMO      -----------------------------------------------------------ERSAGFFALGL
MEND_LISMF      -----------------------------------------------------------ERSAGFFALGL
MEND_CORGB      -----------------------------------------------------------ERSASFLALSL


                         .         .         *         .         .         .         .:140
query           GKLTRRAGWAALTAGPGVTNGVSGIATAHFNGSPLVVVGGRAPDNRWGQGLLQELDQSPLFTTITKRAWT
ILVG_MYCTU      SKVTRVPGVAALTAGPGITNGXXXXXXXXXXXXPLVVLGGRAPALRWGMGSLQEIDHXXXXXXXXXXXXX
ILVG_MYCBO      SKVTRVPGVAALTAGPGITNGXXXXXXXXXXXXPLVVLGGRAPALRWGMGSLQEIDHXXXXXXXXXXXXX
ILVBL_HUMAN     ARLSGTVGVAAVTAGPGLTNTVTAVKNAQMAQSPILLLGGAASTLLQNRGALQAVDQLSLFRPLCKFCVS
ILVBL_CAEEL     ARLRQSIGVAAVTAGPGLTNTITAVKNAQMAESPLLLIGGAAPTLLKGRGALQDIDQMVLFRPLCKYVAR
ILVBL_MOUSE     XXXXXXXXXXXXXXXXXXXNTVTAVKNAQVAQSPVLLLGGAASTLLQKRGALQAIDQMSLFRPLCKFCAS
OXC_ECOLI       GFLTQKPGICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRADLQQGDYEELDQMNAAKPYAKAAFR
OXC_ECO57       GFLTQKPGICLTVSAPGFLNGLTALANATVNGFPMIMISGSSDRADLQQGDYEELDQMNAAKPYAKAAFR
ILVBL_BOVIN     XXXXXXXXXXXXXXXXXXXNTVTAVKNAQIAQSPVLLLGGAASTLLQNRGALQAIDQIALFRPLCKFCAS
ILVBL_DANRE     XRLSGTVGVAAVTAGPGLTNTVTAVKNAQMAESPXXXXXXXXXXXXXXRGALQDIDQMSLFKPLCKFCAS
ILVBL_XENLA     SRLSGTVGVAAVTAGPGLTNTVTAVKNAQMAESPIVXXXXXXXXXXXXXXSLQDIDQLSLFRPLCKWSGR
ILVB_METJA      XXXSGEAGVCVSTSGPGATNLVTGIATAYADSSPVIALTGQVPTKLIGNDAFQEIDALGLFMPITKHNFQ
ILVB_SYNPX      ARATGKVGVCFGTSGPGATNLVTGIATAQMDSVPMVVITGQVPRPAIGTDAFQETDIFGITLPIVKHSWV
HACL1_MOUSE     GYLTGRPGVCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQEAMGAFQEFPQVEACRLYTKFSAR
ILVB_METAO      XXXSGKVGVCIGTSGPGATNLVTGVATAHSDSSPMVALTGQVPTKLIGNDAFQEIDALGLFMPIVKHNFQ
ILVB_GUITH      ARSTGNVGVCFATSGPGATNLVTGIATAHMDSVPMVIITGQVGRSFIGTDAFQEVDIFGITLPIVKHSYV
ILVI_HAEIN      ARSTGKVGCVLVTSGPGATNAITGILTAYTDSVPMVIISGQVMSNLIGSDAFQECDMLGISRPVVKHSFI
ILVB_MYCTU      AHVTGRVGVCMATSGPGATNLVTPLADAQMDSIPVVAITGQVGRGLIGTDAFQEADISGITMPITKHNFL
ILVB_MYCBO      AHVTGRVGVCMATSGPGATNLVTPLADAQMDSIPVVAITGQVGRGLIGTDAFQEADISGITMPITKHNFL
ILVI_BUCSC      ARATGKIGVVLVTSGPGATNSITGIATAYMDSIPIVVISGQVSSSLIGYDAFQECDMIGISRPIVKHSFL
OXC_OXAFO       GYIEGKPGVCLTVSAPGFLNGVTSLAHATTNCFPMILLSGSSEREDLQQGDYEEMDQMNVARPHCKASFR
XSC_ALCXX       ARVSGRHGVVIGQNGPGISNCVTGIAAAYWAHSPVVIVTPETGTMGMGLGGFQEANQLPMFQEFTKYQGH
HACL1_HUMAN     GYLTSRPGVCLVVSGPGLIHALGGMANANMNCWPLLVIGGSSERNQETMGAFQEFPQVEACRLYTKFSAR
ILVB_ARATH      ARSSGKPGICIATSGPGATNLVSGLADALLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYL
ILVB2_TOBAC     ARATGFPGVCIATSGPGATNLVSGLADALLDSVPIVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYL
ILVB1_TOBAC     ARATGFPGVCIATSGPGATNLVSGLADALLDSVPIVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYL
HACL1_RAT       GYLTGRPGVCLVVSGPGLIHALGGMANANMNCWPLIVIGGSSERNQEAMGAFQEFPQVEACRLYSKFSAR
ILVB3_BRANA     ARSSGKPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYL
ILVB1_BRANA     ARSSGKPGICIATSGPGATNLVSGLADAMLDSVPLVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYL
ILVB_MYCLE      AHVTGKVGVCMATSGPGATNLVTPLADAQMDSVPVVAITGQVGRSLIGTDAFQEADISGITMPITKHNFL
ILVB_SPIPL      ARSTGKVGVCLATSGPGATNLVTGLATAYLDSVPVLAITGQVPRSALGTDAFQEIDIFGITLPIVKHSYL
ILVB_PORYE      SRSTGEVGVCFATSGPGATNLVSGIATAHIDSVPILAITGQVGRAFIGTDAFQEVDIFGITLPIVKHSYV
ILVB_CORGL      AQVTGRVGVCIATSGPGATNLVTPIADANLDSVPMVAITGQVGSGLLGTDAFQEADIRGITMPVTKHNFM
ILVI_SALTY      ARATGDVGVVLVTSGPXXXXXXXXXXXXYMDSIPLVILSGQVATSLIGYDAFQECDMVGISRPVVKHSFL
ILVB_PORUM      SRSTGKVGVCFATSGPGATNLVSGIATAHIDSVPILAITGQVGRPFIGTDAFQEVDIFGITLPIVKHSYV
ILVB_PORPU      SRSTGKVGVCFATSGPGATNLVSGIATAHIDSVPILAITGQVGRPFIGTDAFQEVDIFGITLPIVKHSYV
ILVB_ECOLI      ARTDGKPAVCMACSGPGATNLVTAIADARLDSIPLICITGQVPASMIGTDAFQEVDTYGISIPITKHNYL
XSC_ALCDF       ARVSGRTGVVIGQNGPGISNCVTAIAAAYWAHTPVVIVTPEAGTTGIGLGGFQEARQLPMFQEFTKYQGH
ILVG_ECOLI      XXXXXKTGVCIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLACTKHSFL
ILVI_BUCBP      ARATGKIGVVLVTSGPGATNSITGIATAYMDSIPLVVISGQVASSLIGYDAFQECDMIGISRPIVKHSFL
ILVB_BACSU      ARVSGKPGVVIATSGPGATNLVTGLADAMIDSLPLVVFTGQVATSVIGSDAFQEADILGITMPVTKHSYQ
ILVI_ECOLI      ARATGEVGVVLVTSGPXXXXXXXXXXXXYMDSIPLVVLSGQVATSLIGYDAFQECDMVGISRPVVKHSFL
ILVB_MYCAV      XXXXXKVGVCMATSGPGATNLVTALADAQMDSIPVVAVTGQVGRTLIGTDAFQEADISGITMPITKHNFL
ILVB_KLEPN      GRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKQVHQSMDTVAMFSPVTKYAIE
ILVB_CYACA      XXXTNEVGVCLATSGPGATNLVTGIATAQMDSVPIIAITGQVSRAFIGTDAFQEVDIFGITLPIVKHSFV
ILVB_YEAST      ARASGKPGVVLVTSGPGATNVVTPMADAFADGIPMVVFTGQVPTSAIGTDAFQEADVVGISRSCTKWNVM
ILVB2_BRANA     ARSSGKPGICIATSGPGAMNLVSGLADALFDSVPLIAITGQVPRRMIGTMAFQETPVVEVTRTITKHNYL
XSC_DESTI       CRITGKASVCIGQNGPGVTNLVTCVAAANQAHTPMVVLGPSAGTPTVGWDGFQECDQVSIFRSITKQVLQ
ILVB_SCHPO      SRVTKKPGVVLVTSGPGATNVITPIADALADGTPLVVFSGQVATSAIGSDAFQEADMVGISRSCTKWNVM
ILVB1_MAIZE     ARSSGRVGVCIATSGPGATNXXXXXXXXXXXXXPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYL
ILVB1_ORYSJ     ARASGRVGVCVATSGPGATNXXXXXXXXXXXXXPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYL
ILVB2_ORYSJ     ARSSGRPGVCVATSGPGATNLVSALADAHLDSVPLVAITGQAPRRMIGTDAFQETPIVEFTRSITKHNYL
ILVX_BACSU      GRLTGKPGVVLVTSGPGASNLATGLLTANTEGDPVVALAGNVIRADRLKRTHQSLDNAALFQPITKYSVE
ILVI_BUCAI      SRSTGKTGVVLVTSGPXXXXXXXXXXXXYMDSIPMVVISGQVASSLIGYDAFQECDMIGISRPIVKHSFL
ILVB_CRYNE      ARVSGKPGVVLVTSGPGATNVITPMQDALSDGVPMVVFCGQVATNLIGSDAFQEADVVGISRSCTKWNVM
ILVB_CRYNV      ARVSGKPGVVLVTSGPGATNVITPMQDALSDGVPMVVFCGQVATNLIGSDAFQEADVVGISRSCTKWNVM
YGK4_SCHPO      XXLTQRXXXXXXXXXXXXXHAMAGVFNSKTNRWPLLLLAGSSETFQQNCGAFQELDQVSYLSPHTKLAVR
XSC_RHIME       SRATGTMSMAIGQNGPGVTGFITAMKTAYWNHTPLLMVTPQAANKTIGQGGFQEVDQMAMFEEMVCYQEE
ILVB_LACLA      AXXXXXXXXXXXTSGPGATNAVTGIADAYLDSVPLLVFTGQVGPLSIGKDAFQEADTVGITAPITKYNYQ
GCL_ECOLI       TRATANIGVCLGTSGPAGTDMITALYSASADSIPILCITGQAPRARLHKEDFQAVDIEAIAKPVSKMAVT
GCL_ECO57       TRATANIGVCLGTSGPAGTDMITALYSASADSIPILCITGQAPRARLHKEDFQAVDIEAIAKPVSKMAVT
ILVB2_MAIZE     ARSSGRVGVCIATSGPGATNXXXXXXXXXXXXXPMVAITGQVPRRMIGTDAFQETPIVEVTRSITKHNYL
YDAP_BACSU      XKLTGKIGVCLSIAGPGAVHLLNGLYDAKADGAPVLAIAGQVSSGEVGRDYFQEIKLEQMFEDVAVFNRE
POXB_LACPL      XKLTGKIGVCFGSAGPGGTHLMNGLYDAREDHVPVLALIGQFGTTGMNMDTFQEMNENPIYADVADYNVT
ILVI_BUCAP      ARSTGKIGVVLVTSGPXXXXXXXXXXXXYMDSIPMVVISGQVASSLIGYDAFQECDMIGISRPIVKHSFL
MDLC_PSEPU      AQASRKPAFINLHSAAGTGNAMGALSNAWNSHSPLIVTAGQQTRAMIGEALLTNVDAANLPRPLVKWSYE
POXB_STRPN      AKFXXXXXXXXXXXXXXXTHLINGVYDAAMDNTPFLAILGSRPVNELNMDAFQELNQNPMYNGIAVYNKR
ILVB_KLETE      GRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKLVHQSMDTVAMFSPVTKYAVE
YEC0_YEAST      GYISDKXXXXXXXXXXXXXHALAGIYNSMSNRWPLLVIAGSSSQSDIHKGGFQELDQVSLLSPFLKFTGK
POXB_ECOLI      XQLSGELAVCAGSCGPGNLHLINGLFDCHRNHVPVLAIAAHIPSSEIGSGYFQETHPQELFRECSHYCEL
BZNB_PSEFL      XXXXXKLGVAG--------HGGRGIQCGHAHCQRLAGSQGRCIPHP-GSGALRDIDQVAMAAPITKWAHR
HACL1_DICDI     GYLTGLPGLCMTVSGPGVVHALAGVLNAQSNGWPMILLSSSIDQSLVGKGGFQECKQFESAELYCKKCYY
MDLC_PSEAE      ALASGRPAFVNLHAAAGTGNGMGALTNAWYSHSPLVITAGQQVRSMIGEAMLANVDAGQLPKPLVKWSHE
DCIP_AZOBR      ARYSSTLGVAAVTYGAGAFNMVNAVAGAYAEKSPVVVISGAPGTTEGNAGLLRTLDQFQVFKEITVAQAR
IOLD_BACHK      AKQKHRKQIMACTSGPGSANMITSAATASANNIPVLLLPGDVFATRQPDPVLQQIEQNDAFRAVSKYWDR
IOLD_BACC0      AKQKHRKQIMACTSGPGSANMITSAATASANNIPVLLLPGDVFATRQPDPVLQQIEQNDAFRAVSKYWDR
IOLD_BACAN      AKQKHRKQIMACTSGPGSANMITSAATASANNIPVLLLPGDVFATRQPDPVLQQIEQNDAFRAVSKYWDR
IOLD_BACAC      AKQKHRKQIMACTSGPGSANMITSAATASANNIPVLLLPGDVFATRQPDPVLQQIEQNDAFRAVSKYWDR
IOLD_BACAA      AKQKHRKQIMACTSGPGSANMITSAATASANNIPVLLLPGDVFATRQPDPVLQQIEQNDAFRAVSKYWDR
IOLD2_BACCZ     AKQKHRKQIMACTSGPGSANMITSAATASANNIPVLLLPGDVFATRQPDPVLQQIEQNDAFRAVSKYWDR
Y737_HAEIN      ARSTGKVGVCIATSGPGATNLVIGLGDAMMDSIPVVTITGQVASPLIGTDAFQEADVLGLSLACTKHSFI
Y663_METJA      ARITNYIGVCLATAGPGATNLTTPIATAYKDNSSVLAITGRCQRKYIGKNYFQEVNMD--FLNFYKGYFV
IOLD_GEOTN      AKQKNRKQIMAATSGPGAANMVTSAATATANNIPVLLLPGDVFATRQPDPVLQQIEHNDAFRAVSKYWDR
MEND_DESPS      ATELQAPVGVLCTSGTALLNYGPAIAEAYYLRAPLIVLSADRPARLVGQQDSQTICQDNLFANIVKGSYS
IOLD_BACC3      AKQKHRKQIMACTSGPGSANMITSAATASANNIPVLLLPGDVFATRQSDPVLQQIEQNDAFRAVSKYWDR
IOLD_BACAH      AKQKHRKQIMACTSGPGSANMITSAATASANNIPVLLLPGDVFATRQSDPVLQQIEQNDAFRAVSKYWDR
IOLD1_BACCZ     AKQKHRKQIMACTSGPGSANMITSAATASANNIPVLLLPGDVFATRQPDPVLQQIEQNDAFRAVSKYWDR
MEND_CHLTE      ARATGMPAVLVCTSGTAVANYFPAVVEASADAQPMLVLSADRPFELLECGANQAIRQQNIFGSYTRWSFE
MEND_CORJK      AKVSRRPVPVVMTSGTAVANCLPAMVEATLSGVPLVVLSANRPLSMLGSGANQTIDQAEIFGT-------
IOLD_LACCA      SRQLYRHKIFAVTAGPGSANFVTAAGNAYVNSIPILFLPADTFATRQPDPVLQEVDYSADTTTVSKYWDR
MEND_PELLD      ARATGRPAVLVCTSGTAVANYFPAVVEASADFVPMIVISADRPFDLQECGANQTIRQDGIFGRYARWHMQ
IOLD_LISMF      AKQKNRQRIYACSAGPGSANLITAAGTALANNLPVLFLPADTFATRQPDPVLQQLEHESSFQAVSRYFDR
MEND_CHLP8      ARAAGKPAVLVCTSGTAVANYFPAVVEASADAQPMLVLSADRPFELLDAGANQTIRQQDIFGSYTRWNLE
MEND_FLAJ1      AQQTQKPAAVVCTSGSALLNYYPAVAEAFYSQIPLIVISADRPQSKIGQTIRQELNHSVFNANLTEDA-S
MEND_RUBXD      ARATGRPAAWVTTSGTAVANGLPAVAEAATDCVPMLLLTADRPPELRHTGANQTIEQPGIFGGYARWSFD
IOLD_LISIN      AKQKNRKRIYACSAGPGSANLITAAGTAFANNLPVLFLPADTFATRQPDPVLQQLEHESSFQAVSKYFDR
MEND_BACTN      ALNGGHPAAVCCTSGTALLNLHPAVAEAYYQNIPLVVISADRPAAWIGQMAGQTLPQPGVFQTLVKKSQT
MEND_COREF      ARVQRRPVPVIMTSGTAVSNCLPAVTEAAHAHIPLLVVSADRPAHLIGTGSSQTIDQTDIFGALAPTV-T
MEND_BACP2      AKASQTPVLLICTSGTAAANFYPAIVEAHYSRVPLIVLTADRPHELREVGAPQAIDQQFLFGKFVK--WA
MEND_CYTH3      SLQTQKPTVLICTSGSALYNYAPAIVEAYYQRVPLIVLSADRPPEWIDQNDGQTIRQQEIYGKHSKAFFQ
MEND_LEUMM      AKTLLEPVVLLGTSGTAIAEYMPAVAEAYAANIPLVVLSTDRPQELQFNGAPQTIPQSNLFGQLTKQAVL
MEND_FLAPJ      AQQLKKPVALVCTSGSALLNYYPAFAEAFYSQIPLVVISADRPQSKIDIGDGQTIRQENVFANHSYNANL
MEND_CHLL2      ARATQKPAVLICTSGTAVANYYPAVVEASMDCQPMLILSADRPFELLETGANQTIQQFGIFGGYSRWNFR
MEND_LYSSC      AKATAKPVVLLCTSGTAAANYFPAIVEASYARVPLIIITADRPHELREVGAPQTINQPHLYGSHVK--WS
IOLD_LISMO      AKQKNRKRIYACSAGPGSANLITAASTALANNLPVLFLPADTFATRQPDPVLQQLEHESSFQAVSRYFDR
PDC5_YEAST      ----------------------------------------------------------------------
MEND_MYCLE      AVAAGAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTMEQLGYFGTQVRAAIS
MEND_MYCLB      AVAAGAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTMEQLGYFGTQVRAAIS
MEND_BACSU      AKAKQRPVLLICTSGTAAANFYPAVVEAHYSRVPIIVLTADRPHELREVGAPQAINQHFLFGNFVKFFTD
PDC3_SCHPO      ----------------------------------------------------------------------
MEND_DECAR      AKSSHCPVLLLATSGTAPANWLPAVIEASQSGIPLILISADRPPELQDCGANQTVSQPGLFGSHTRASYT
MEND_CHLAA      ARARGMPAAVLCTSGTAVANLLPAVVEANLARVPLVILTADRPPELRDNGAPQTIDQIGIFGRNVR--WF
PDC2_SCHPO      ----------------------------------------------------------------------
PDC1_SCHPO      ----------------------------------------------------------------------
PDC1_CANGA      ----------------------------------------------------------------------
MEND_MYCS2      AVAERAPVCIAMTSGTAVANLGPAVVEANYARVPLIVLSANRPYEMLGTGANQTFEQLGYFGTQVRAAIS
MEND_MYCA9      AAASGSPVPVAMTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTMEQLGYFGTQVRAAIS
KDC_MYCPA       ----------------------------------------------------------------------
KDC_MYCA1       ----------------------------------------------------------------------
MEND_OCEIH      AKKSNRAVAIVCTSGTAAANYYPAIVEAHYSRVPLLVLTADRPHELRHIGAPQTIEQIKMYGDYTK----
KDC_MYCTU       ----------------------------------------------------------------------
KDC_MYCTA       ----------------------------------------------------------------------
KDC_MYCBP       ----------------------------------------------------------------------
KDC_MYCBO       ----------------------------------------------------------------------
MEND_MYCVP      AVAERAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTFEQLGYFGTQVRANIS
MEND_MYCMM      AVGAGAPACVAMTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTMEQLGYFGTQVRATIS
MEND_BACCR      AKAKKRPVALLCTSGTAAANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMNQFNLYGTFVKQF--
MEND_MYCGI      AVAERAPVCVAMTSGTAVANLGPAVVEANYARVPLIVLTANRPYELLGTGANQTFEQLGYFGTQVRESIS
MEND_MYCUA      AVGAGAPACVAMTSGTAVANLGPAVVETNYARVPLIVLSANRPYELLGTGANQTMEQLGYFGTQVRATIS
MEND_CHLPD      ARATGKPAILICTSGTAVANYFPSVVEASMDCQPMIILSADRPFELLETGANQTIRQSGMFGSYSRWNFR
MEND_BACC1      AKAKKRPVALLCTSGTAAANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMNQINLYGTFVKQF--
MEND_BACA2      AKARQRPVMLICTSGTAAANFYPAVIEAHYSRVPLIVLTADRPHELREVGAPQAINQHFLFGNFVK-FFT
MEND_STAS1      MKGSEKPVAILCTSGSAAANYTPAISESSLSHLPLVVLTSDRPHELRGIGAPQAINQTNMFANYVQYQFD
MEND_SORC5      ARVTGRPSVFVCTSGTAGAHALPAIIEAHQSFTPLIAITADRPWELXXXXXXQTIDQTKLFGD------H
MEND_PARD8      ALHGGKPAAVCCTSGTALLNIHPAVAEAFYQKVPLVVISADRPAAWIGQMDGQTLPQPGVFGSLVKKSHT
MEND_MYCPA      ----------AMTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTMEQLGYFGTQVRAAIS
MEND_MYCA1      ----------AMTSGTAVANLGPAVVEANYARVPLIVLSANRPYELLGTGANQTMEQLGYFGTQVRAAIS
MEND_BACAN      AKAKKRPVALLCTSGTAAANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMNQINLYGTFVKQ-FT
MEND_BACAH      AKAKKRPVALLCTSGTAAANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMNQINLYGTFVKQ-FT
MEND_ARTS2      ALSTGAPVAVLTTSGTAVGNLLPAVMEANHAAVPLVVLSADRPDELRGTGANQTTDQLDLFGEHVRFAVD
MEND_PROA2      ---TGRPAVLICTSGTAAANYFPAVVEASMGHQPMLVLSADRPFELRETGANQTIRQSGIYGSYSRWSFQ
MEND_NOCSJ      TRSGRRAA-VVCTSGTAVANLHPAVLEAAHAGVDLVVVSADRPARLRGTGANQTTDQVGIFGPL------
KDC_MYCUA       ----------------------------------------------------------------------
PDC2_PEA        ----------------------------------------------------------------------
MEND_SALRD      XXXXXXXXWVT-TSGTAVANGLPAAVEASVDGVPMLLLTADRPPELRDTGANQTIDQVKIFGDYVR--WQ
MEND_BACWK      AKAKKRPVALLCTSGTAAANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMNQFNLYGTFVKQF--
MEND_BACCZ      AKAKKRPVALLCTSGTAAANYYPAVCEAFHSRVPLIVLTADRPHELRDVGAPQAMNQFNLYGTFVKQ-FT
KDC_MYCLE       ----------------------------------------------------------------------
MEND_LISMO      AKASKRPVVLLCTSGTAAANYFPAVAEANLSQIPLIVLTADRPHELRNVGAPQAMDQLHLYGSFTDMALP
MEND_LISMF      AKASKRPVVLLCTSGTAAANYFPAVAEANLSQIPLIVLTADRPHELRNVGAPQAMDQLHLYGSFTDMALP
MEND_CORGB      ARTQARPVAVVMTSGTAVANCLPAVAEAAHAHIPLIVLSADRPAHLVGTGASQTINQTGIFGDL---APT


                         +         .         .         .         .         *         .:210
query           VHDTAQIGPALDEAFTLANTAHRGPVFLDIPMDRLYDQAEITVTGQAAAEDRSPDPDAVAAVARLLSEAE
ILVG_MYCTU      XQSAENAGLLVDQALQAAVSAPSGVAFVDFPMDHAFSMSSDNGRPGALTEGPTPXXXXXXXXXXXXSTAQ
ILVG_MYCBO      XQSAENAGLLVDQALQAAVSAPSGVAFVDFPMDHAFSMSSDNGRPGALTEGPTPXXXXXXXXXXXXSTAQ
ILVBL_HUMAN     VRRVRDIVPTLRAAMAAAQSGTPGPVFVELPVDVLYPQKEMVLVGRAGAWEPQPEPQQVQRCVEILSRAK
ILVBL_CAEEL     VERLRDIVPTVREAIKAAKSGCPGPVFVEFPVDVLYPY-ELVVKGNAWAPQTMPKSEKIQEIVQLVKSAK
ILVBL_MOUSE     VRRVRDIVPTLRTAIAAAQSGTPGPVFVELPLDVLYPEKEMIPTGPLPLDIPQASPQQVQRCVEILSRAK
OXC_ECOLI       VNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLKDEALTTIVKENPSPALLPCPKSVTSAISLLAKAE
OXC_ECO57       VNQPQDLGIALARAIRVSVSGRPGGVYLDLPANVLKDEALTTIVKENPSPALLPCPKSVTSAISLLAKAE
ILVBL_BOVIN     VRRVRDIIPTLRAAMAAAQSGTPGPVFVELPLDVLYPQKEMVPAKPAGAWEPQPEPQQVQRCVEILSRAK
ILVBL_DANRE     VRTVREIVPTVRKALAIAQSGTPGPVFIEFPIDTLYNHLSNLFAGAWESRDLSPLPDQVQRCVELVSRAK
ILVBL_XENLA     VNCVKDIVPMLCKAFYLARSGTPGPVLVEFPIDTLYPYSLVQVPTQIPVEIPSPSTKSIDQLVWLLSQAK
ILVB_METJA      IKKPEEIPETFRAAFEIATTGRPGPVHIDLPKDVQDGEIDIEKYPIPAKVDTVGHPLQIKKAAKLIAESE
ILVB_SYNPX      VRDPADLGSIVAQAFLIAASGRPGPVLIDIPKDVGQEQFNYSVIPGGFHQPEPPXXXXXXXXXXXIEQAQ
HACL1_MOUSE     PSTIELIPFIIEKAVRSSIYGRPGACYIDIPADFVTLQANVTSIKYKECCMPPPETSAVCAAASVLRDAK
ILVB_METAO      IQKTCQIPEIFRSAFEIAQTGRPGPVHIDLPKD--VQELELDI-------DKHPIPSKVKLIGXXXXXXX
ILVB_GUITH      VRETKEMGKIVAESFFIAKYGRPGPVLIDIPKDQIVNPNNINLAGCPVL--KNYDQNRISQAANLIKQSS
ILVI_HAEIN      VKKAEDIPSTLKKAFYIASTGRPGPVVVDIPKDTVNPNFKYPYEYPEYVELRSYNPTVIXXXXXXXXXXX
ILVB_MYCTU      VRSGDDIPRVLAEAFHIAASGRPGAVLVDIPKDVL--QGQCTFSWPPRMENTKPHSRQVREAAKLIAAAR
ILVB_MYCBO      VRSGDDIPRVLAEAFHIAASGRPGAVLVDIPKDVL--QGQCTFSWPPRMENTKPHSRQVREAAKLIAAAR
ILVI_BUCSC      VKKTEDIPITFKKAFWLASSGRPGPIVIDLPKDILNSYNKKPYIWPIEVNIRSYNPRQIKKAIDILKLSK
OXC_OXAFO       INSIKDIPIGIARAVRTAVSGRPGGVYVDLPA-KLFGQ---TISVEEAAPAQIPAEDAIARAADLIKNAK
XSC_ALCXX       VCNPKRMAEFTGRVFDRA-MSEMGPTQLNIPRDYFYGEIECEIPKPMRVDRGHGGEASLQAAVELLKTAK
HACL1_HUMAN     PSSIEAIPFVIEKAVRSSIYGRPGACYVDIPADFVNLQVNVNSIKYMERCMSPPETSAVCTAASVIRNAK
ILVB_ARATH      VMDVEDIPRIIEEAFFLATSGRPGPVLVDVPKDIQQQLAAMRLPGYMSRMPKPPEDSHLEQIVRLISESK
ILVB2_TOBAC     VMDVEDIPRVVREAFFLARSGRPGPVLIDVPKDIQWDQ-PMRLPGYMSRLPKLPNEMLLEQIVRLISESK
ILVB1_TOBAC     VMDVEDIPRVVREAFFLARSGRPGPILIDVPKDIQWDQ-PMRLPGYMSRLPKLPNEMLLEQIVRLISESK
HACL1_RAT       PSSIQHIPFVIEKAVRSSIYGRPGACYIDVPADLVTLQE--STTSIKYKECCMPPPLSLAETXXXXXXXK
ILVB3_BRANA     VMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQLAPMRLPGYMSRLPQPPEVSQLGQIVRLISESK
ILVB1_BRANA     VMDVDDIPRIVQEAFFLATSGRPGPVLVDVPKDIQQQLAPMRLPGYMSRLPQPPEVSQLGQIVRLISESK
ILVB_MYCLE      VRAGDDIPRVLAEAFHIASSGRPGAVLVDIPKDVLQGQCKFSMDLPGYKPNTKPHNRQIRAAAKLIADAR
ILVB_SPIPL      VREPSELPRIVVEAFHLAMSGRPGPVLIDIPKDVGNAQIDYSVRRVGYRPTERGNPRQINQALQLISEAT
ILVB_PORYE      VRDPRDMSRIVAEAFFICKHGRPGPVLIDVPKDNYFSVEPGKVNIPGCRPITSLKSRQILMAAKMIQQSS
ILVB_CORGL      VTNPNDIPQALAEAFHLAITGRPGPVLVDIPKD--VQNAELDFVWPPKIDVSTPHARQIEQAVKLIGEAK
ILVI_SALTY      VKQTEDIPLVLKKAFWLAASGRPGPVVVDLPKDILNPAKKMPYAWPETVSMRSYNPTTIKRALQTLASAK
ILVB_PORUM      VRDPRDMSRIVAEAFYICKHGRPGPVLIDVPKDVGLEKFNYVEPGQVKIPGCRPKSRQILMAAKMIQQSS
ILVB_PORPU      VRDPRDMSRIVAEAFYICKHGRPGPVLIDVPKDVGLEKFNYVEPGQVKIPGCRPKSRQILMAAKMIQQSS
ILVB_ECOLI      VRHIEELPQVMSDAFRIAQSGRPGPVWIDIPKDVQTAVFEIETQPXXXXXXXXXSEESIRDAAAMINAAK
XSC_ALCDF       VTHPARMAEYTARCFARARD-EMGPAQLNIPRDYFYGKIKCEIPLPQPLDRGPGGAQSLDAAARLLAEAK
ILVG_ECOLI      VQSLEELPRIMAEAFDVACSGRPGPVLVDIPKDIQLASGDLE-PWFTTVENEVTFPHAEVEQARMLAKAQ
ILVI_BUCBP      VKNTEDIPKIFKKAFWLASSGRPGPIVIDLPKDILNPLIKKPYIWPKLISIRSYSPGQXXXXXXXXXXXX
ILVB_BACSU      VRQPEDLPRIIKEAFHIATTGRPGPVLIDIPKDVATIEGEFSYDHEMNLPGYQPTTEQIRKLVEAVSSAK
ILVI_ECOLI      VKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILNPANKLPYVWPESVSMRSYNPTTIKRALQTLVAAK
ILVB_MYCAV      V--VRQRNPALAEAFHIAASGRPARCSVDIPKDVLQGQCTFSIHLPGYKPTTKPHSRQIRERAKLIAAAR
ILVB_KLEPN      VTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVSGKVLPASGAPQMGAAPDAIDQVAKLIAQAK
ILVB_CYACA      VRDPRDISTIVSEAFYISKHGRPGAVLIDVPKDHDYDSIRDHKPITKYRPIYGPSIRQIEKFKKMLLESK
ILVB_YEAST      VKSVEELPLRINEAFEIATSGRPGPVLVDLPKDRNPIPTKTTLPSNALNQLTSRAQDSINKAADLINLAK
ILVB2_BRANA     VMEVDDIPRIVREAFFLATSVRPGPVLIDVPKD-VQQQFAIPNWEQMSTMPKPPKVSHLEQILRLVSESK
XSC_DESTI       VPHPSRAGDVLRTAFRIA-YAERGPVYVDIPRNYFYGEVEILRPDQYRAMNGAGDATELARATEILAAAK
ILVB_SCHPO      VKDVADLPRRIDEAFEIATSGRPGPVLVDLPKDILSSVPSMNRRMKEVLEEGSKNVTAIDRVANLLKLAK
ILVB1_MAIZE     VLDVDDIPRVVQEAFFLASSGRPGPVLVDIPKDIQQQMAPMSLPGYIARLPKPPATELLEQVLRLVGESR
ILVB1_ORYSJ     VLDVEDIPRVIQEAFFLASSGRPGPVLVDIPKDIQQQMASMNLPGYIARLPKPPATELLEQVLRLVGESR
ILVB2_ORYSJ     ILDVDDIPRVINEAFFLASTGRPGPVLVDIPKDIQQQDAPMRLPGYISRLPKPPAANLLDEVIRLVGDAE
ILVX_BACSU      VQDVKNIPEAVTNAFRIASAGQAGAAFVSFPQDVVNEVTNTKNVRAVAAPKLGPXXXXXXXXXXXIQTAK
ILVI_BUCAI      VKKTEDIPIVFKKAFWLASSGRPGPIVIDLPKDILKKDNKYLYKWPDNINIRSYNPTTKGHIGQILLKAQ
ILVB_CRYNE      VKDIAELPRRINEAFKIATTGRPGPVLVDLPKDVTAAILRTPIPAKSAQPGHXXDADLITEAAQMINKAK
ILVB_CRYNV      VKDIAELPRRINEAFKIATTGRPGPVLVDLPKDVTAAILRTPIPAKSVQPGHXXDADLITEAAQMINKAK
YGK4_SCHPO      PPSPKMVVDSIRRAYRVSMTGTPGTCYVDLPANYIESTVXXXXXXXXXXXXXXXXXXXLQKAAYYLKNAK
XSC_RHIME       VRDPSRIPEVLNR---VIEKAWRGPAQINIPRDFWTQVIDVDLPRIVRFERXXXXXXXXXXXXRLLSEAK
ILVB_LACLA      IRETADIPRIVTEAYYLARTGRPGPVEIDLPKD--VSTLEVTEINDPSLESEKATDXXXXXXXXXXSVSK
GCL_ECOLI       VREAALVPRVLQQAFHLMRSGRPGPVLVDLPFDVQVAEIEFDPDMYEPLPVYKPAASQIEKAVEMLIQAE
GCL_ECO57       VREAALVPRVLQQAFHLMRSGRPGPVLVDLPFDVQVAEIEFDPDMYEPLPVYKPAASQIEKAVEMLIQAE
ILVB2_MAIZE     VLDVDDIPRVVQEAFFLASSGRPGPVLVDIPKDIQQQMAPMSLPGYIARLPKPPATEFLEQVLRLVGESR
YDAP_BACSU      VHSAESLPDLLNQAIRTAYSK-KGVAVLSVSDDLFAEKIEPVYTSPVYIEGNEPKKEQLVTCAQYINNAK
POXB_LACPL      AVNAATLPHVIDEAIRRA-YAHQGVAVVQIPVDLPWQQIPAEDWYASANSYQTPDVQAVTRLTQTLLAAE
ILVI_BUCAP      VKRTEDIPIIFKKAFWLASTGRPGPVVIDLPKDILKKTNKYNFIWPKNIHIRSYNPTTKGHQGQXXXXXX
MDLC_PSEPU      PASAAEVPHAMSRAIHMASMAPQGPVYLSVPYDD-WDQSHHLFDRHVSSSVRLNDQD-LDILVKALNSAS
POXB_STRPN      VAYAEQLPKVIDEACRAA-VSKKGPAVVEIPVNFGFQEIDENSYYGSGSYERSFIAPALNEVVEILNNAE
ILVB_KLETE      VTASDALAEVVSNAFRAAEQGRPGSAFVSLPQDIVDGPASGSTLPASRAPQMGAAPD-------------
YEC0_YEAST      LTPD-NIDMITQKALNYCIQGTAGVSYIDVPADFIEYEKPLEGNDRTGNELPGPDPSKIKKVVQLILQHK
POXB_ECOLI      VSSPEQIPQVLAIAMRKA-VLNRGVSVVVLPGDVALKPAPEGATMHAPQPVVTPEEEELRKLAQLLRYSS
BZNB_PSEFL      VMATEHIPRLVMQAIRAALSAPRGPVLLDLPWDILMNQID---------EDSVIIPDLVLSAXXXXXKAE
HACL1_DICDI     LTEIDHFPEILKDAIETSLSNRPGPVYIQIPADLIKSKCEAAGYGTIAIKSVVPDMKLIKDAVQLLSEAK
MDLC_PSEAE      PACAQDVPRALSQAIQTASLPPRAPVYLSIPYDDWAQPAPAGVEHLAARQXXXXXXXXXXXXXXRLSRSR
DCIP_AZOBR      LDDPAKAPAEIARVLGAARALSR-PVYLEIPRNMVNAEVEPVGDDPAWPVDRXXXXXXXXXXXXXMRSAT
IOLD_BACHK      INRPEQLMTAMIQAMVLTNPADTGAVTICLPQD---------VQGEARIERRLPTKASLADAVEMIKRKK
IOLD_BACC0      INRPEQLMTAMIQAMVLTNPADTGAVTICLPQD---------VQGEARIERRLPTKASLADAVEMIKRKK
IOLD_BACAN      INRPEQLMTAMIQAMVLTNPADTGAVTICLPQD---------VQGEARIERRLPTKASLADAVEMIKRKK
IOLD_BACAC      INRPEQLMTAMIQAMVLTNPADTGAVTICLPQD---------VQGEARIERRLPTKASLADAVEMIKRKK
IOLD_BACAA      INRPEQLMTAMIQAMVLTNPADTGAVTICLPQD---------VQGEARIERRLPTKASLADAVEMIKRKK
IOLD2_BACCZ     INRPEQLMTAMIQAMVLTNPADTGAVTICLPQD---------VQGEARIERRLPTRASLADAVEMIKRKK
Y737_HAEIN      V---------------------------------------------------------------------
Y663_METJA      --DKAEVS-YIAKAFADC-LFNKKPVQLNIPVDLYKEEAKITTYTDIYKDDETP----------------
IOLD_GEOTN      VCRPEQLMSAMLNAMVLTNPADTGAVTIALPQDEAWDFPESFFAKRVRIERRQPSLESVRDAVKLIRSKK
MEND_DESPS      LPEEPETVAELEQAFSTALSPCFGPVHINIPLDELMAESLIALSPLQLAEPKGMSPALWQEVESAWRGAK
IOLD_BACC3      INRPEQLMTAMIQAMVLTNPADTGAVTICLPQDEAWDFPDYFFQKRVRIERRLPTKASLADAVEMIKRKK
IOLD_BACAH      INRPEQLMTAMIQAMVLTNPADTGAVTICLPQDEAWDFPDYFFQKRVRIERRLPTKASLADAVEMIKRKK
IOLD1_BACCZ     INRPEQLMTAMIQAMVLTNPADTGAVTICLPQD---------VQGEARIERRLPTKASLADAVEMIKRKK
MEND_CHLTE      LPEPGIATPTVDHAVRKSLSLPAGPVHLNLPFDPGHPWAAPLETWQASGEPWSPSAESIVTLRELLAQAE
MEND_CORJK      ----------------------------------------------------------------------
IOLD_LACCA      IERPEQLMSALLKAFVLTNPATAGPVTIALPQDQAYDPLSFFXXXXXXXXXXQPSSAELAGAVELIQASQ
MEND_PELLD      LPQPSTEIPTVEHAVAKSLGAPRGPVHLNQPFREPFDPEPLE--GQSAQPERRPDARAMATIRELLATAR
IOLD_LISMF      VQRPEQLMSALIRAFVMTNPASAGPATICIAQDEAFDPVEFFQKRIHYLNRQIPTKRELTEAARLIKASK
MEND_CHLP8      LPEPGTGTPLASLLSTVGQAVKRGPVHLNLPFPESHDLAHPWVRNWLASEQTAPDANALTALQQILANAE
MEND_FLAJ1      VENDLKINKAIETAI-----LQKGPVHINAPFE-------------------------------------
MEND_RUBXD      VQDPATVLTTVDQAVYRSQRPPAGPVHLNLMFREPFLPQPAQPDGRYARAAPVPDEAEVRELASALGAAE
IOLD_LISIN      VQRPEQLMSALIRAFVMTNPVSAGPATICIAQDTEGEAFDYPVTFFQKLNRQIPTKRELTEAAKLIKASQ
MEND_BACTN      EEDEWYCNRLVNEALLETNHHGKGPVHINIPI--------------------------------------
MEND_COREF      VAAPEHVG-RISQA--LGNGASQSPRHINVALD-------------------------------------
MEND_BACP2      LPEESQVQTAAARANHMSMQEPKGPVQINVPLDRETDRKKVLATGQA-----YPNDDALSEIVTVMNRSK
MEND_CYTH3      LSAEHELPDTVNEAVSISEAYPKGPVHINIPFEPFYPKGEIMFSG-------------------------
MEND_LEUMM      IRVTEYIDFIVQKVVNLSITAPRGPIQINLPL--------------------------------------
MEND_FLAPJ      VENVSEENDAIQEAIHLA-TTKKGPVHINVPFEELYETVD------------------------------
MEND_CHLL2      LPEPSSDVPAIDHAVSSATGSLPGPVHINVPFREPFEPLDSTPLCRTLSQERVPNRESISSLRKIIAESK
MEND_LYSSC      VDFPLADGAAIARAVAIATSAPFGPVHLNVPFRELQDELPTMTFKHSSMGQLIPTTSAMQELSSILNSTR
IOLD_LISMO      VQRPEQLMSALIRAFVMTNPASAGPATICIAQDEAFDPVEFFQKRIHYLNRQIPTKRELTEAARLIQASK
PDC5_YEAST      ----------------------------------------------------------------------
MEND_MYCLE      LGLAEDAPERLDSAATGSRTANAGPVQFDIPL--------------------------------------
MEND_MYCLB      LGLAEDAPERLDSAATGSRTANAGPVQFDIPL--------------------------------------
MEND_BACSU      SALPEESPQMLRYIRTLASRAPMGPVHVNVPLDEPFGRMRTGRHVSVKTGTQSVDRESLSDVAEMLAEAE
PDC3_SCHPO      ----------------------------------------------------------------------
MEND_DECAR      LFNPGYLHRVARQACEQASWPHPGPVHINQPFREPMLPSEPVLSGEMPEKDLQPDLNALGDLARRIS---
MEND_CHLAA      VDDMALLRATLGRAVGLARSAPAGPVHLNLPFREVPDRARM-----AALFSETPSAVQVTPARRMIGGAE
PDC2_SCHPO      ----------------------------------------------------------------------
PDC1_SCHPO      ----------------------------------------------------------------------
PDC1_CANGA      ----------------------------------------------------------------------
MEND_MYCS2      LGLAPDLGPNAADLDTLARSANAGPVQFDIPL--------------------------------------
MEND_MYCA9      I-GLAEEGSEKIEAQNPSRTANAGPVQFDIPL--------------------------------------
KDC_MYCPA       ----------------------------------------------------------------------
KDC_MYCA1       ----------------------------------------------------------------------
MEND_OCEIH      ----------------------------------------------------------------------
KDC_MYCTU       ----------------------------------------------------------------------
KDC_MYCTA       ----------------------------------------------------------------------
KDC_MYCBP       ----------------------------------------------------------------------
KDC_MYCBO       ----------------------------------------------------------------------
MEND_MYCVP      LGLAPESGASVVVAATGARSANAGPVQFDIPL--------------------------------------
MEND_MYCMM      LGLAEDAHERLDSAAMGSRTANAGPVHFDIPL--------------------------------------
MEND_BACCR      ---TEMALPEASEAMIVANAAPQGPVHLNFPLESLWDKGRSEYTGVVQQGNAVMPSEYVDSLVGRLSHME
MEND_MYCGI      LGDHADMGSLNAQAAKGSRSANAGPVQFDIPL--------------------------------------
MEND_MYCUA      LGLAEDAHERLDSAAMGSRTANAGPVHFDIPL----------------REPLVPDPDPHGAV--------
MEND_CHLPD      LPEPSAEIPAIDHAVEKATGNPPGPVHLNVPFREPFDSAE--PLRRCSHAENVPHPAVIEKTAELIKASR
MEND_BACC1      ---TEMAIPEANEAIASALLAPQGPVHLNFPLESLWDKGRGEYTGVVQRGNAVMPSEYVDSLVGRLSHME
MEND_BACA2      DSALPEENPQMGRAVSEAGKRPMGPVHINVPLERMRKGRHVSVT----TGIQSADQDSLCHITERLAGTE
MEND_STAS1      F----PIAEKNDNEDIMANTPHRGPIHLNLP---------------------------------------
MEND_SORC5      VRHFAELG--LPDPSPLAL------------------RAVTRIAAQAVTRALSPTPGAVHINARFRKPLE
MEND_PARD8      DQDEWYCNRLINEALLELNHHGKGPVHINVPI--------------------------------------
MEND_MYCPA      LGLAEDAPERLDAAATGSRTANAGPVQFDIPL--------------------------------------
MEND_MYCA1      LGLAEDAPERLDAAATGSRTANAGPVQFDIPL--------------------------------------
MEND_BACAN      EMALPEASEAMQRMIASACLAPQGPVHLNFPLESLWDKGRGEYTGVVQQGNAVMPSEYVDSLVGRLSHME
MEND_BACAH      EMALPEASEAMQRMIASACLAPQGPVHLNFPLESLWDKGRGEYTGVVQQGNAVMPSEYVDSLVGRLSHME
MEND_ARTS2      VNPQRAVETALSAATGVFEDTPPGPVQLNL----------------------------------------
MEND_PROA2      LPEPSTDTPAIDYAVSTCTANPSGPVHLNIAFREPLEPVPLNENSRTLQRQSSPESASVKEVARLLASAE
MEND_NOCSJ      VPTQDASGPV--ELLT------AGPVHLNVPLEEPLVPDDRWLPDVVPGE---PAHRVIPASLTVLARGP
KDC_MYCUA       ----------------------------------------------------------------------
PDC2_PEA        ----------------------------------------------------------------------
MEND_SALRD      ADDPAYVLTTADQALHQTLRAPAGPVHVNCPLEPVETEASVAVPTAVDAWARGTEP--------------
MEND_BACWK      ---TEMALPEASEAMTIASAAPQGPVHLNFPLESLWDKGRGEYTGVVQQGNVTMPSEYVDSLVGRLSHME
MEND_BACCZ      EMALPEASEAMQRMIASACLAPQGPVHLNFPLESLWDKGRGEYTGVVQQGNVVMPSEYVDSLVGRLSHME
KDC_MYCLE       ----------------------------------------------------------------------
MEND_LISMO      ENSEEMLRYAKSRAVDIAMKTPRGPVHLNFPLREILEPSPFTATGK------------------------
MEND_LISMF      ENSEEMLRYAKSRAVDIAMKTPRGPVHLNFPLREILEPSPFTATGK------------------------
MEND_CORGB      VGIT-ELDQVAQIAESLAQRASQIPLALDVPL--------------------------------------


                         .         .         .         +         .         .         .:280
query           RPVLVYGSDVWLDHXXXXXXXXXXXXGVPVVTNGQGRGVLPAGHPXXXXXXXXXXXXXXDLVIVVGTPLD
ILVG_MYCTU      RPVIMAGTNVWWGHAEAALLRLVEERHIPVLMNGMARGVVPADHRLAFSRARSKALGEADVALIVGVPMD
ILVG_MYCBO      RPVIMAGTNVWWGHAEAALLRLVEERHIPVLMNGMARGVVPADHRLAFSRARSKALGEADVALIVGVPMD
ILVBL_HUMAN     RPLMVLGSQALLPTSADKLRAAVETLGVPCFLGGMARGLLGRNHPLHIRENRSAALKKADVIVLAGTVCD
ILVBL_CAEEL     RPVLLIGSQATLPPKPADLVKAVEALGCPVFLGGMARGLLGKDHPLQMRQVRRDALKDADLTILAGTVCD
ILVBL_MOUSE     RPLLVLGSQALLPPTPANKLRAAVETGVPCFLGGMSRGLLGRNHPLHIRQNRSXXXXXXXXXXXXXXXCD
OXC_ECOLI       RPLIILGKGAAYSQADEQLREFIESAQIPFLPMSMAKGILEDTHPLSXXXXXXXXXXXXDVVMLVGARLN
OXC_ECO57       RPLIILGKGAAYSQADEQLREFIESAQIPFLPMSMAKGILEDTHPLSXXXXXXXXXXXXDVVMLVGARLN
ILVBL_BOVIN     KPLMLIGSQALLPPTSSDKLRVAVETGIPCFLAGMARGLLGRNHPLHFRQNRRXXXXXXXXXXXXXXXCD
ILVBL_DANRE     KPVILLGSQATLPTPADDIRKALESLGIPCFLGGMSRGLLGKNSPLHIRQNRRXXXXXXXXXXXXGTVCD
ILVBL_XENLA     RPVIVVSSQALLPPPATQTAEHVKSLRIPVYLTGMARGLLGRHHPCVFRHARRAALRVADLIILAGSVCD
ILVB_METJA      RPVILAGGGVIISGASEELLRLAEFVKIPVCTTLMGKGCFPEDHPMHGTKAANYAVTECDVLIAIGCRFS
ILVB_SYNPX      RPLLYVGGGAISACAHDSLRMLAERYQLPVTTTLMGKGAFDENDAMHGTAYANFAVTECDLLIAVGARFD
HACL1_MOUSE     QPLLIIGKGAAYSHAEDSIRKLVEQCSLPFLPTPMGKGVVPDNHPNCVGAARSRALQSADVIVLFGARLN
ILVB_METAO      RPIILAGGGVLLSGANXXXXXXXXXXNIPVCTTLMGKGCISENHPMHGTKPANYCLSESDVLISIGCRFS
ILVB_GUITH      QPLLYIGGGAVTSNSHNEINELINLVKIPVATTLMGKGIIDESHPMHGTVYANYAVSECDLLIALGARFD
ILVI_HAEIN      XPILFVGGGAITAECSEQLIQFAQRLNLPVTSSLMGLGAYPSTDKMHGTLEANTAMHESDLILGIGVRFD
ILVB_MYCTU      KPVLYVGGGVIRGEATEQLRELAELTGIPVVTTLMARGAFPDSHGMHGTVAAVAALQRSDLLIALGTRFD
ILVB_MYCBO      KPVLYVGGGVIRGEATEQLRELAELTGIPVVTTLMARGAFPDSHGMHGTVAAVAALQRSDLLIALGTRFD
ILVI_BUCSC      QPVIYAGGGVISANCHNELKELAEKLNIPVTTSLMALGAFPGNHPMHGTYEANMAMHYADVILAIGVRFD
OXC_OXAFO       RPVIMLGKGAAYAQCDDEIRALVEETGIPFLPMGMAKGLLPDNHPQSAAATRAFALAQCDVCVLIGARLN
XSC_ALCXX       FPVILAGGGVVMGDAVEEAKQLAERLGAPVATGYLRNDAFPAKHPLWAGPLGYQGSKAADVVIALGSRM-
HACL1_HUMAN     QPLLIIGKGAAYAHAEESIKKLVEQYKLPFLPTPMGKGVVPDNHPYCVGAARSRALQFADVIVLFGARLN
ILVB_ARATH      KPVLYVGGGCL--NSSDELGRFVELTGIPVASTLMGLGSYPCDDEMHGTVYANYAVEHSDLLLAFGVRFD
ILVB2_TOBAC     KPVLYVGGG--CSQSSEELRRFVELTGIPVASTLMGLGAFPTGDEMHGTVYANYAVDSSDLLLAFGVRFD
ILVB1_TOBAC     KPVLYVGGG--CSQSSEDLRRFVELTGIPVASTLMGLGAFPTGDEMHGTVYANYAVDSSDLLLAFGVRFD
HACL1_RAT       QPLLIIGKGAAYSHAEDSIRKLVELCNLPFLPTPMGKGVVPDNHPNCVGAARSRALQFADVIVLFGARLN
ILVB3_BRANA     RPVLYV--XXXXXXXXXXXXRFVELTGIPVASTLMGLGSYPCNDEMHGTVYANYAVEHSDLLLAFGVRFD
ILVB1_BRANA     RPVLYV--XXXXXXXXXXXXRFVELTGIPVASTLMGLGSYPCNDEMHGTVYANYAVEHSDLLLAFGVRFD
ILVB_MYCLE      KPVLYVGGGVIRGEATEQLRDLAELTGIPVVSTLMARGAFPDSHGMHGTVAAVAALQRSDLLIALGTRFD
ILVB_SPIPL      KPLLYVGGGAIMAGAHAEIAELSERFQIPVTSTLMGKGRFDENHPMHGTAYANFAVMELDFVIAVGVRFD
ILVB_PORYE      QPLLYIGGGAIISDSHQIIKELVDFYKIPVTTTLMGKGIFNEDSDMHGTAYANFAVSECDLLIALGARFD
ILVB_CORGL      KPVLYVGGGVIKADAHEELRAFAEYTGIPVVTTLMALGTFPESHEMHGTVSAVGALQRSDLLIAIGSRFD
ILVI_SALTY      KPVVYVGGGAISAACYAPLRHIIETFNLPVVSSLMGLGAFPATHGMHGTYEANMTMHNADVIFAVGVRFD
ILVB_PORUM      QPLLYIGGGAIISDAHSIIKELVDLYKIPVTTTLMGKGIFNEDSEMHGTAYANFAVSECDLLIALGARFD
ILVB_PORPU      QPLLYIGGGAIISDAHSIIKELVDLYKIPVTTTLMGKGIFNEDSEMHGTAYANFAVSECDLLIALGARFD
ILVB_ECOLI      RPVLYLGGGV--INAPARVRELAEKAQLPTTMTLMALGMLPKAHPMHGVRSTNYILQEADLLIVLGARFD
XSC_ALCDF       FPVIISGGGVVMGDAVEECKALAERLGAPVVNSYLHNDSFPASHPYQGSXXXXXXXXXXXXXXXXGTRL-
ILVG_ECOLI      KPMLYVGGGVGMAQAVPALREFLAATKMPATCTLKGLGAVEADYPMHGTKAANFAVQECDLLIAVGARFD
ILVI_BUCBP      QPIIYIGGGIITSNSHKELKLLAETLNIPVTTSLMALGALPQNHPMHGTYEANMAIHNADVILAIGVRFD
ILVB_BACSU      KPVILAGAGVLHGKASEELKNYAEQQQIPVAHTLLGLGGFPADHPMHGTYTANMALHECDLLISIGARFD
ILVI_ECOLI      KPVVYVGGGAITAGCHQQLKETVEALNLPVVCSLMGLGAFPATHGMHGTYEANMTMHNADVIFAVGVRFD
ILVB_MYCAV      KPVLYVGGGVIRGEASEQLRELAELTGIPVVTTLMARGAFPDSHRQHLGMPGMHGTVAADLLIALGTRFD
ILVB_KLEPN      NPIFLLGLMASQPENSKALRRLLETSHIPVTSTYQAAGAVNQDNGLFNNQAGDRLLQLADLVICIGSPVE
ILVB_CYACA      QPILYVGGGAVMSRAQHEIEELASFIKIPVTTTLMGKGSFNEYNPMHGTAYANFAVSECDLLIALGARFD
ILVB_YEAST      KPVLYVGAGI-LNHGPRLLKELSDRAQIPVTTTLQGLGSFDQEDPMHGCATANLAVQNADLIIAVGARFD
ILVB2_BRANA     RPVLYVGGGCL--NSSEELRRFVELTGIPVASTFMGLGSYPCDDEMHGTVYANYAVEYSDLLLAFGVRFD
XSC_DESTI       NPVIISGRGVVDADAFAEVKEIAHMLTAPVAMSYLHNDTYPADDEYMGAKSAMYSLQDADVILAIGSRLS
ILVB_SCHPO      KPVIFCGHGVLANECPTLLRKFSERLQIPVTTSLLGLGAVDERSDMHGSGYANMAMQEADLILALGVRFD
ILVB1_MAIZE     RPVLYVGGGCAAS--GEELRRFVELTGIPVTTTLMGLGNFPSDDPMHGTVYANYAVDKADLLLALGVRFD
ILVB1_ORYSJ     RPILYVGGG--CSASGDELRWFVELTGIPVTTTLMGLGNFPSDDPMHGTVYANYAVDKADLLLAFGVRFD
ILVB2_ORYSJ     RPVLYVGGG--CSASGYELRRFVELTGIPVTTTLMGIGNFPSDDPMHGTVYANYAVDNADLLLALGVRFD
ILVX_BACSU      LPVVLVGMKGGRPEAIKAVRKLLKKVQLPFVETYQAAGTLSRDLELFRNQPGDLLLEQADVVLTIGDPIE
ILVI_BUCAI      RPVIYAXXXXXXXXXXEELRIFAEKINCPVTTSLMGLGSFPGTHDMHGTYEANMTMHHADVIFAIGVRFD
ILVB_CRYNE      RPIIFAGNGVLSSPEGPKLLKELSDKGIPVTTTLQGLGAFDERDEMHGSAYANFAMQEADVLIALGVRFD
ILVB_CRYNV      RPIIFAGNGVLSSPEGPKLLKELSDKGIPVTTTLQGLGAFDERDEMHGSAYANFAMQEADVLIALGVRFD
YGK4_SCHPO      APLLVVGKGAAYACAEKQLLEFVEHTGIPFLPSPMGKGLLPESHPLNVSSARSAALRNADVVLLAGARLN
XSC_RHIME       FPVILNGAGVVIGNAIQESMALAEKLDAPVCCGYQHNDAFPGSHGYNGSKAAMELISKADVVLALGTPFS
ILVB_LACLA      KPVIIAGGGINYSGSVDIFRAFVEKYQIPVVSTLLGLGTLPISHELQLGMAGMHGSYAANMALV---EAD
GCL_ECOLI       RPVIVAGGGVINADAAALLQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMV
GCL_ECO57       RPVIVAGGGVINADAAALLQQFAELTSVPVIPTLMGWGCIPDDHELMAGMVGLQTAHRYGNATLLASDMV
ILVB2_MAIZE     RPVLYVGGGCAAS--GEELCRFVELTGIPVTTTLMGLGNFPSDDPMHGTVYANYAVDKADLLLAFGVRFD
YDAP_BACSU      KPIILAGQG--MKKAKRELLEFADKAAAPIVVTLPAKGVVPDKHPHFLGNLGQIGTKPADLLIMLGTSFP
POXB_LACPL      RPLIYYG--IGARKAGKELEQLSKTLKIPLMSTYPAKGIVADRYPRVAQKPANEALAQADVVLFVGNNYP
ILVI_BUCAP      XXXXXXXXXXXXXXXXEELRIFAEKINCPVTTSLMGLGAFPGNHGMHGTYEANMAMHYSDVIFAIGVRFD
MDLC_PSEPU      NPAIVLGPDVXXXXXXXXCVMLAERLKAPVVAPSAPRCPFPTRHPCFRGLMPAGIAAISDVVLVIGAPV-
POXB_STRPN      RPVIYAGFGG--VKAGEVITELSRKIKAPIITTGKNEGLTGSAY-RVGWKPANEVVFEADTVLFLGSNFP
ILVB_KLETE      ----------------------------------------------------------------------
YEC0_YEAST      NKNILIVIGKGAVKNSHEIRRLVNTFNLPFLPTPMAKGIVPDSSPLNVSSARSQALKIADIVLVLGARLN
POXB_ECOLI      NIALMCGSGCAGAHKELVEFAGKIK--APIVHALRGKEHVEYDNPYDVGMTGLIGFSSGDTLVLLGTQFP
BZNB_PSEFL      RPVIVLGSEASRTARKTALSAFVAATGVPVFADYEGLSMLSGGGLVQNLYSFAKADAAPDLVLMLGARFG
HACL1_DICDI     RPLVIGGKGAAYCRSENELLEFIEATKIPFLPSPMGKGLLRDDHPLVVGAARSYALKNADVVLVLGARLN
MDLC_PSEAE      NPVLVLGPDVDGANANGLAVELAEKLRMPATRHACFRGVLPAA-----IAGISRLLDGHDLILVVGAPV-
DCIP_AZOBR      SPVLMVCVEVRRYGLEAKVAELAQRLGVPVVTTFMGRGLL-ADAPTPPLGTYIGVAGDAEITRLVEESDG
IOLD_BACHK      KPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPVTGNVAANTIAKEADLVIGIGTRFD
IOLD_BACC0      KPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPVTGNVAANTIAKEADLVIGIGTRFD
IOLD_BACAN      KPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPVTGNVAANTIAKEADLVIGIGTRFD
IOLD_BACAC      KPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPVTGNVAANTIAKEADLVIGIGTRFD
IOLD_BACAA      KPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHPVTGNVAANTIAKEADLVIGIGTRFD
IOLD2_BACCZ     KPVMICGGGVRYAEAAEELKQFAEAFRIPFGETQAGKSAIESSHPVTGNLAANTIAKEADLVIGIGTRFD
Y737_HAEIN      ----------------------------------------------------------------------
Y663_METJA      ----------------------------------------------------------------------
IOLD_GEOTN      KPLLVLGGGVRYSEAADAFVKFAEKFNIPFAETQAGKGTIESSHPVTGNLAANTIAKQADLIIGVGTRFD
MEND_DESPS      RRMIVCGQGV------------------------------------------------------------
IOLD_BACC3      KPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHP-------------------------
IOLD_BACAH      KPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHP-------------------------
IOLD1_BACCZ     KPVMICGGGVRYAEAAEELKQFAETFHIPFGETQAGKSAIESSHP-------------------------
MEND_CHLTE      RPLFVAGS--------------------------------------------------------------
MEND_CORJK      ----------------------------------------------------------------------
IOLD_LACCA      TPVLIVGGGAKFSDAGAAIETFSERFNIPIVETPTGKSAISSDFP-------------------------
MEND_PELLD      RPLLIAGS--------------------------------------------------------------
IOLD_LISMF      TPVIIVGGGARYSRAREELIALSEQTNIPLVETHAGKSTL------------------------------
MEND_CHLP8      RPLFVAGS--------------------------------------------------------------
MEND_FLAJ1      ----------------------------------------------------------------------
MEND_RUBXD      RGVVVAG---------------------------------------------------------------
IOLD_LISIN      TPVIIVGGGARYSDARKELIALSEQNDIPLVETHAGKSTV------------------------------
MEND_BACTN      ----------------------------------------------------------------------
MEND_COREF      ----------------------------------------------------------------------
MEND_BACP2      KGLIVCG---------------------------------------------------------------
MEND_CYTH3      ----------------------------------------------------------------------
MEND_LEUMM      ----------------------------------------------------------------------
MEND_FLAPJ      ----------------------------------------------------------------------
MEND_CHLL2      LPFMIAG---------------------------------------------------------------
MEND_LYSSC      KGFMIVG---------------------------------------------------------------
IOLD_LISMO      TPVIIVGGGARYSDAREELIALSEQSNIPLVETHAGKSTVXXXXXXXXXXXXXKAIRDADLVIGIGTRTD
PDC5_YEAST      ----------------------------------------------------------------------
MEND_MYCLE      ----------------------------------------------------------------------
MEND_MYCLB      ----------------------------------------------------------------------
MEND_BACSU      KGMIVCG---------------------------------------------------------------
PDC3_SCHPO      ----------------------------------------------------------------------
MEND_DECAR      ----------------------------------------------------------------------
MEND_CHLAA      LAML------------------------------------------------------------------
PDC2_SCHPO      ----------------------------------------------------------------------
PDC1_SCHPO      ----------------------------------------------------------------------
PDC1_CANGA      ----------------------------------------------------------------------
MEND_MYCS2      ----------------------------------------------------------------------
MEND_MYCA9      ----------------------------------------------------------------------
KDC_MYCPA       ----------------------------------------------------------------------
KDC_MYCA1       ----------------------------------------------------------------------
MEND_OCEIH      ----------------------------------------------------------------------
KDC_MYCTU       ----------------------------------------------------------------------
KDC_MYCTA       ----------------------------------------------------------------------
KDC_MYCBP       ----------------------------------------------------------------------
KDC_MYCBO       ----------------------------------------------------------------------
MEND_MYCVP      ----------------------------------------------------------------------
MEND_MYCMM      ----------------------------------------------------------------------
MEND_BACCR      KGLIICGDD-------------------------------------------------------------
MEND_MYCGI      ----------------------------------------------------------------------
MEND_MYCUA      ----------------------------------------------------------------------
MEND_CHLPD      QPLFIAG---------------------------------------------------------------
MEND_BACC1      KGLIICGDD-------------------------------------------------------------
MEND_BACA2      RGMIVCG---------------------------------------------------------------
MEND_STAS1      ----------------------------------------------------------------------
MEND_SORC5      -PVDATGPEPW-----------------------------------------------------------
MEND_PARD8      ----------------------------------------------------------------------
MEND_MYCPA      ----------------------------------------------------------------------
MEND_MYCA1      ----------------------------------------------------------------------
MEND_BACAN      KGLIICGDD-------------------------------------------------------------
MEND_BACAH      KGLIICGDD-------------------------------------------------------------
MEND_ARTS2      ----------------------------------------------------------------------
MEND_PROA2      NPLIIAG---------------------------------------------------------------
MEND_NOCSJ      RTVVVAGDD-------------------------------------------------------------
KDC_MYCUA       ----------------------------------------------------------------------
PDC2_PEA        ----------------------------------------------------------------------
MEND_SALRD      ----------------------------------------------------------------------
MEND_BACWK      KGLIICG---------------------------------------------------------------
MEND_BACCZ      KGLIICGDD-------------------------------------------------------------
KDC_MYCLE       ----------------------------------------------------------------------
MEND_LISMO      ----------------------------------------------------------------------
MEND_LISMF      ----------------------------------------------------------------------
MEND_CORGB      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           FRLNHGLFGGRDGAPLARTVHITDSPAQLATHLTLAGAVSGDLSAILRALAEQAKPKREVAQWRXXXXXX
ILVG_MYCTU      FRLG---FGGVFGSTTQLIVADRVEPAREHPRPVAAG-LYGDLTATLSALAGSGGTDHQ--GWIEELATA
ILVG_MYCBO      FRLG---FGGVFGSTTQLIVADRVEPAREHPRPVAAG-LYGDLTATLSALAGSGGTDHQ--GWIEELATA
ILVBL_HUMAN     FRLSY----GRVLSHSSKIIIVNRNREEMLLNSDIQEAVQGDVGSFVLKLVEGLQGQTWAPDW---VEEL
ILVBL_CAEEL     FRLSY----GRTLSKKSKIVALNRNSSQLTSDVSVQADVATSLVQVANALGHTTTPTEWVKSLREKDDEK
ILVBL_MOUSE     FRLSYGRVLNRKSSIIIVNRNRDDLLLNSDIFWKPQEAVQGDVGSFMIKLVEGLQGQMWSSDWAEELRKA
OXC_ECOLI       WLLAHGKKG---WAADTQFIQLDIEPQEIDSNRPIAVPVVGDIASSMQGMLAELKQNTFTTPWRDILNIH
OXC_ECO57       WLLAHGKKG---WAADTQFIQLDIEPQEIDSNRPIAVPVVGDIASSMQGMLAELKQNTFTTPWRDILNIH
ILVBL_BOVIN     FRLSYGRVLSRSSKIIVVNRDRKEMLINSDIFWKPQEAVQGDVGSFVVKLVEGLRGQMWASDWAEELRQA
ILVBL_DANRE     FRLSYGRVLNR----RSKIIAVNRDKSQLLKNSDMTVAIQGDAGSFLLNLSKALKGHRCPEEWPQSLKEG
ILVBL_XENLA     FRMDYGRVLNRK----AKIVIINRDKKQLYLNSDIFWAIRGDVGTALKELSISLNDRRCPTEW---VGEL
ILVB_METJA      DRVTGDI---RYFAPEAKIIHIDIDPAEIGKNVRADIPIVGDAKNVLRDLALIALEIKDKETWLERIYEL
ILVB_SYNPX      DRVTGKL---DTFAPRARVVHFEIDPAEIGKNRKADVAVLGDLGLSLARMVEQRTAEPRTAAW------L
HACL1_MOUSE     WILHFGL-PPRYQADV-KFIQIDICAEELGNNVRPSVILLGDIDAVSKQLLEQFDKTPPDSQWWKTLREK
ILVB_METAO      DRITGDI---KSFATNAKIIHIDIDPAEIGKNVNVDVPIVGDAKLILKEVIKQXXXXXXXSQW----IEN
ILVB_GUITH      DRVTGKL---DEFACHAQVIHVDIDPAEIGKNRTPQIGIVGEIKDFVRDLIECLKNDINFDSEQSQAWRS
ILVI_HAEIN      DRTTNNL---EKYCPNAKVIHIDIDPTSISKNVPVAIPIVGNAKNVXKSQTDLESWWQEINQWK------
ILVB_MYCTU      DRVTGKL---DSFAPEAKVIHADIDPAEIGKNRHADVPIVGDVKAVITELIAMLRHHHEMADWWAYLNGV
ILVB_MYCBO      DRVTGKL---DSFAPEAKVIHADIDPAEIGKNRHADVPIVGDVKAVITELIAMLRHHHEMADWWAYLNGV
ILVI_BUCSC      DRTTNNV---KKYCPNATIIHIDIDPTSISKTITAHIPIVGNAKNVLQQILVFINSNMFVKEFYCLKKWW
OXC_OXAFO       WLMQHGK-GKTWGDELKKYVQIDIQANEMDSNQPIAAPVVGDIKSAVSLLRKALKPKAD-AEWTGALKAK
XSC_ALCXX       -----GPFGGMDYWPAAKIIQIEADHTNLGLVKKIAVGINGDAKAVAAELSEKAAWEKELDGWTHERDPY
HACL1_HUMAN     WILHFGL--PPRYQPDVKFIQVDICAEELGNNVKPAVTLLGNIHAVTKQLLEELDKTPPESKWWKTLREK
ILVB_ARATH      DRVTGKL---EAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKWRNELNVQ
ILVB2_TOBAC     DRVTGKL---EAFASRAKIVHIDIDSAEIGKNKQPHVSICADIKLALQGLSKEGKLKLDFSAWRQELTVQ
ILVB1_TOBAC     DRVTGKL---EAFASRAKIVHIDIDSAEIGKNKQPHVSICADIKLALQGLSKEGKLKLDFSAWRQELTEQ
HACL1_RAT       WILHFGL-PPRYQADV-KFIQIDICAEELGNNVRPSVTLLGDVNAVSKQLLEQFVKNPTDSKWWETLREK
ILVB3_BRANA     DRVTGKL---EAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKWRSELSEQ
ILVB1_BRANA     DRVTGKL---EAFASRAKIVHIDIDSAEIGKNKTPHVSVCGDVKLALQGMNKVLENRAEELKWRSELSEQ
ILVB_MYCLE      DRVTGKL---DSFAPDAKVIHADIDPAEIGKNRHADVPIVGDVKAVIVELIAMLRHYEEMTDWWSYLDGV
ILVB_SPIPL      DRV---AGTGDQFAHSAKVIHIDIDPAEVGKNRSTDVPIVGDVRQVLGDMLQRTYHERKLSRNKPRNGTD
ILVB_PORYE      DRVTGKL---DEFACNAQVIHVDIDPAEVGKNVAIVGDVAEVVSEILNLLKTSFPPPEQIISWQERINRW
ILVB_CORGL      DRVT----GDVDTAPDAKIIHADIDPAEIGKIKQVEVPIVGDAREVLARLLETTKASKDISEW------V
ILVI_SALTY      DRTTNNL---AKYCPNATVLHIDIDPTSISKTVNADIPVVGDLEQMLELLAQDAQPQDDIRDWWQQIESW
ILVB_PORUM      DRVTGKL---DEFACNAQVIHVDIDPAEVGKNVAIVGDVTEVVTSLLNLLKNNFKPPEQIISWQERIHRW
ILVB_PORPU      DRVTGKL---DEFACNAQVIHVDIDPAEVGKNVAIVGDVTEVVTSLLNLLKNNFKPPEQIISWQERIHRW
ILVB_ECOLI      DR---AIGKTEQFCPNAKIIHVDIDRAELGKIKQPHVAIQADVDDVLAQLIPEAQPR---AEWHQLVADL
XSC_ALCDF       -----GPFGGLDYWPKARIIQVDADSKMLGLVKKITVGVCGDAKAAARIQAEKDAWEQELTDWTHERDPF
ILVG_ECOLI      DRVTGKL---NTFAPHASVIHMDIDPAEMNKLRQAHVALQGDXXXXXXXXQQHCAQLRDEHSWR------
ILVI_BUCBP      DRTTNNV---DKYCPNATIIHIDIDPTSISAHIPIVGHARNVLKQILNLLKNQFSKKNNLEHW----WKQ
ILVB_BACSU      DRVTGNL---KHFARNAKIAHIDIDPAEIGKIMKTQIPVVGDSKIVLQELIKQDGKQSDSSEWKKQLAEW
ILVI_ECOLI      DRTTNNL---AKYCPNATVLHIDIDPTSISKTVTADIPIVGDARQVXXXXXXXXQPLDEIRDWWQQIEQW
ILVB_MYCAV      DRVTGKL---DTFAPEAKVIHADIDPAEIGKNRHADVPIVGDVKAVIAELVEGAPGNLDIADWWAYLDDV
ILVB_KLEPN      YEPAMWNSGN------ATLVHIDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSQAAEILRDR
ILVB_CYACA      DRVTGKL---DEFACNAQVIHVDIDPAEIGKNRIPQLAIISDIKIVLKELLSSMKDKNQTQAWLHRIHKW
ILVB_YEAST      DRVTGNIXXXXXXXXXXXIIHFEVSPKNINKVVQTQIAVEGDATTNLGKMMSKIFPVKERSEWFAQINKW
ILVB2_BRANA     DRVTGKL---EAFASRAKIVHIDIDSTEIGKNKTPHVSVCCDVQLALQGMNEVLENRRDVGEWRCELNEQ
XSC_DESTI       VFGTLPQYDINYFPENAKIIQIEVNPKQIGRRHPVTVPIIGDAKLATAELIKLLKAKGDVAERLAKIQER
ILVB_SCHPO      DRVNVSLF-----APQARIIHFDISPKNIGKVVQPTEAIEGDVYESLKLLDSATKNIKIPSRFDWLSQIQ
ILVB1_MAIZE     DRVTGKI---EAFASRAKIVHVDIDPAEIGKNKQPHVSICADVKLALQALLEGSTSKKDFGSWNDELDQQ
ILVB1_ORYSJ     DRVTGKI---EAFASRAKIVHIDIDPAEIGKNKQPHVSICADVKXXXXXXXSTTKTSSDFSAWHNELDQQ
ILVB2_ORYSJ     DRVTGKV---EAFASRAKIVHVDIDPSELGPHVSICADVKLALQGMNAMLEEQARKNLDFSAWRSELEKK
ILVX_BACSU      YDPKFWNING-DRTIIHLDEIIADIDHAYQPDLELIGDIPSTINHI-----EHDAVKVEFAEREQKILSD
ILVI_BUCAI      DRTTNNL---NKYCPNAIVLHVDIDPTSISKTVSANIPIVGDAKHVXXXXXXXXXXXXXXXXXXDXXXXX
ILVB_CRYNE      DRVTXXXXEGRGG-----IIHFEIQPKNINKIVEAQIPVLGDVVASLAELVPQIEAVDRSA-W------I
ILVB_CRYNV      DRVTXXXXEGRGG-----IIHFEIQPKNINKIVEAQIPVLGDVVASLGELVPQIEAVDRSA-W------I
YGK4_SCHPO      WIFQYGL--PPKWSPNAKFIQIDTNAETLGNNAALDLAIWADVGLTIDCLFKLVQTKYSVGISTPYLRTL
XSC_RHIME       TLPGYGIYWPKDAAII--QVDINADRIGLTKKVTV--GICGDXXXXXXXXASREERKALVHQTRSAWLQQ
ILVB_LACLA      YIINLGRFDDRXXXXXXXXXHIDIDAAELGKIVKTDIPILSDLKAALSRLLQLNKVRTDFNDW-IKTVTK
GCL_ECOLI       FGIGNRFANRHTGSVEKYTVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAGRLPCRKEWV
GCL_ECO57       FGIGNRFANRHTGSVEKYTVHIDIEPTQIGRVLCPDLGIVSDAKAALTLLVEVAQEMQKAGRLPCRKEWV
ILVB2_MAIZE     DRVTGKIFAGR-----AKIVHIDIDPAEIGKNKQPHVSICADVKLALQGMGSTSKKSFDFGSWHDELDQQ
YDAP_BACSU      YRDYLP-----DDTP---AIQLDSDPAKIGKRYPVTAGLVCDSALGLRELTEYIERKEDRRFLNACTEHM
POXB_LACPL      FAEVSKAFKN-----TRYFLQIDIDPAKLGKRHKTDIAVLADAQKTLAAILAQVS-ERESTPWWQANLAN
ILVI_BUCAP      DRTTNNL---KKYCPNATILHVDIDPTSISKTVSADIPIVGDAKQVXXXXXXXXXXXXQIHSLXXXXXXX
MDLC_PSEPU      FRY-HQYDPGQYLKPGTRLISVTCDPLE-AARAPMGDAIVADIGAMASALANLVEESSR-----------
POXB_STRPN      FAEVYEAFKNTE-----KFIQVDIDPYKLGKRHALDASILGDAGQAAKAILDKVNPVESTPWWRANVKNN
ILVB_KLETE      ----------------------------------------------------------------------
YEC0_YEAST      WILHFGTSPKWNSESIF--IQFDSNPETLGDNNVSPGAIWGDIGLSVTALVEELTRQDSCWKYSGVKQEI
POXB_ECOLI      YRA----FYPTD----AKIIQIDINPASIGAHSKVDMALVGDIKSTLRALLPLVEEKAD-----RKFLDK
BZNB_PSEFL      LNTGHG--SGQLIPHSAQVIQVDPDACELGRLQGIALGIVADVGGTIEXXXXXXXXXXXWPDRGDWCAKV
HACL1_DICDI     WMFNFG----------------------------------------------------------------
MDLC_PSEAE      FRYHQ--FAPGDYLPAAELVQVTCDPGE-AARAPMGDALVGDIALTLEALLEQV-----------XXXXX
DCIP_AZOBR      LFLLGAILSDTNFADLRKTIHAFDRAVTLGYHTYADIPLAGLVDALLEGLPPSDRTTRGKEPHAYPTG--
IOLD_BACHK      FTASKQLFQNEEVEFL--NINISEFHANKLDALKVIADAKEALLALIDELQEDAKDAWETELSRLHNIRF
IOLD_BACC0      FTASKQLFQNEEVEFL--NINISEFHANKLDALKVIADAKEALLALIDELQEDAKDAWETELSRLHNIRF
IOLD_BACAN      FTASKQLFQNEEVEFL--NINISEFHANKLDALKVIADAKEALLALIDELQEDAKDAWETELSRLHNIRF
IOLD_BACAC      FTASKQLFQNEEVEFL--NINISEFHANKLDALKVIADAKEALLALIDELQEDAKDAWETELSRLHNIRF
IOLD_BACAA      FTASKQLFQNEEVEFL--NINISEFHANKLDALKVIADAKEALLALIDELQEDAKDAWETELSRLHNIRF
IOLD2_BACCZ     FTASKQLFQNEEANKLDALKVIADAKEALLALINELQAIEYRSSYTVEIAAAKEFWETELARLHNIRFTG
Y737_HAEIN      ----------------------------------------------------------------------
Y663_METJA      ----------------------------------------------------------------------
IOLD_GEOTN      FTASKQLFSSAE----ILTINVSEFHASKLXXXXXXXXXXXGLEAIAEALAKQAWNRESVAYGENFTPEI
MEND_DESPS      ----------------------------------------------------------------------
IOLD_BACC3      ----------------------------------------------------------------------
IOLD_BACAH      ----------------------------------------------------------------------
IOLD1_BACCZ     ----------------------------------------------------------------------
MEND_CHLTE      ----------------------------------------------------------------------
MEND_CORJK      ----------------------------------------------------------------------
IOLD_LACCA      ----------------------------------------------------------------------
MEND_PELLD      ----------------------------------------------------------------------
IOLD_LISMF      ----------------------------------------------------------------------
MEND_CHLP8      ----------------------------------------------------------------------
MEND_FLAJ1      ----------------------------------------------------------------------
MEND_RUBXD      ----------------------------------------------------------------------
IOLD_LISIN      ----------------------------------------------------------------------
MEND_BACTN      ----------------------------------------------------------------------
MEND_COREF      ----------------------------------------------------------------------
MEND_BACP2      ----------------------------------------------------------------------
MEND_CYTH3      ----------------------------------------------------------------------
MEND_LEUMM      ----------------------------------------------------------------------
MEND_FLAPJ      ----------------------------------------------------------------------
MEND_CHLL2      ----------------------------------------------------------------------
MEND_LYSSC      ----------------------------------------------------------------------
IOLD_LISMO      FTTSSKTAFG----PATKFININVS--RMQTYKLDAFQVVGDAKATLAELAPLLK---------------
PDC5_YEAST      ----------------------------------------------------------------------
MEND_MYCLE      ----------------------------------------------------------------------
MEND_MYCLB      ----------------------------------------------------------------------
MEND_BACSU      ----------------------------------------------------------------------
PDC3_SCHPO      ----------------------------------------------------------------------
MEND_DECAR      ----------------------------------------------------------------------
MEND_CHLAA      ----------------------------------------------------------------------
PDC2_SCHPO      ----------------------------------------------------------------------
PDC1_SCHPO      ----------------------------------------------------------------------
PDC1_CANGA      ----------------------------------------------------------------------
MEND_MYCS2      ----------------------------------------------------------------------
MEND_MYCA9      ----------------------------------------------------------------------
KDC_MYCPA       ----------------------------------------------------------------------
KDC_MYCA1       ----------------------------------------------------------------------
MEND_OCEIH      ----------------------------------------------------------------------
KDC_MYCTU       ----------------------------------------------------------------------
KDC_MYCTA       ----------------------------------------------------------------------
KDC_MYCBP       ----------------------------------------------------------------------
KDC_MYCBO       ----------------------------------------------------------------------
MEND_MYCVP      ----------------------------------------------------------------------
MEND_MYCMM      ----------------------------------------------------------------------
MEND_BACCR      ----------------------------------------------------------------------
MEND_MYCGI      ----------------------------------------------------------------------
MEND_MYCUA      ----------------------------------------------------------------------
MEND_CHLPD      ----------------------------------------------------------------------
MEND_BACC1      ----------------------------------------------------------------------
MEND_BACA2      ----------------------------------------------------------------------
MEND_STAS1      ----------------------------------------------------------------------
MEND_SORC5      ----------------------------------------------------------------------
MEND_PARD8      ----------------------------------------------------------------------
MEND_MYCPA      ----------------------------------------------------------------------
MEND_MYCA1      ----------------------------------------------------------------------
MEND_BACAN      ----------------------------------------------------------------------
MEND_BACAH      ----------------------------------------------------------------------
MEND_ARTS2      ----------------------------------------------------------------------
MEND_PROA2      ----------------------------------------------------------------------
MEND_NOCSJ      ----------------------------------------------------------------------
KDC_MYCUA       ----------------------------------------------------------------------
PDC2_PEA        ----------------------------------------------------------------------
MEND_SALRD      ----------------------------------------------------------------------
MEND_BACWK      ----------------------------------------------------------------------
MEND_BACCZ      ----------------------------------------------------------------------
KDC_MYCLE       ----------------------------------------------------------------------
MEND_LISMO      ----------------------------------------------------------------------
MEND_LISMF      ----------------------------------------------------------------------
MEND_CORGB      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           XXXXXXKDREVLDSDASPIHPARIYGELNRILXXXXXXXXXXXXXXSYAGKYIQPRRPGNWLDPGPFGCL
ILVG_MYCTU      ETMARDLEKAELVDDRIPLHPMRVYXXXXXXXXXXXXVVIDAGDFGSYAGRMIDSYLPGCWLDSGPFGCL
ILVG_MYCBO      ETMARDLEKAELVDDRIPLHPMRVYXXXXXXXXXXXXVVIDAGDFGSYAGRMIDSYLPGCWLDSGPFGCL
ILVBL_HUMAN     READRQKEQTFREKAAMPVNPVQVLQLVEETLPDNSILVVDGGDFVGTAAHLVQPRGPLRWLDPGAFGTL
ILVBL_CAEEL     ESANAKKMEQKLTNGF--LNPLNFLRTLDQSLPDDAILVADGGDFVGSAAYIVRPRGPLQWLDPXXXXXX
ILVBL_MOUSE     DQQ---KEQTYRDKALMPVNPVWVLQQVEETLPDNALLVVDGGDFVATAAYLVQPRGPLRWLDPGAFGTL
OXC_ECOLI       KQQNAQKMHEKLSTDTQPLNYFNALSAVRDVLRENQDIYLVNEGANTLARNIIDMYKPRRRLDCGTWGVM
OXC_ECO57       KQQNAQKMHEKLSTDTQPLNYFNALSAVRDVLRENQDIYLVNEGANTLARNIIDMYKPRRRLDCGTWGVM
ILVBL_BOVIN     DQQKEQAFREALMPVAQHLNPVRVLQLVEDTLPDNSILVVDGGDFVGTAAYLVQPRGPLRWLDPGAFGTL
ILVBL_DANRE     DNVKEKANRAKADEKTEHLNPLSVLHRVDELLAEDSIIVADGGDFVGSAAYIMRPRGPLCWLDPXXXXXX
ILVBL_XENLA     LAREHHRDEEILTQPAERINPLSVLWQLNGLTDQESIIVADGGDFVGSAAYILRPRGPLSWLDXXXXXXX
ILVB_METJA      KKLSI----PMMDFDDKPIKPQRFVKDLMEVLNEIDSKLKNTIITTDWMAHFFKTKMPRSFLASGGLGTM
ILVB_SYNPX      ERINTWKDRYPLTIPPAAIYPQEVLLAV-RDLAPDAIVTTDVGQHQMWAAQHLR-NGPRGWISSAGLGTM
HACL1_MOUSE     MKSNEAISKELASQKSLPMNYYTVFYHVQEQLPRDSFIVSEGANTMDIGRTMLQNCLPRHRLDAGSFGTM
ILVB_METAO      VNSLKKSSIPVMDYDDIPIKPQKIVKELMAVINKNTIITTDVGQNQMWMAHYFKTQTPRSFLSSGGLGTM
ILVB_GUITH      RIIRWRKEYPLLPKNINNLSPQEVIHEIS-TEATNAYFTTDVGQHQMWAAQFIKTSQK-RWITSAGLGTM
ILVI_HAEIN      -----AKKCLEFDRTSGVIKPQQVVEAVYRLTKGQAYVASDVGQHQMFAALHYPFDEPRHWINSGGAGTM
ILVB_MYCTU      RKTYPLSYGPQSDGSLSPEY---VIEKLGEIAGPDAVFVAGVGQHQMWAAQFIRYEKPRSWLNSGGLGTM
ILVB_MYCBO      RKTYPLSYGPQSDGSLSPEY---VIEKLGEIAGPDAVFVAGVGQHQMWAAQFIRYEKPRSWLNSGGLGTM
ILVI_BUCSC      IKIQSWKNKNSLDTNSDNIKPQSVIKTIWKLTKGKAFITSDVGQHQMFAALYYSFQKPRRWINSGGLGTM
OXC_OXAFO       VDGNKAKGKMTAETPSGMMNYSNSLGVVRDFMLANPDISLVNEGANALTRMIVDMLKPRKRLDSGTWGVM
XSC_ALCXX       SLDMIEEAKERTPTGGSYLHPRQVLRELEKAMPARVMVSTDIGNINSVANSYLRFDEPRSFFAPMSFGNC
HACL1_HUMAN     MKSNEAASKELASKKSLPMNYYTVFYHVQEQLPRDCFVVSEGANTMDIGRTVLQNYLPRHRLDAGTFGTM
ILVB_ARATH      KQKFPLS----FKTFGEAIPPQYAIKVLDELTDGKAIISTGVGQHQMWAAQFYNYKKPRQWLSSGGLGAM
ILVB2_TOBAC     KVKYPLNFKTFGDA----IPPQYAIQVLDELTNGSAIISTGVGQHQMWAAQYYKYRKPRQWLTSGGLGAM
ILVB1_TOBAC     KVKHPLNFKTFGDA----IPPQYAIQVLDELTNGNAIISTGVGQHQMWAAQYYKYRKPRQWLTSGGLGAM
HACL1_RAT       RKNNEAVSKELASKKSLPMNYYTVFYHVQEQLPRNCFIVSEGANTMDIGRTVLQNYLPRHRLDAGSFGTM
ILVB3_BRANA     KQKFPLS----FKTFGEAIPPQYAIQVLDELTQGKAIISTGVGQHQMWAAQFYKYRKPRQWLSSSGLGAM
ILVB1_BRANA     KQKFPLS----FKTFGEAIPPQYAIQILDELTEGKAIISTGVGQHQMWAAQFYKYRKPRQWLSSSGLGAM
ILVB_MYCLE      RKTYPLSYSPQSDGTLSPEY---VIEKLGEIVGPEAVYVAGVGQHQMWAAQFISYEKPRTWLNSGGLGTM
ILVB_SPIPL      LNQLREPIPLTVPHPEDGISPQDGDWELSH-QCPDAFYTTDVGQHQMWAGQFVQ-NGPRRWMTSGGLGTM
ILVB_PORYE      RQQYPL----LVPRKSTSISPQVILVATNK-LAQNAYFTTDVGQHQMWSAQFLKVKAK-HWLSSAGLGTM
ILVB_CORGL      DYLKGLKARFPRGYDEQPLAPQFVIETLSKEVGPDAIYCAGVGQHQMWAAQFVDFEKPRTWLNSGGLGTM
ILVI_SALTY      RARQCLK----YDAESESIKPQAVIETLWRLTKGDAYVTSDVGQHQMFAALYYPFDKPRRWINSGGLGTM
ILVB_PORUM      RQQYPL----LVPKKSTSISPQEILVTTNQ-LAQDAYFTTDVGQHQMWSAQFLKVKSK-HWISSAGLGTM
ILVB_PORPU      RQQYPL----LVPKKSTSISPQEILVTTNQ-LAQDAYFTTDVGQHQMWSAQFLKVKSK-HWISSAGLGTM
ILVB_ECOLI      -------QREFPCPIPKACDPLSHYGLINAVVDDNAIITTDVGQHQMWTAQAYPLNRPRQWLTSGGLGTM
XSC_ALCDF       SLDMI---EEQSKEEGNWLHPRQVLRELEKAMPEDVMVSTDIGNINSVANSYLRFEKPRSFFAAMSWGNC
ILVG_ECOLI      -----------YDHPGDAIYAPLLLKQLSDRKPADCVVTTDVGQHQMWAAQHIAHTRPENFITSSGLGTM
ILVI_BUCBP      INCWKSKNSLEYDRKSKKIKPQNVIEIISALTNGNAFVTSDVGQHQMFTALYYSFNKPRRWVNSGGLGTM
ILVB_BACSU      KEEYPL---WYVDNEEEGFKPQKLIEYIHQFTKGEAIVATDVGQHQMWSAQFYPFQKADKWVTSGGLGTM
ILVI_ECOLI      RARQCLK----YDTHSEKIKPQAVIETLWRLTKGDAYVTSDVGQHQMFAALYYPFDKPRRWINSGGLGTM
ILVB_MYCAV      QSTYPLSYGPQSDGSLGPEY---VIEKLGQIAGPDALYVAGVGHDQMWAAQFISYEKPRTWLNSGGQGTM
ILVB_KLEPN      QHQRELLDRRGAQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYTFRARQVMISNGQQTM
ILVB_CYACA      KKEYPLS----IPHDSKLLYPQEVINEISQI-AQKAFFATDVGQHQMWAAQFLKVEQ-GKWLSSSGLGTM
ILVB_YEAST      KKEYPYAYME--ETPGSKIKPQTVIKKLSKVANDTGRHVIVTTGVGQWAAQHWTWRNPHTFITSGGLGTM
ILVB2_BRANA     RLKFPLRYK----TFGEEIPPQYAIQLLDELTDGKAIITTGVGQHQMWAAQFYRFKKPRQWLSSGGLGAM
XSC_DESTI       RNDWFKEIEEMAMMPGNPINPRRVLFEVAKLMPEDAILTTDIGNVASTANSYFKFTKPKKHIAALTFGNT
ILVB_SCHPO      TWKERFPFTFTRSAPGELVKPQEVIQELDKDIKDKVTITTGVGAHQMWAATFYRWTKPSSLVTSGGLGTM
ILVB1_MAIZE     KREFPL-GYKTSNEEIQPQYAIQVLDELTK---GEAIIGTGVGQHQMWAAQYYTYKRPRQWLSSAGLGAM
ILVB1_ORYSJ     KREFPL-GYKTFGEEIPPQYAIQVLDELTK---GEAIIATGVGQHQMWAAQYYTYKRPRQWLSSAGLGAM
ILVB2_ORYSJ     KVEFPLGYR----TFGEEIPPQYAIQVLDEVTNGEAIVATGVGQHQMWATQHYTYRRPRQWLSSXXXXXX
ILVX_BACSU      LKQYMHEGEQVADWKSDRAHPLEIVKELRNAVDDHVTVTCDIGSHAIWMSRYFRSYEPLTLMISNGMQTL
ILVI_BUCAI      XXXXXXXSLQ-YNQLSNKIKPQTVIKTLFKLTKGTSYITSDVGQHQMFTALYYPFNKPRRWINSGGLGTM
ILVB_CRYNE      GRCKATKERYPFSQEGQKLKPQEVVQELDRLGKEKFIISTGVGQHQMWACQYYRWTEPRSWVSSGGLGTM
ILVB_CRYNV      GRCKATKERYPFSQEGQKLKPQEVVQELDRLGKEKFVISTGVGQHQMWACQYYRWTEPRSWVSSGGLGTM
YGK4_SCHPO      NETRSKNEKKALESRKSSIPLQMNYAVVNEELQSLSLKSKRNITWVSEGAQLLEVTHPRGRLDAGTMSTM
XSC_RHIME       LSSMDHEDDDARQREPDRMSPRQVWRAIQAVLPKEAIISTDIGNNCAIGNAYPSFEQGRKYLAPGMFGPC
ILVB_LACLA      NKEKAPFTYEPQNHDIRPQETIKLIGEYTQ---GDAIIVTDVGQHQMWVAQYYPYKNARQLITSGGMGTM
GCL_ECOLI       ADCQQRK-RTLLRKDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIAAAQMLHVFKDRHWINCGQAGPL
GCL_ECO57       ADCQQRK-RTLLRKDNVPVKPQRVYEEMNKAFGRDVCYVTTIGLSQIAAAQMLHVFKDRHWINCGQAGPL
ILVB2_MAIZE     KREFPL-GYKIFNEEIQPQYAIQVLDELTK---GEAIIATGVGQHQMWAAQYYTYKRPRQWLSSXXXXXX
YDAP_BACSU      QHWWNEIEKDETEA-TTPLKPQQVVARLQEXXXXXXXXXXXXGTVTVWMARHFKMNANQDFIVSSWLATM
POXB_LACPL      VKNWRAYLASLEDKQEGPLQAYQVLRAVNKIAEPDAIYSIDVGDINLNANRHLKLTPSNRHITSNLFATM
ILVI_BUCAP      XXXXXXXXLE-YNKKSNKIKPQKIIQTLFKLTKGTSYITSDVGQHQMFTALYYQFNKPRRWINSGGLGTM
MDLC_PSEPU      QLPTAAPEPAKVDQDAGRLHPETVFDTLNDMAPENAIYLNESTSTTAQMWQRLNMRNPGSY-----YFCX
POXB_STRPN      QNWRDYMNK-LEGKTEGELQLYQVYNAINKHADQDAIYSIDVGNTTQTSTRHLHMTPKNMWRTSPLFATM
ILVB_KLETE      ------------------LHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYSFRARQVMISNGQQTM
YEC0_YEAST      REKIQLNQTRLLRKEGAQLNYNQVYGTLRPLIDDYRTILVTEGANTMDIARISFPTAPRRRLDAGTNATM
POXB_ECOLI      ALEDYRDARKGLDDLAKPIHPQYLAQQISHFAADDAIFTCDVGTPTVWAARYLKMNGKRRLLGSFNHGSM
BZNB_PSEFL      TDLAQERYASIAAKSSSELHPFHASQVIAKHXXXXXXXXXXXXLTYLWLSEVMSRVKPGGFLCHGYLGSM
HACL1_DICDI     ---------------------------------------------------------PRSRLDAGTLATM
MDLC_PSEAE      XXXXXXXXXXXXXXXGGPLRPETVFDVIDALAPRDAIFVKESTSTVTAFWQRVEMREPGSY-XXXXXXXX
DCIP_AZOBR      -----------LQADGEPIAPMDIARAVNDRVRAGQEPLLIAADMGDCLFTAMDMIDAG-LMAPGYYAGM
IOLD_BACHK      TCQDFTPENEYVDALGTQLTQTAVIGQINTLLDKDAIIVGAAGSLPGDLQRMWASRKPNTYHMEYGYSCM
IOLD_BACC0      TCQDFTPENEYVDALGTQLTQTAVIGQINTLLDEDAIIVGAAGSLPGDLQRMWASRKPNTYHMEYGYSCM
IOLD_BACAN      TCQDFTPENEYVDALGTQLTQTAVIGQINTLLDKDAIIVGAAGSLPGDLQRMWASRKPNTYHMEYGYSCM
IOLD_BACAC      TCQDFTPENEYVDALGTQLTQTAVIGQINTLLDKDAIIVGAAGSLPGDLQRMWASRKPNTYHMEYGYSCM
IOLD_BACAA      TCQDFTPENEYVDALGTQLTQTAVIGQINTLLDKDAIIVGAAGSLPGDLQRMWASRKPNTYHMEYGYSCM
IOLD2_BACCZ     QDFKPEVENEYVDALGTQLTQTAVIGEMNTLLDEDAIIVGAAGSLPGDLQRMWTSRKPNTYHMEYGYSCM
Y737_HAEIN      ----------------------------------------------------------------------
Y663_METJA      ----------------------------------------------------------------------
IOLD_GEOTN      AGHLDEKLPEYREAFGSELTQTGVIGKVNELIDDDAVIVGASGSLPGDLQRMWVCKDRNTYHMEYGYSCM
MEND_DESPS      ----------------------------------------------------------------------
IOLD_BACC3      ---------EYVDALGSQLTQTAVIGQINTLLDEDAIIVGAAGSLPGDLQRMWASRKPNTYHMEYGYSCM
IOLD_BACAH      ---------EYVDALGSQLTQTAVIGQINTLLDEDAIIVGAAGSLPGDLQRMWASRKPNTYHMEYGYSCM
IOLD1_BACCZ     ---------EYVDALGSQLTQTAVIGQINTLLDEDAIIVGAAGSLPGDLQRMWASRKPNTYHMEYGYSCM
MEND_CHLTE      ----------------------------------------------------------------------
MEND_CORJK      ----------------------------------------------------------------------
IOLD_LACCA      ----------------------------------------------------------------------
MEND_PELLD      ----------------------------------------------------------------------
IOLD_LISMF      ----------------------------------------------------------------------
MEND_CHLP8      ----------------------------------------------------------------------
MEND_FLAJ1      ----------------------------------------------------------------------
MEND_RUBXD      ----------------------------------------------------------------------
IOLD_LISIN      ----------------------------------------------------------------------
MEND_BACTN      ----------------------------------------------------------------------
MEND_COREF      ----------------------------------------------------------------------
MEND_BACP2      ----------------------------------------------------------------------
MEND_CYTH3      ----------------------------------------------------------------------
MEND_LEUMM      ----------------------------------------------------------------------
MEND_FLAPJ      ----------------------------------------------------------------------
MEND_CHLL2      ----------------------------------------------------------------------
MEND_LYSSC      ----------------------------------------------------------------------
IOLD_LISMO      ----------------------------------------------------------------------
PDC5_YEAST      ---------------------------------------------------------------------V
MEND_MYCLE      ----------------------------------------------------------------------
MEND_MYCLB      ----------------------------------------------------------------------
MEND_BACSU      ----------------------------------------------------------------------
PDC3_SCHPO      ----------------------------------------------------------------------
MEND_DECAR      ----------------------------------------------------------------------
MEND_CHLAA      ----------------------------------------------------------------------
PDC2_SCHPO      ----------------------------------------------------------------------
PDC1_SCHPO      ------------------------------------------------------------------WGSI
PDC1_CANGA      ----------------------------------------------------------------------
MEND_MYCS2      ----------------------------------------------------------------------
MEND_MYCA9      ----------------------------------------------------------------------
KDC_MYCPA       ------------------------------------------------------------------WGSI
KDC_MYCA1       ------------------------------------------------------------------WGSI
MEND_OCEIH      ----------------------------------------------------------------------
KDC_MYCTU       ------------------------------------------------------------------WGSI
KDC_MYCTA       ------------------------------------------------------------------WGSI
KDC_MYCBP       ------------------------------------------------------------------WGSI
KDC_MYCBO       ------------------------------------------------------------------WGSI
MEND_MYCVP      ----------------------------------------------------------------------
MEND_MYCMM      ----------------------------------------------------------------------
MEND_BACCR      ----------------------------------------------------------------------
MEND_MYCGI      ----------------------------------------------------------------------
MEND_MYCUA      ----------------------------------------------------------------------
MEND_CHLPD      ----------------------------------------------------------------------
MEND_BACC1      ----------------------------------------------------------------------
MEND_BACA2      ----------------------------------------------------------------------
MEND_STAS1      ----------------------------------------------------------------------
MEND_SORC5      ----------------------------------------------------------------------
MEND_PARD8      ----------------------------------------------------------------------
MEND_MYCPA      ----------------------------------------------------------------------
MEND_MYCA1      ----------------------------------------------------------------------
MEND_BACAN      ----------------------------------------------------------------------
MEND_BACAH      ----------------------------------------------------------------------
MEND_ARTS2      ----------------------------------------------------------------------
MEND_PROA2      ----------------------------------------------------------------------
MEND_NOCSJ      ----------------------------------------------------------------------
KDC_MYCUA       ------------------------------------------------------------------WGSI
PDC2_PEA        ------------------------------------------------------------------YGSI
MEND_SALRD      ----------------------------------------------------------------------
MEND_BACWK      ----------------------------------------------------------------------
MEND_BACCZ      ----------------------------------------------------------------------
KDC_MYCLE       ------------------------------------------------------------------WGSI
MEND_LISMO      ----------------------------------------------------------------------
MEND_LISMF      ----------------------------------------------------------------------
MEND_CORGB      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           GTGMGYAIAARLVRPSSQVVALFGDGALGFSLADVDTLVRHNLPVVMVCGNNGIWGLEKAPMQLVYGYDV
ILVG_MYCTU      GSGPGYALAAKLARPQRQVVLLQGDGAFGFSGMEWDTLVRHNVAVVSVIGNNGIWGLEKHPMEALYGYSV
ILVG_MYCBO      GSGPGYALAAKLARPQRQVVLLQGDGAFGFSGMEWDTLVRHNVAVVSVIGNNGIWGLEKHPMEALYGYSV
ILVBL_HUMAN     GVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALVGNDAGW---------------
ILVBL_CAEEL     XXXXXXXXXXKTVYPKRPVYIIWGDGSCGYSLMEYDTFARHKLPVIGIVGNDACWAREQVPM---FQSSV
ILVBL_MOUSE     GVGAGFALGAKLCQPEAEVWCLFGDGAFGYSLIEFDTFVRHKVPVIALVGNDAGWTQISREQVPRLGSDV
OXC_ECOLI       GIGMGYAIGAS-VTSGSPVVAIEGDSAFGFSGMEIETICRYNLPVTIVIFNNG--GIYRGDGVDLSGAGA
OXC_ECO57       GIGMGYAIGAS-VTSGSPVVAIEGDSAFGFSGMEIETICRYNLPVTIVIFNNG--GIYRGDGVDLSGAGA
ILVBL_BOVIN     GVGAGFALGAKLCRPDAEVWCLFGDGAFGYSLIEFDTFVRHKIPVMALIGNDAGW---------------
ILVBL_DANRE     XXXXXXXXXXKLCRPESEVWIVYGDGSLGYTVAEFDTFTRHKTPVIALVGNDACWSQISREQVPMLGSNV
ILVBL_XENLA     XXXXXXXXXXKLCRPQAHVWVVYGDGSAGYSLAEWDTMARHKAPAIGVIGNDACWSQIARDQLGLFGSNV
ILVB_METJA      GFGFPAAIGAKVAKPYANVISITGDGGFLMNSQELATISEYDIPVVICIFDNRTLGMVYQWQNLYYGQQS
ILVB_SYNPX      GFGMPAAMGAQVAMPDRQVVCIAGDASILMNIQELGTLAAYGLPVKVVIVNNHWQGMVRQWQESFYDYSA
HACL1_MOUSE     GVGLGFAIAAALVSPGQRVICVEGDSAFGFSGMEVETICRYXXXXXXXXXXXGIYGFDADTWEKMLHFQE
ILVB_METAO      GFGFPSAIGAKVAKPDSKVICITGDGGFMMNCQELGTIAEYNIPVVICIFDNRTLGMVYQWQNLFYGRQC
ILVB_GUITH      GYGLPAAIGVQIAHPNEQVICISGDASFQMNIQELGTVSQYGLPIKIFIINNKWQGMVRQWQQAFYGHSN
ILVI_HAEIN      GFGFPAALGVKLAHPEGTVVCVTGDGSIQMNIQELSTATQYGIPVVIICLNNHFLGMVKQWQDLIYGRHS
ILVB_MYCTU      GFAIPAAMGAKIALPGTEVWAIDGDGCFQMTNQELATCAVEGIPVKVALINNGNLGMVRQWQSLFY----
ILVB_MYCBO      GFAIPAAMGAKIALPGTEVWAIDGDGCFQMTNQELATCAVEGIPVKVALINNGNLGMVRQWQSLFY----
ILVI_BUCSC      GFGLPAALGVKLAFPNETVICVTGDGSIQMNIQELSTAMQYELPILILNLNNKSLGMVKQWQDIIY----
OXC_OXAFO       GIGMGYCVAAAAV-TGKPVIAVEGDSAFGFSGMELETICRYNLPVTVIIMNNGYKGNEADPQPGVISCTR
XSC_ALCXX       GYALPTIIGAKCAAPDRPAIAYAGDGAWGMSMMEIMTAVRHDIPVTAVVFHNRQWGAEKKNQVDFYNRRF
HACL1_HUMAN     GVGLGFAIAAAVVSPGQWIICVEGDSAFGFSGMEVETICRYXXXXXXXXXXXGIYGFDTDTKEMLKFQDA
ILVB_ARATH      GFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKVLLLNNQHLGMVMQWEDRFYAHTF
ILVB2_TOBAC     GFGLPAAIGAAVGRPDEVVVDIDGDGSFIMNVQELATIKVENLPVKIMLLNNQHLGMYKANRAHTYLGNP
ILVB1_TOBAC     GFGLPAAIGAAVGRPDEVVVDIDGDGSFIMNVQELATIKVENLPVKIMLLNNQHLGMYKANRAHTYLGNP
HACL1_RAT       GVGLGFAIAAAVVSPGQRVICVEGDSAFGFSGMEVETICRYXXXXXXXXXXXXXXGFDADTWGKILNFQG
ILVB3_BRANA     GFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKILLLNNQHLGMVMQWEDRFYAHTY
ILVB1_BRANA     GFGLPAAIGASVANPDAIVVDIDGDGSFIMNVQELATIRVENLPVKILLLNNQHLGMVMQWEDRFYAHTY
ILVB_MYCLE      GFAIPAAMGAKIARPEAEVWAIDGDGCFQMTNQELATCAIEGAPIKVALINNGNLGMVRQWQALFY----
ILVB_SPIPL      GYGLPAAVGVKVAHPHDTVTCISGDGSFQMNMQELGTIAQYGIGVKVIILNNGWLGMVRQWQHMFY----
ILVB_PORYE      GYGLPAAIGAQVAHPNDVVICISGDSSFQMNMQELGTIAQYQLPVKIIIINNRWQGMVRQWQQAFYGHSR
ILVB_CORGL      XXXXXXXXXXXXXXPDKEVWAIDGDGCFQMTNQELTTAAVEGFPIKIALINNGNLGMVRQWQTLFYGRYS
ILVI_SALTY      GFGLPAALGVKMALPKEMVVCVTGDGSIQMNIQELSTALQYELPVLVLNLNNRYLGMVKQWQDMIYGRHS
ILVB_PORUM      GYGLPAAIGAQVAHPNELVICVSGDSSFQMNMQELGTIAQYKLPIKIVIINNRWQGMVRQWQQAFYGHSR
ILVB_PORPU      GYGLPAAIGAQVAHPNELVICVSGDSSFQMNMQELGTIAQYKLPIKIVIINNRWQGMVRQWQQAFYGHSR
ILVB_ECOLI      GFGLPAAIGAALANPDRKVLCFSGDGSLMMNIQEMATASENQLDVKIILMNNEALGLVHQQQSLFYEQGV
XSC_ALCDF       GYAFPTIIGAKVAAPHRPAVSYAGDGAWGMSMSEIMTCVRHDIPVTAVVFHNRQWGAEKKNQVDFYNRRF
ILVG_ECOLI      GFGLPAAVGAQVARPNDTVVCISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRLGMVRQWQQLFYSETT
ILVI_BUCBP      GYGLPAALGVKLALPKETVLCITGDGSIQMNIQELSTAMQYKXXXXXXXXXXXXXGMVKQWQDIIYGRHS
ILVB_BACSU      GFGLPAAIGAQLAEKXXXXXXXXXXXXFQMTLQELDVIRELNLPVKVVILNNACLGMVRQWQEIFYEERY
ILVI_ECOLI      GFGLPAALGVKMALPEETVVCVTGDGSIQMNIQELSTALQYELPVLVVNLNNRYLGMVKQWQDMIYGRHS
ILVB_MYCAV      GFAIPAAMGAKMGRPEAEVWAIDGDGCFQMTNQELATCAVEGIPIKVALINNGNLGMVRQWQTLFYQTDL
ILVB_KLEPN      GVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIGYNMVAIQEEKKYQRLSG---
ILVB_CYACA      GYGLPAAIGAKIANPNDLIICITGDASFQMNLQELGTIAQYELDIKIFIINNQWQGMVRQWQQAFYDYAH
ILVB_YEAST      GYGLPAAIGAQVAKPESLVIDIDGDASFNMTLTELSSAVQAGTPVKILILNNEEQGMVTQWQSLFYEHRY
ILVB2_BRANA     GFGLXXXXXXXXXXXXXVVVDIDGDGSFIMNIQELATIRVENLPVKVLLINNQHLGMVLQWEDHFYAANF
XSC_DESTI       GFAYQAGLGAQMAEPDSPVVAIVGDGAWGQSLHEISTAVQYKLPVIACVFRNMAWCAEKKNQIDFYNNRF
ILVB_SCHPO      GFGLPAAIGASVAAPKDIVIDIDGDASFSMTGMELATVRQFDIPVKILILNNEEQGMVTQWQNLFYEKRY
ILVB1_MAIZE     GFGLPAAAGASVANPGVTVVDIDGDGSFLMNVQELAMIRIENLPVKVFVLNNQHLGMEDRFYKANRAHTY
ILVB1_ORYSJ     GFGLPAAAGASVANPGVTVVDIDGDGSFLMNIQELALIRIENLPVKVMVLNNQHLGMEDRFYKANRAHTY
ILVB2_ORYSJ     XXXXXXXXXXXXXXXXXTVVDIDGDGSLLMNIQELAMVRVEDLPVKVMVLNNQHLGM-------------
ILVX_BACSU      GVALPWAIGASLVKPGEKVVSVSGDGGFLFSAMELETAVRLKAPIVHIVWNDSTYDMVAFQQLKKYNRTS
ILVI_BUCAI      GFGLPAALGVKLALPKETVICITGDGSIQMNIQELSTARQYNLAVLILNLNNSSLGMVKQWQDMIYGRHS
ILVB_CRYNE      GFGLPSAIGAKVAAPEKYVIDIDGDASFSMTAMELATASQYDIGVKVLLFNNEFQGMVEQWQDLFYENRY
ILVB_CRYNV      GFGLPSAIGAKVAAPEKYVIDIDGDASFSMTAMELATASQYDIGVKVLLFNNEFQGMVEQWQDLFYENRY
YGK4_SCHPO      GVGMGYAIASAFAHSSDKIVVVEGDSAFGFSAMELETAIRNQLDLVIVINNNGVYGLD------TDAYET
XSC_RHIME       GYGFPSIVGAKIGCPDVPVVGFAGDGAFGISMNEMTSIGREGWPITMVIFRNYQWGAEKRNTTLWYDNNV
ILVB_LACLA      GFGIPAAIGAKLAQPNKNVIVFVGDGGFQMTNQELALLNGYGIAIKVVLINNHSLGMVRQWQESFY----
GCL_ECOLI       GWTIPAALGVCAADPKRNVVAISGDFDFQFLIEELAVGAQFNIPYIHVLVNNAYLGLIR-QSQRAFDMDY
GCL_ECO57       GWTIPAALGVCAADPKRNVVAISGDFDFQFLIEELAVGAQFNIPYIHVLVNNAYLGLIR-QSQRAFDMDY
ILVB2_MAIZE     XXXXXXXXXXXXXXXXXTVVDIDGDGSFLMNIQELAMIRIENLPVKVFVLNNQHLGMEDRFYKANRAHTF
YDAP_BACSU      GCGLPGAIAASLSEPERQAIAVCGDGGFSMVMQDLPTAVKYKLPITVVILNNENLGMIEYEQQVKGNIDY
POXB_LACPL      GVGIPGAIAAKLNYPERQVFNLAGDGGASMTMQDLATQVQYHLPVINVVFTNCQYGFIK-----------
ILVI_BUCAP      GFGLPAALGVKLALPKATVICVTGDGSIQMNIQELSTARQYNLAVLILNLNNSSLGMVKQWQDMIY----
MDLC_PSEPU      XXXXXXXXXVQLAEPERQVIAVIGDGSANYSISALWTAAQYNIPTIFVIMNNGTYG--------------
POXB_STRPN      GIALPGGIAAKKDNPDRQVWNIMGDGAFNMCYPDVITNVQYDLPVINLVFSNAEYGFIK-----------
ILVB_KLETE      GVALPWAIGAWLVNPQRKVVSVSGDGGFLQSSMELETAVRLHANILHIIWVDNGYNMVAIQEQKKYQRLS
YEC0_YEAST      GIGLGYALACKASHPELDVVLIQGDSAFGFSAMEIETAVRCQLAVIVVMNNSGIYHGEK---------DI
POXB_ECOLI      ANAMPQALGAQATEPERQVVAMCGDGGFSMLMGDFLSVVQMKLPVKIVVFNNSVLGFVAMEMK-AGGYLT
BZNB_PSEFL      GVGFGTALGAQVLEAGRRTILVTGDGSVGYSIGEFDTLVRKQLPLIVIIMNNQSWGATLHFQQLAVGPNV
HACL1_DICDI     GVGVGYSVAAQICFPDRSVVCIQGDSAFGFSAMEMEVAVRYKLPIVIVLNNNGVYGLESSSTESASLHIP
MDLC_PSEAE      XXXXXXXXXXQLAQPRRQVIGIIGDGSANYGITALWSAAQYRVPAVFIILKNGTYGALRWFAGVLEVPDA
DCIP_AZOBR      GFGVPAGIGAQCVSGGKRILTVVGDGAFQMTGWELGNCRRLGIDPIVILFNNASW---------------
IOLD_BACHK      GYEVAGALGAKLAEPSKEVYAMVGDGSYQMLHSELVTSLQENKKIVLLFDNSG-----------------
IOLD_BACC0      GYEVAGALGAKLAEPSKEVYAMVGDGSYQMLHSELVTSLQENKKIVLLFDNSG-----------------
IOLD_BACAN      GYEVAGALGAKLAEPSKEVYAMVGDGSYQMLHSELVTSLQENKKIVLLFDNSG-----------------
IOLD_BACAC      GYEVAGALGAKLAEPSKEVYAMVGDGSYQMLHSELVTSLQENKKIVLLFDNSG-----------------
IOLD_BACAA      GYEVAGALGAKLAEPSKEVYAMVGDGSYQMLHSELVTSLQENKKIVLLFDNSG-----------------
IOLD2_BACCZ     GYEVAGALGAKLAEPSKEVYAMVGDGSYQMLHSELVTSLQENKKIVLLFDNSG-----------------
Y737_HAEIN      ----------------------------------------------------------------------
Y663_METJA      ----------------------------------------------------------------------
IOLD_GEOTN      GYEIAGAFGVKLAEPDKEVYAMVGDGSFLMLHSELVTSLQEGQKINIILFDNSGFG--------------
MEND_DESPS      ----------------------------------------------------------------------
IOLD_BACC3      GYEVAGALGAKLAEPSKEVYAMVGDGSYQMLHSELVTSLQENKKIVLLFDNSG-----------------
IOLD_BACAH      GYEVAGALGAKLAEPSKEVYAMVGDGSYQMLHSELVTSLQENKKIVLLFDNSG-----------------
IOLD1_BACCZ     GYEVAGALGAKIAEPSKEVYAMVGDGSYQMLHSELVTSLQENKKIVLLFDNSG-----------------
MEND_CHLTE      ----------------------------------------------------------------------
MEND_CORJK      ----------------------------------------------------------------------
IOLD_LACCA      ----------------------------------------------------------------------
MEND_PELLD      ----------------------------------------------------------------------
IOLD_LISMF      ----------------------------------------------------------------------
MEND_CHLP8      ----------------------------------------------------------------------
MEND_FLAJ1      ----------------------------------------------------------------------
MEND_RUBXD      ----------------------------------------------------------------------
IOLD_LISIN      ----------------------------------------------------------------------
MEND_BACTN      ----------------------------------------------------------------------
MEND_COREF      ----------------------------------------------------------------------
MEND_BACP2      ----------------------------------------------------------------------
MEND_CYTH3      ----------------------------------------------------------------------
MEND_LEUMM      ----------------------------------------------------------------------
MEND_FLAPJ      ----------------------------------------------------------------------
MEND_CHLL2      ----------------------------------------------------------------------
MEND_LYSSC      ----------------------------------------------------------------------
IOLD_LISMO      ----------------------------------------------------------------------
PDC5_YEAST      GALLGATMAAEELDPKKRVILFIGDGSLQLTVQEISTMIRWGLPYIFVLNNNG-YTIEKAEYNEIQGWDH
MEND_MYCLE      ----------------------------------------------------------------------
MEND_MYCLB      ----------------------------------------------------------------------
MEND_BACSU      ----------------------------------------------------------------------
PDC3_SCHPO      -SAFGYAIGA----PKRNVVVFVGDGSFQETVQEVSQMVRLNLPIIMFLINNRGYTIEDGPYNRIKNWD-
MEND_DECAR      ----------------------------------------------------------------------
MEND_CHLAA      ----------------------------------------------------------------------
PDC2_SCHPO      -SAMGYAVAA----PERRTIVMVGDGSFQLTGQEISQMIRHKLPVLIFLLNNRGYTIE------------
PDC1_SCHPO      GYSVGAMFGAVLAEPDRRTILVVGDGSLQLTITEISTCIRHNLPIIFIINNDG-----------------
PDC1_CANGA      GACLGAAFAAEEIDPKKRVILFIGDGSLQLTVQEISTMIRWGLPYLFVLNNDGIHG-EKAGYNDIQNWDH
MEND_MYCS2      ----------------------------------------------------------------------
MEND_MYCA9      ----------------------------------------------------------------------
KDC_MYCPA       GYTLPAALGAAVAHPDRRTVLLIGDGAAQLTVQELGTFAREGLSPVIVVVNNDGYTVERA----------
KDC_MYCA1       GYTLPAALGAAVAHPDRRTVLLIGDGAAQLTVQELGTFAREGLSPVIVVVNNDGYTVERA----------
MEND_OCEIH      ----------------------------------------------------------------------
KDC_MYCTU       GYTLPAAVGAAVAHPDRRTVLLIGDGAAQLTVQELGTFSREGLSPVIVVVNNDGYTVERA----------
KDC_MYCTA       GYTLPAAVGAAVAHPDRRTVLLIGDGAAQLTVQELGTFSREGLSPVIVVVNNDGYTVERA----------
KDC_MYCBP       GYTLPAAVGAAVAHPDRRTVLLIGDGAAQLTVQELGTFSREGLSPVIVVVNNDGYTVERA----------
KDC_MYCBO       GYTLPAAVGAAVAHPDRRTVLLIGDGAAQLTVQELGTFSREGLSPVIVVVNNDGYTVERA----------
MEND_MYCVP      ----------------------------------------------------------------------
MEND_MYCMM      ----------------------------------------------------------------------
MEND_BACCR      ----------------------------------------------------------------------
MEND_MYCGI      ----------------------------------------------------------------------
MEND_MYCUA      ----------------------------------------------------------------------
MEND_CHLPD      ----------------------------------------------------------------------
MEND_BACC1      ----------------------------------------------------------------------
MEND_BACA2      ----------------------------------------------------------------------
MEND_STAS1      ----------------------------------------------------------------------
MEND_SORC5      ----------------------------------------------------------------------
MEND_PARD8      ----------------------------------------------------------------------
MEND_MYCPA      ----------------------------------------------------------------------
MEND_MYCA1      ----------------------------------------------------------------------
MEND_BACAN      ----------------------------------------------------------------------
MEND_BACAH      ----------------------------------------------------------------------
MEND_ARTS2      ----------------------------------------------------------------------
MEND_PROA2      ----------------------------------------------------------------------
MEND_NOCSJ      ----------------------------------------------------------------------
KDC_MYCUA       GYTLPAALGAAVAHPDRRTVLLIGDGAAQLTVQELGIFSREGLSPVIVVVNNDGYTVERA----IHGETA
PDC2_PEA        GWSVGATLGYAQAVPEKRVIACIGDGSFQVTAQDVSTMLRCGQKTIIFLINNGGYTIE------------
MEND_SALRD      ----------------------------------------------------------------------
MEND_BACWK      ----------------------------------------------------------------------
MEND_BACCZ      ----------------------------------------------------------------------
KDC_MYCLE       GYTLPAALGAGLAHRNRRTVLLLGDGAAQLTIQELGSFYREGLSPVIVVVNNDGYTIERA----IHGATA
MEND_LISMO      ----------------------------------------------------------------------
MEND_LISMF      ----------------------------------------------------------------------
MEND_CORGB      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           LADLAPQTRYDQVVTALGGGGELVTDPAEIGPALRRAFDSGVPYLVNIVTDPENVYPRKTMGx
ILVG_MYCTU      VAELRPGTRYDEVVRALGGHGELVSVPAELRPALERAFASGLPAVVNVLTDPSVAYPRRS---
ILVG_MYCBO      VAELRPGTRYDEVVRALGGHGELVSVPAELRPALERAFASGLPAVVNVLTDPSVAYPRRS---
ILVBL_HUMAN     ---------------------------------------------------------------
ILVBL_CAEEL     AVDLA-RTRYDNVAKSLGSWGETIDE-------------------------------------
ILVBL_MOUSE     ACSLA-YTDYHKAAMGLGAQGLILS--------------------------------------
OXC_ECOLI       PSDLLHHARYDKLMDAFRGVGYNVTTTDELRHALTTGIQSRKPTIINVVIDP-----------
OXC_ECO57       PSDLLHHARYDKLMDAFRGVGYNVTTTDELRHALTTGIQSRKPTIINVVIDP-----------
ILVBL_BOVIN     ---------------------------------------------------------------
ILVBL_DANRE     ACGLA-FTDYHVVADGYGGKGYLIEDESQLEDIIKKACKEGKAVLLNVLIGKTN---------
ILVBL_XENLA     ACGL-QSTRYDLVGAAYAGADPL----------------------------------------
ILVB_METJA      EVHLGESPDFVKLAESYGVKADRIISPDEIKEKLKEAILSNEPYLLDIVIDPAEALP------
ILVB_SYNPX      SDMLNGMPDFIALARSFGVDGVKITDRELLHRDLAAALQSPTPTMIDVVRRGENCYP------
HACL1_MOUSE     AATLLPNSHYEQVMTAFGGKGYFVRTPEELQHSLRQALDTSKPCLLNIMIEPQS---------
ILVB_METAO      SVNFGGAPDFIKLAESYGIKARRIESPNEINEALKEAINCDEPYLLDFAIDPSS---------
ILVB_GUITH      MEKGAP--NFTKVAEAFGLRSLKIKSRNDLKLRIKEALDYDGPILVDIVIADENCYPMVAPG-
ILVI_HAEIN      QTYMNSLPDFAKLAESYGHVGIKIATPDELESKLQEAFSNKLVFVDINVDESEHVYPMQIRG-
ILVB_MYCTU      ---------------------------------------------------------------
ILVB_MYCBO      ---------------------------------------------------------------
ILVI_BUCSC      ---------------------------------------------------------------
OXC_OXAFO       LT----RGRYDMMMEAFGGKGYVANTPXXXXXXXXXXXXSGKPCLINAMIDPD----------
XSC_ALCXX       VAGELESESFSDIAKAMGAEGIVVDHIEDVGPALQKAID------------------------
HACL1_HUMAN     TACLLPNSHYEQVMTAFGGKGYFVQTPEELQKSLRQSLDTTKPSLINIMIEPQ----------
ILVB_ARATH      LGDPAQE---DEIAAACGIPAARVTKKADLREAIQTMLDTPGPYLLDVIPHQEHVLP------
ILVB2_TOBAC     SNEAEIFPNMLKFAEACGVPAARVTHRDDLRAAIQKMLDTPGPYLLDIVPHQEHVLP------
ILVB1_TOBAC     SNEAEIFPNMLKFAEACGVPAARVTHRDDLRAAIQKMLDTPGPYLLDIVPHQEHVLP------
HACL1_RAT       TATLLPNSHYEQVMTAFGGKGYFVQTPEELQDSLRQALDTSKPCLINIMIEPQS---------
ILVB3_BRANA     LGDPARENEIFQFAGACGIPAARVTKKEELREAIQTMLDTPGPYLLDVIPHQEHVLP------
ILVB1_BRANA     LGDPARENEIFQFAGACGIPAARVTKKEELREAIQTMLDTPGPYLLDVIPHQEHVLP------
ILVB_MYCLE      ------QERYSQ--TDLATHSHRIPDFVKLAEAL-----------------------------
ILVB_SPIPL      ---------------------------------------------------------------
ILVB_PORYE      MTEGAPD--FQKLAEAFGIKAFTINNRQNMQSALQVAIDYPGPVLLDCVTENENCYPMVAPG-
ILVB_CORGL      NTKLRNQGEYDFVTLSEGLGAIRVTKAEEVLPAIQKARENDRPVVIDIVGEDAQVWPMVSAG-
ILVI_SALTY      QSYMQSLPDFVRLAEAYGHVGLQINRPDELSEALEHVRNNRLVFVDVTVDGSEHVYPMQIRG-
ILVB_PORUM      MTEGAP--NFQKLAEAFGIKAFTVNNRQNMESSLKDAMKYPGPVLLDCVTENENCYPMVAPG-
ILVB_PORPU      MTEGAP--NFQKLAEAFGIKAFTVNNRQNMESSLKDAMKYPGPVLLDCVTENENCYPMVAPG-
ILVB_ECOLI      FAATYPKINFMQIAAGFGLETCDLNNEADPQASLQEIINRPGPALIHVRIDEEKVYP------
XSC_ALCDF       VAGELESESFAGIARAMGAEGVVVDRIEDVGPALKKAIDA-----------------------
ILVG_ECOLI      LTD---NPDFLMLASAFGIHGQHITRKDQVEAALDTMLNSDGPYLLHVSIDEENVWP------
ILVI_BUCBP      HSYMKSLPNFIKLAESYGHIGISIHNPEDXXXXXXXXXDQGNLVFVDITIDPEHVYP------
ILVB_BACSU      SSKFASQPDFVKLSEAYGIKGIRISSXXXXXXXXXXXXTSREPVVIDVVASEEKVFPMVAPG-
ILVI_ECOLI      QSYMQSLPDFVRLAEAYGHVGIQISHPHELSEALEQVRNNRLVFVDVTVDGSEHVYPMQIRG-
ILVB_MYCAV      GHPLAPHPDFVKLAEALGCVGEREEDVVDVINAARAINDRPV-VIAFIVGADAQVWPMVAAG-
ILVB_KLEPN      -VEFGPMD-FKAYAESFGAKGFAVESAEALEPTLRAAMDVDGPAVVAIPVD------------
ILVB_CYACA      SNMAKGQPDFVQLANSYGIRGIRVTTSKDLKSKIERIISTPGPLLIDIVATSENCYP------
ILVB_YEAST      SHTHQLNPDFIKLAEAMGLKGLRVKKQEELDAKLKEFVSTKGPVLLEVEVD------------
ILVB2_BRANA     LGDPAPEAVFPDMLASCGIPAARVTRREDLREAIQTMLDTPGPFLLDVV--------------
XSC_DESTI       VGTEIPNISFIPAAEAFGAKGIRVEKPEDIADAFKQGLAEGHPVVLEFVVD------------
ILVB_SCHPO      SHTHQKNPNFVKLADAMGIKALRVEKREDLAKKMKEFLSTKGPVLMEVVAQKEHVYP------
ILVB1_MAIZE     LGNPENESEYPDFVTIAKGPAVRVTKKNEVRAAIKKMLETPGPYLLDIVPHQEHVLP------
ILVB1_ORYSJ     LGNPECESEYPDFVTIAKGPAVRVTKKSEVRAAIKKMLETPGPYLLDIVPHQEHVLP------
ILVB2_ORYSJ     ---------------------------------------------------------------
ILVX_BACSU      AVDFG-NIDIVKYAESFGATGLRVESPDQLADVLRQGMNAEGPVIIDVPVD------------
ILVI_BUCAI      HSYMDSLPDFVKLSESYGHFGIQITEPIELEEALSKLSDGHLVFVDVQIDNSEHVYPMQIQG-
ILVB_CRYNE      SHTRMTNPDFVKLSESMGTKGLRCTKLEDLPRMMKEEYDGKRPIVLECLVSSEHVYP------
ILVB_CRYNV      SHTRMTNPDFVKLSESMGAKGLRCTKLEDLPRMMKEEYDGKRPIVLECLVSSEHVYP------
YGK4_SCHPO      LRDLGTSIRYDQICEACGGKGFFVKNEEDLRSSLRKAWQTSSVSLINVMVDPE----------
XSC_RHIME       GTELNPNLSYAKVADGCGLKGVTVDTPAALTEALAKAIEKGITTFVEVVLNQE----------
ILVB_LACLA      ---------------------------------------------------------------
GCL_ECOLI       CVQLAFEVDHVKVAEGLGCKAIRVFKPEDIAPAFEQA--------------------------
GCL_ECO57       CVQLAFEVDHVKVAEGLGCKAIRVFKPEDIAPAFEQA--------------------------
ILVB2_MAIZE     LGNPENESEIYPDFVAIAKGFNIVTKKSEVHAAIKKMLEAPGPYLLDIVPHQEHVLP------
YDAP_BACSU      VTKL-QNVDYAAFAESCGAKGIKVTKAEELAPAFHEALHSDQPVVVDVMIGNEPPLPGK----
POXB_LACPL      ---------------------------------------------------------------
ILVI_BUCAP      ---------------------------------------------------------------
MDLC_PSEPU      ---------------------------------------------------------------
POXB_STRPN      ---------------------------------------------------------------
ILVB_KLETE      GVEFGP-VDFKVYAEAFGACGFAVESAEALEPTLRAAMDVDGPAVVAIPVD------------
YEC0_YEAST      EGDLPPNCRYDLVGKGLGANDFFVNTISELSRCFQQAVQKRETSVINVIIEP-----------
POXB_ECOLI      DGTELHDTNFARIAEACGITGIRVEKASEVDEALQRAFSIDGPVLVDVVVAKEEL--------
BZNB_PSEFL      TGTRLENGSYHGVAAAFGADGYHVDSVESFSAALAQALAHNRPACINVAVALDPIPPEE----
HACL1_DICDI     PTSLSVDTKYELIMQSFGGTG------------------------------------------
MDLC_PSEAE      PGLDVPGLDFCAIARGYGVEALHAATREELEGALKHALAADRPVLIEVPT-------------
DCIP_AZOBR      ---------------------------------------------------------------
IOLD_BACHK      ---------------------------------------------------------------
IOLD_BACC0      ---------------------------------------------------------------
IOLD_BACAN      ---------------------------------------------------------------
IOLD_BACAC      ---------------------------------------------------------------
IOLD_BACAA      ---------------------------------------------------------------
IOLD2_BACCZ     ---------------------------------------------------------------
Y737_HAEIN      ---------------------------------------------------------------
Y663_METJA      ---------------------------------------------------------------
IOLD_GEOTN      ---------------------------------------------------------------
MEND_DESPS      ---------------------------------------------------------------
IOLD_BACC3      ---------------------------------------------------------------
IOLD_BACAH      ---------------------------------------------------------------
IOLD1_BACCZ     ---------------------------------------------------------------
MEND_CHLTE      ---------------------------------------------------------------
MEND_CORJK      ---------------------------------------------------------------
IOLD_LACCA      ---------------------------------------------------------------
MEND_PELLD      ---------------------------------------------------------------
IOLD_LISMF      ---------------------------------------------------------------
MEND_CHLP8      ---------------------------------------------------------------
MEND_FLAJ1      ---------------------------------------------------------------
MEND_RUBXD      ---------------------------------------------------------------
IOLD_LISIN      ---------------------------------------------------------------
MEND_BACTN      ---------------------------------------------------------------
MEND_COREF      ---------------------------------------------------------------
MEND_BACP2      ---------------------------------------------------------------
MEND_CYTH3      ---------------------------------------------------------------
MEND_LEUMM      ---------------------------------------------------------------
MEND_FLAPJ      ---------------------------------------------------------------
MEND_CHLL2      ---------------------------------------------------------------
MEND_LYSSC      ---------------------------------------------------------------
IOLD_LISMO      ---------------------------------------------------------------
PDC5_YEAST      LA-------------------------------------------------------------
MEND_MYCLE      ---------------------------------------------------------------
MEND_MYCLB      ---------------------------------------------------------------
MEND_BACSU      ---------------------------------------------------------------
PDC3_SCHPO      ---------YAAIVEAFNAGGFRVGNGHELAEAIRQAKESQGPTLIECNIDQDD---------
MEND_DECAR      ---------------------------------------------------------------
MEND_CHLAA      ---------------------------------------------------------------
PDC2_SCHPO      ---------------------------------------------------------------
PDC1_SCHPO      ---------------------------------------------------------------
PDC1_CANGA      LA-------------------------------------------------------------
MEND_MYCS2      ---------------------------------------------------------------
MEND_MYCA9      ---------------------------------------------------------------
KDC_MYCPA       ---------------------------------------------------------------
KDC_MYCA1       ---------------------------------------------------------------
MEND_OCEIH      ---------------------------------------------------------------
KDC_MYCTU       ---------------------------------------------------------------
KDC_MYCTA       ---------------------------------------------------------------
KDC_MYCBP       ---------------------------------------------------------------
KDC_MYCBO       ---------------------------------------------------------------
MEND_MYCVP      ---------------------------------------------------------------
MEND_MYCMM      ---------------------------------------------------------------
MEND_BACCR      ---------------------------------------------------------------
MEND_MYCGI      ---------------------------------------------------------------
MEND_MYCUA      ---------------------------------------------------------------
MEND_CHLPD      ---------------------------------------------------------------
MEND_BACC1      ---------------------------------------------------------------
MEND_BACA2      ---------------------------------------------------------------
MEND_STAS1      ---------------------------------------------------------------
MEND_SORC5      ---------------------------------------------------------------
MEND_PARD8      ---------------------------------------------------------------
MEND_MYCPA      ---------------------------------------------------------------
MEND_MYCA1      ---------------------------------------------------------------
MEND_BACAN      ---------------------------------------------------------------
MEND_BACAH      ---------------------------------------------------------------
MEND_ARTS2      ---------------------------------------------------------------
MEND_PROA2      ---------------------------------------------------------------
MEND_NOCSJ      ---------------------------------------------------------------
KDC_MYCUA       TYNDIVSWRWTDVPGALG---------------------------------------------
PDC2_PEA        ---------------------------------------------------------------
MEND_SALRD      ---------------------------------------------------------------
MEND_BACWK      ---------------------------------------------------------------
MEND_BACCZ      ---------------------------------------------------------------
KDC_MYCLE       PYNNIARWRWTDIPGALG---------------------------------------------
MEND_LISMO      ---------------------------------------------------------------
MEND_LISMF      ---------------------------------------------------------------
MEND_CORGB      ---------------------------------------------------------------