[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54630.1

[Show Plain Result]


## Summary of Sequence Search
    1::603
   10::263     6e-51  41%  742 aa  PKWA_THECU RecName: Full=Probable serine/threonine-protein kinase
   10::264     8e-51  39%  799 aa  AFSK_STRCO RecName: Full=Serine/threonine-protein kinase afsK;     
   10::258     1e-49  40%  807 aa  AFSK_STRGR RecName: Full=Serine/threonine-protein kinase afsK;     
   12::263     1e-35  38%  627 aa  PKNB_LACLA RecName: Full=Probable serine/threonine-protein kinase
   32::272     9e-34  38% 1110 aa  PKNK_MYCTU RecName: Full=Probable serine/threonine-protein kinase
   10::264     9e-34  36%  625 aa  PKN1_THETN RecName: Full=Probable serine/threonine-protein kinase
   32::272     3e-33  37% 1110 aa  PKNK_MYCBO RecName: Full=Probable serine/threonine-protein kinase
   12::276     4e-33  36%  690 aa  PKNB_BIFLO RecName: Full=Probable serine/threonine-protein kinase
   14::258     8e-33  35%  626 aa  PKNH_MYCTU RecName: Full=Probable serine/threonine-protein kinase
   14::258     8e-33  35%  596 aa  PKNH_MYCBO RecName: Full=Probable serine/threonine-protein kinase
    9::265     1e-31  34%  648 aa  PRKC_BACSU RecName: Full=Serine/threonine-protein kinase prkC;     
   11::225     1e-31  40%  431 aa  PKNA_MYCTU RecName: Full=Probable serine/threonine-protein kinase
   11::225     1e-31  40%  431 aa  PKNA_MYCBO RecName: Full=Probable serine/threonine-protein kinase
    5::270     3e-31  36%  622 aa  PKNB_MYCLE RecName: Full=Serine/threonine-protein kinase pknB;     
   11::225     4e-31  39%  437 aa  PKNA_MYCLE RecName: Full=Probable serine/threonine-protein kinase
   16::263     2e-30  34%  641 aa  PK1_STRTO RecName: Full=Serine/threonine-protein kinase PK-1;      
    8::269     3e-30  33%  543 aa  PKAA_STRCO RecName: Full=Serine/threonine-protein kinase pkaA;     
   11::216     1e-29  38%  626 aa  PKNB_MYCTU RecName: Full=Serine/threonine-protein kinase pknB;     
   11::216     1e-29  38%  626 aa  PKNB_MYCBO RecName: Full=Serine/threonine-protein kinase pknB;     
    9::269     1e-29  34%  673 aa  PKNX_STRCO RecName: Full=Probable serine/threonine-protein kinase
   12::263     2e-29  36%  476 aa  PKNF_MYCTU RecName: Full=Serine/threonine-protein kinase pknF;     
   12::263     2e-29  36%  476 aa  PKNF_MYCBO RecName: Full=Serine/threonine-protein kinase pknF;     
   10::255     4e-29  33%  657 aa  PKN2_CLOAB RecName: Full=Probable serine/threonine-protein kinase
   10::267     7e-29  35%  520 aa  PKN2_COREF RecName: Full=Serine/threonine-protein kinases drp72;   
    9::279     7e-29  36%  646 aa  PKN1_CORGL RecName: Full=Probable serine/threonine-protein kinase
   10::272     2e-28  29%  685 aa  PKN2_CLOPE RecName: Full=Probable serine/threonine-protein kinase
    9::279     3e-28  35%  660 aa  PKN1_COREF RecName: Full=Probable serine/threonine-protein kinase
   10::283     8e-27  33%  469 aa  PKN2_CORGL RecName: Full=Serine/threonine-protein kinases pknA;    
   12::264     1e-26  30%  757 aa  PKNA2_BIFLO RecName: Full=Probable serine/threonine-protein kinase
   16::283     2e-25  30%  496 aa  Y4251_DICDI RecName: Full=Probable serine/threonine-protein kinase
   19::264     1e-24  29%  399 aa  PKNL_MYCBO RecName: Full=Probable serine/threonine-protein kinase
   13::239     2e-24  32%  664 aa  PKND_MYCTU RecName: Full=Serine/threonine-protein kinase pknD;     
   19::264     3e-24  29%  399 aa  PKNL_MYCTU RecName: Full=Probable serine/threonine-protein kinase
   26::272     9e-24  31%  556 aa  PKSC_STRCO RecName: Full=Serine/threonine-protein kinase pksC;     
    8::226     9e-24  35%  547 aa  PKN3_MYXXA RecName: Full=Serine/threonine-protein kinase pkn3;     
  133::383     3e-23  32%  402 aa  STK6_BOVIN RecName: Full=Serine/threonine-protein kinase 6;        
  394::654     3e-23  31%  766 aa  DCLK2_HUMAN RecName: Full=Serine/threonine-protein kinase DCLK2;   
  133::383     3e-23  32%  402 aa  STK6_PIG RecName: Full=Serine/threonine-protein kinase 6;       
   11::230     3e-23  37%  830 aa  PKN2_MYXXA RecName: Full=Serine/threonine-protein kinase pkn2;     
  393::653     3e-23  31%  756 aa  DCLK2_MOUSE RecName: Full=Serine/threonine-protein kinase DCLK2;   
  274::515     4e-23  31%  544 aa  PAK1_RAT RecName: Full=Serine/threonine-protein kinase PAK 1;      
  275::516     4e-23  31%  545 aa  PAK1_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 1;    
  274::515     4e-23  31%  544 aa  PAK1_BOVIN RecName: Full=Serine/threonine-protein kinase PAK 1;    
  275::516     6e-23  31%  545 aa  PAK1_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 1;    
  103::384     2e-22  30%  491 aa  STK33_MOUSE RecName: Full=Serine/threonine-protein kinase 33;      
   65::325     2e-22  29% 1028 aa  FRAY2_DICDI RecName: Full=Serine/threonine-protein kinase fray2;   
   46::295     2e-22  32%  540 aa  CIPKC_ORYSJ RecName: Full=CBL-interacting protein kinase 12;       
  133::383     3e-22  32%  403 aa  STK6_HUMAN RecName: Full=Serine/threonine-protein kinase 6;        
  116::376     3e-22  29%  486 aa  STK33_BOVIN RecName: Full=Serine/threonine-protein kinase 33;      
    4::249     4e-22  28% 1315 aa  STK36_PONAB RecName: Full=Serine/threonine-protein kinase 36;      
  674::920     4e-22  30%  954 aa  STE20_NEUCR RecName: Full=Serine/threonine-protein kinase ste-20;  
  273::514     4e-22  30%  544 aa  PAK3_RAT RecName: Full=Serine/threonine-protein kinase PAK 3;      
  288::529     4e-22  30%  559 aa  PAK3_PONPY RecName: Full=Serine/threonine-protein kinase PAK 3;    
  288::529     4e-22  30%  559 aa  PAK3_PANTR RecName: Full=Serine/threonine-protein kinase PAK 3;    
  288::529     4e-22  30%  559 aa  PAK3_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 3;    
  288::529     4e-22  30%  559 aa  PAK3_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 3;    
  249::495     4e-22  30%  524 aa  PAK2_RAT RecName: Full=Serine/threonine-protein kinase PAK 2;      
  249::495     4e-22  30%  524 aa  PAK2_RABIT RecName: Full=Serine/threonine-protein kinase PAK 2;    
  249::495     4e-22  30%  524 aa  PAK2_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 2;    
  249::495     4e-22  30%  524 aa  PAK2_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 2;    
  616::859     4e-22  29%  891 aa  MKCC_DICDI RecName: Full=Probable serine/threonine-protein kinase
    4::249     6e-22  28% 1315 aa  STK36_HUMAN RecName: Full=Serine/threonine-protein kinase 36;      
  472::719     6e-22  30%  746 aa  STE20_USTMA RecName: Full=Serine/threonine-protein kinase SMU1;    
   14::216     6e-22  31%  589 aa  PKNJ_MYCTU RecName: Full=Probable serine/threonine-protein kinase
   14::216     6e-22  31%  589 aa  PKNJ_MYCBO RecName: Full=Probable serine/threonine-protein kinase
    9::259     8e-22  28%  652 aa  NAK1_SCHPO RecName: Full=Serine/threonine-protein kinase nak1;     
  378::650     8e-22  31%  740 aa  DCLK1_HUMAN RecName: Full=Serine/threonine-protein kinase DCLK1;   
  116::388     1e-21  28%  514 aa  STK33_HUMAN RecName: Full=Serine/threonine-protein kinase 33;      
   12::276     1e-21  32%  535 aa  SPKC_SYNY3 RecName: Full=Serine/threonine-protein kinase C;        
   17::274     1e-21  26% 1495 aa  Y8901_DICDI RecName: Full=Probable serine/threonine-protein kinase
   14::248     1e-21  30%  566 aa  PKNE_MYCTU RecName: Full=Serine/threonine-protein kinase pknE;     
  326::567     2e-21  32%  591 aa  PAK4_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 4;    
  106::356     2e-21  30% 1060 aa  MRKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   71::343     2e-21  32%  433 aa  DCLK1_RAT RecName: Full=Serine/threonine-protein kinase DCLK1;     
  394::666     2e-21  32%  756 aa  DCLK1_MOUSE RecName: Full=Serine/threonine-protein kinase DCLK1;   
   92::368     3e-21  29%  424 aa  KPSH1_HUMAN RecName: Full=Serine/threonine-protein kinase H1;      
   92::368     3e-21  29%  424 aa  KPSH1_BOVIN RecName: Full=Serine/threonine-protein kinase H1;      
   15::263     4e-21  28%  343 aa  KCC1B_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   17::246     5e-21  35%  709 aa  ZYG1_CAEBR RecName: Full=Probable serine/threonine-protein kinase
  620::866     7e-21  29%  915 aa  STE20_CANGA RecName: Full=Serine/threonine-protein kinase STE20;   
   14::248     7e-21  30%  566 aa  PKNE_MYCBO RecName: Full=Serine/threonine-protein kinase pknE;     
  124::375     9e-21  30%  395 aa  STK6_MOUSE RecName: Full=Serine/threonine-protein kinase 6;        
   92::368     9e-21  29%  424 aa  KPSH1_MOUSE RecName: Full=Serine/threonine-protein kinase H1;      
   23::271     9e-21  31% 1080 aa  KIC1_YEAST RecName: Full=Serine/threonine-protein kinase KIC1;     
   15::263     9e-21  27%  343 aa  KCC1B_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   15::263     9e-21  27%  343 aa  KCC1B_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   25::265     1e-20  29%  426 aa  STK25_HUMAN RecName: Full=Serine/threonine-protein kinase 25;      
   25::265     1e-20  29%  426 aa  STK25_BOVIN RecName: Full=Serine/threonine-protein kinase 25;      
  366::607     1e-20  28%  642 aa  STE20_PENMA RecName: Full=Serine/threonine-protein kinase pakA;    
  634::887     1e-20  30%  914 aa  STE20_MAGGR RecName: Full=Serine/threonine-protein kinase MST20;   
  801::1048    1e-20  29% 1079 aa  STE20_DEBHA RecName: Full=Serine/threonine-protein kinase STE20;     
  108::281     2e-20  34%  443 aa  STK24_HUMAN RecName: Full=Serine/threonine-protein kinase 24;      
    4::289     2e-20  35%  933 aa  PKND_CHLAB RecName: Full=Serine/threonine-protein kinase pknD;     
   85::261     2e-20  35%  693 aa  PKN1_MYXXA RecName: Full=Serine/threonine-protein kinase pkn1;     
  295::541     2e-20  27%  572 aa  PAK1_CAEEL RecName: Full=Serine/threonine-protein kinase pak-1;    
    3::267     2e-20  29%  651 aa  MELK_HUMAN RecName: Full=Maternal embryonic leucine zipper kinase; 
   90::366     2e-20  28%  422 aa  KPSH1_DANRE RecName: Full=Serine/threonine-protein kinase H1
   32::276     2e-20  30% 1001 aa  TAO1A_XENLA RecName: Full=Serine/threonine-protein kinase TAO1-A;  
   25::265     2e-20  29%  426 aa  STK25_MOUSE RecName: Full=Serine/threonine-protein kinase 25;      
  844::1099    2e-20  29% 1125 aa  STE20_YARLI RecName: Full=Serine/threonine-protein kinase STE20;     
  126::377     3e-20  31%  397 aa  STK6_RAT RecName: Full=Serine/threonine-protein kinase 6;       
   96::269     3e-20  34%  431 aa  STK24_MOUSE RecName: Full=Serine/threonine-protein kinase 24;      
  956::1198    3e-20  28% 1228 aa  STE20_CANAL RecName: Full=Serine/threonine-protein kinase CST20;     
    9::255     3e-20  29%  471 aa  SID1_SCHPO RecName: Full=Serine/threonine-protein kinase sid1;     
   56::332     3e-20  31%  349 aa  MYLKG_DICDI RecName: Full=Probable myosin light chain kinase
   14::274     3e-20  28%  511 aa  CIPKD_ORYSJ RecName: Full=Putative CBL-interacting protein kinase
   98::359     3e-20  28%  551 aa  CDPKJ_ARATH RecName: Full=Calcium-dependent protein kinase 19;     
  663::909     3e-20  26%  916 aa  Y9955_DICDI RecName: Full=Probable serine/threonine-protein kinase
   32::276     3e-20  30% 1001 aa  TAOK1_RAT RecName: Full=Serine/threonine-protein kinase TAO1;      
   32::276     3e-20  30% 1001 aa  TAOK1_MOUSE RecName: Full=Serine/threonine-protein kinase TAO1;    
   32::276     3e-20  30% 1001 aa  TAOK1_HUMAN RecName: Full=Serine/threonine-protein kinase TAO1;    
   13::276     3e-20  29% 1001 aa  TAO1B_XENLA RecName: Full=Serine/threonine-protein kinase TAO1-B;  
   10::263     3e-20  28%  438 aa  CIPKW_ORYSJ RecName: Full=CBL-interacting protein kinase 32;       
  391::632     4e-20  28%  658 aa  STE20_SCHPO RecName: Full=Serine/threonine-protein kinase
  539::780     6e-20  28%  815 aa  STE20_ASPFU RecName: Full=Serine/threonine-protein kinase ste20;   
   10::263     6e-20  28%  454 aa  CIPKX_ORYSJ RecName: Full=CBL-interacting protein kinase 33;       
  373::615     8e-20  32%  639 aa  PAKM_DROME RecName: Full=Serine/threonine-protein kinase PAK mbt;  
  134::402     8e-20  31%  583 aa  CDPKK_ARATH RecName: Full=Calcium-dependent protein kinase 20;     
   25::281     8e-20  27%  974 aa  CDC15_YEAST RecName: Full=Cell division control protein 15;        
    4::276     1e-19  34%  930 aa  PKND_CHLCV RecName: Full=Serine/threonine-protein kinase pknD;     
  412::664     1e-19  30%  681 aa  PAK6_PONAB RecName: Full=Serine/threonine-protein kinase PAK 6;    
  412::664     1e-19  30%  681 aa  PAK6_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 6;    
   29::276     1e-19  26%  737 aa  DST1_DICDI RecName: Full=Serine/threonine-protein kinase dst1;     
   23::275     1e-19  29%  489 aa  CIPKC_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   19::268     1e-19  29%  288 aa  AUR3_ARATH RecName: Full=Serine/threonine-protein kinase Aurora-3; 
   16::277     1e-19  31%  820 aa  M4K2_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
    1::253     2e-19  26% 1263 aa  QSK_HUMAN RecName: Full=Serine/threonine-protein kinase QSK;       
   20::297     2e-19  24%  392 aa  MYLKB_DICDI RecName: Full=Probable myosin light chain kinase
  365::628     2e-19  30%  642 aa  DRKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   74::335     2e-19  27%  343 aa  AURKB_RAT RecName: Full=Serine/threonine-protein kinase 12;        
   13::266     2e-19  29%  941 aa  Y9877_DICDI RecName: Full=Serine/threonine-protein kinase
  698::944     2e-19  29%  989 aa  STE20_KLULA RecName: Full=Serine/threonine-protein kinase STE20;   
   16::268     2e-19  31%  821 aa  M4K2_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  340::615     2e-19  31%  662 aa  CRK16_ARATH RecName: Full=Putative cysteine-rich receptor-like
   57::287     3e-19  29%  385 aa  KPSH2_HUMAN RecName: Full=Serine/threonine-protein kinase H2;      
   19::272     4e-19  30%  898 aa  TAOK3_HUMAN RecName: Full=Serine/threonine-protein kinase TAO3;    
  572::813     4e-19  27%  848 aa  STE20_EMENI RecName: Full=Serine/threonine-protein kinase ste20;   
   13::222     4e-19  35%  756 aa  IKKB_BOVIN RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   13::276     5e-19  31% 1235 aa  TAOK2_RAT RecName: Full=Serine/threonine-protein kinase TAO2;      
   13::276     5e-19  31% 1055 aa  TAOK2_MOUSE RecName: Full=Serine/threonine-protein kinase TAO2;    
  129::378     5e-19  30%  407 aa  STK6_XENLA RecName: Full=Serine/threonine-protein kinase 6;        
  572::813     5e-19  28%  848 aa  STE20_ASPOR RecName: Full=Serine/threonine-protein kinase ste20;   
  679::877     5e-19  32%  971 aa  STE20_ASHGO RecName: Full=Serine/threonine-protein kinase STE20;   
    4::289     5e-19  34%  933 aa  PKND_CHLFF RecName: Full=Serine/threonine-protein kinase pknD;     
  176::433     5e-19  27%  942 aa  MKKA_DICDI RecName: Full=Mitogen-activated protein kinase kinase
   88::332     5e-19  25%  705 aa  CDC5_YEAST RecName: Full=Cell cycle serine/threonine-protein kinase
 1067::1319    6e-19  28% 1328 aa  YSK4_HUMAN RecName: Full=SPS1/STE20-related protein kinase YSK4;     
   13::276     6e-19  31% 1235 aa  TAOK2_HUMAN RecName: Full=Serine/threonine-protein kinase TAO2;    
    5::253     6e-19  26% 1311 aa  QSK_MOUSE RecName: Full=Serine/threonine-protein kinase QSK;       
   34::281     6e-19  29%  615 aa  PLK3_CAEEL RecName: Full=Serine/threonine-protein kinase plk-3;    
   13::222     6e-19  37%  757 aa  IKKB_MOUSE RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   13::222     6e-19  35%  756 aa  IKKB_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase
  354::642     6e-19  29%  654 aa  CRK40_ARATH RecName: Full=Cysteine-rich receptor-like protein
   25::277     6e-19  28%  483 aa  CIPKJ_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   54::314     6e-19  29%  528 aa  CDPKD_ARATH RecName: Full=Calcium-dependent protein kinase 13;     
   45::295     6e-19  25%  794 aa  BRSK1_HUMAN RecName: Full=BR serine/threonine-protein kinase 1;    
    4::209     8e-19  29% 1268 aa  STK36_MOUSE RecName: Full=Serine/threonine-protein kinase 36;      
    1::265     8e-19  27%  926 aa  SIK2_HUMAN RecName: Full=Serine/threonine-protein kinase SIK2;     
  413::665     8e-19  29%  682 aa  PAK6_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 6;    
   53::299     8e-19  24%  628 aa  NUAK2_PONAB RecName: Full=NUAK family SNF1-like kinase 2;       
   53::299     8e-19  24%  628 aa  NUAK2_HUMAN RecName: Full=NUAK family SNF1-like kinase 2;       
   13::271     8e-19  29%  282 aa  AURKC_MOUSE RecName: Full=Serine/threonine-protein kinase 13;      
   76::337     8e-19  27%  345 aa  AURKB_MOUSE RecName: Full=Serine/threonine-protein kinase 12;      
   30::290     1e-18  30%  576 aa  SNF1_SCHPO RecName: Full=SNF1-like protein kinase ssp2;       
    6::252     1e-18  27%  312 aa  PPK11_SCHPO RecName: Full=Serine/threonine-protein kinase ppk11;   
  419::682     1e-18  30%  714 aa  MKCB_DICDI RecName: Full=Probable serine/threonine-protein kinase
   13::222     1e-18  35%  757 aa  IKKB_RAT RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   71::290     1e-18  32%  520 aa  CIPKI_ARATH RecName: Full=CBL-interacting serine/threonine-protein
    6::272     1e-18  28%  435 aa  CIPKB_ARATH RecName: Full=CBL-interacting serine/threonine-protein
    3::264     1e-18  24%  736 aa  BRSK2_HUMAN RecName: Full=BR serine/threonine-protein kinase 2;    
  406::716     1e-18  30%  741 aa  WAK3_ARATH RecName: Full=Wall-associated receptor kinase 3;        
   56::275     1e-18  27% 1187 aa  QSK_DANRE RecName: Full=Serine/threonine-protein kinase QSK
    4::230     1e-18  35%  932 aa  PKND_CHLPN RecName: Full=Serine/threonine-protein kinase pknD;     
    4::286     1e-18  31%  529 aa  OXSR1_PIG RecName: Full=Serine/threonine-protein kinase OSR1;      
   67::313     1e-18  28%  436 aa  NIM1_HUMAN RecName: Full=Serine/threonine-protein kinase NIM1;     
   20::269     1e-18  27%  370 aa  KCC1A_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
  359::616     1e-18  30%  659 aa  CRK39_ARATH RecName: Full=Putative cysteine-rich receptor-like
  363::550     1e-18  31%  673 aa  CRK13_ARATH RecName: Full=Cysteine-rich receptor-like protein
  129::378     2e-18  29%  408 aa  STK6L_XENLA RecName: Full=Serine/threonine-protein kinase Eg2-like;
    3::276     2e-18  31%  521 aa  SPKA_SYNY3 RecName: Full=Serine/threonine-protein kinase A;        
  916::1107    2e-18  30% 1197 aa  PAKA_DICDI RecName: Full=Serine/threonine-protein kinase pakA;       
    4::286     2e-18  31%  527 aa  OXSR1_PONAB RecName: Full=Serine/threonine-protein kinase OSR1;    
    4::286     2e-18  31%  527 aa  OXSR1_HUMAN RecName: Full=Serine/threonine-protein kinase OSR1;    
   59::309     2e-18  30%  482 aa  KS6B2_HUMAN RecName: Full=Ribosomal protein S6 kinase beta-2;      
   31::284     2e-18  25%  335 aa  KCC1_SCHPO RecName: Full=Calcium/calmodulin-dependent protein
   32::276     2e-18  29% 1025 aa  TAOK2_XENLA RecName: Full=Serine/threonine-protein kinase TAO2;    
   72::341     2e-18  31%  553 aa  STK39_RAT RecName: Full=STE20/SPS1-related proline-alanine-rich
   75::344     2e-18  31%  556 aa  STK39_MOUSE RecName: Full=STE20/SPS1-related proline-alanine-rich
   65::334     2e-18  31%  547 aa  STK39_HUMAN RecName: Full=STE20/SPS1-related proline-alanine-rich
    9::272     2e-18  25%  779 aa  SIK1_MOUSE RecName: Full=Serine/threonine-protein kinase SIK1;     
   51::285     2e-18  31%  982 aa  PKND_PARUW RecName: Full=Serine/threonine-protein kinase pknD;     
    4::286     2e-18  31%  527 aa  OXSR1_MOUSE RecName: Full=Serine/threonine-protein kinase OSR1;    
   67::313     2e-18  28%  436 aa  NIM1_MOUSE RecName: Full=Serine/threonine-protein kinase NIM1;     
    4::259     2e-18  28%  418 aa  NEK2_DICDI RecName: Full=Probable serine/threonine-protein kinase
   17::267     2e-18  28%  643 aa  MELK_MOUSE RecName: Full=Maternal embryonic leucine zipper kinase; 
  392::644     2e-18  30%  690 aa  DRKB_DICDI RecName: Full=Probable serine/threonine-protein kinase
   10::265     2e-18  24%  735 aa  BRSK2_MOUSE RecName: Full=BR serine/threonine-protein kinase 2;    
  107::355     2e-18  28%  384 aa  AURK_DICDI RecName: Full=Probable serine/threonine-protein kinase
   61::332     2e-18  26%  344 aa  AURKB_BOVIN RecName: Full=Serine/threonine-protein kinase 12;      
    1::259     3e-18  27%  931 aa  SIK2_MOUSE RecName: Full=Serine/threonine-protein kinase SIK2;     
  402::641     3e-18  27%  677 aa  MKCF_DICDI RecName: Full=Probable serine/threonine-protein kinase
   47::284     3e-18  29%  476 aa  KCC1G_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   47::284     3e-18  29%  477 aa  KCC1G_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
  345::543     3e-18  31%  646 aa  CRK37_ARATH RecName: Full=Cysteine-rich receptor-like protein
   22::275     3e-18  27%  429 aa  CIPK7_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   59::319     3e-18  28%  535 aa  CDPK7_ARATH RecName: Full=Calcium-dependent protein kinase 7;      
   85::355     3e-18  24%  355 aa  ARK1_SCHPO RecName: Full=Serine/threonine-protein kinase ark1;     
  397::601     4e-18  31%  732 aa  WAK2_ARATH RecName: Full=Wall-associated receptor kinase 2;        
  409::710     4e-18  29%  735 aa  WAK1_ARATH RecName: Full=Wall-associated receptor kinase 1;        
   19::272     4e-18  29%  898 aa  TAOK3_PONAB RecName: Full=Serine/threonine-protein kinase TAO3;    
    9::272     4e-18  25%  776 aa  SIK1_RAT RecName: Full=Serine/threonine-protein kinase SIK1;       
  204::467     4e-18  29%  821 aa  RAD53_YEAST RecName: Full=Serine/threonine-protein kinase RAD53;   
  153::392     4e-18  28%  479 aa  PK2_DICDI RecName: Full=Protein kinase 2;         Short=PK2;       
    8::266     4e-18  26%  295 aa  MYLKA_DICDI RecName: Full=Myosin light chain kinase A;       
  293::491     4e-18  33%  660 aa  MP2K1_DICDI RecName: Full=Dual specificity mitogen-activated
   47::284     4e-18  28%  476 aa  KCC1G_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   20::269     4e-18  26%  374 aa  KCC1A_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   20::269     4e-18  26%  374 aa  KCC1A_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   15::308     4e-18  29%  453 aa  CIPKO_ORYSJ RecName: Full=CBL-interacting protein kinase 24;       
   18::272     4e-18  29%  426 aa  CIPK4_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   10::208     5e-18  32%  706 aa  ZYG1_CAEEL RecName: Full=Probable serine/threonine-protein kinase
  423::634     5e-18  28%  642 aa  WAKLF_ARATH RecName: Full=Wall-associated receptor kinase-like 6;  
  662::907     5e-18  28% 1331 aa  M3K15_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  340::538     5e-18  29%  658 aa  CRK36_ARATH RecName: Full=Cysteine-rich receptor-like protein
   31::279     5e-18  25%  778 aa  BRSK1_MOUSE RecName: Full=BR serine/threonine-protein kinase 1;    
   30::280     7e-18  29%  896 aa  TAOK3_XENLA RecName: Full=Serine/threonine-protein kinase TAO3;    
    1::265     7e-18  26%  925 aa  SIK2_PONAB RecName: Full=Serine/threonine-protein kinase SIK2;     
    9::267     7e-18  30%  564 aa  PKNA_ANASP RecName: Full=Serine/threonine-protein kinase pknA;     
  613::866     9e-18  27%  939 aa  STE20_YEAST RecName: Full=Serine/threonine-protein kinase STE20;   
  130::403     9e-18  30%  652 aa  SSP1_SCHPO RecName: Full=Serine/threonine-protein kinase ssp1;     
  333::548     9e-18  29%  665 aa  CRK26_ARATH RecName: Full=Cysteine-rich receptor-like protein
   71::341     9e-18  26%  532 aa  CDPK_DAUCA RecName: Full=Calcium-dependent protein kinase;       
   35::291     9e-18  29%  488 aa  CDC5_ENCCU RecName: Full=Probable cell cycle
   84::344     9e-18  27%  626 aa  AAPK2_CAEEL RecName: Full=5'-AMP-activated protein kinase catalytic
    1::257     1e-17  26%  478 aa  SVKA_DICDI RecName: Full=Serine/threonine-protein kinase svkA;     
  454::695     1e-17  30%  719 aa  PAK7_HUMAN RecName: Full=Serine/threonine-protein kinase PAK 7;    
   13::212     1e-17  34%  743 aa  IKKA_XENLA RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   85::345     1e-17  27%  534 aa  CDPKT_ARATH RecName: Full=Calcium-dependent protein kinase 29;     
   67::340     1e-17  29%  340 aa  BYR1_SCHPO RecName: Full=Protein kinase byr1;       
   30::272     2e-17  28%  898 aa  TAOK3_RAT RecName: Full=Serine/threonine-protein kinase TAO3;      
   30::272     2e-17  29%  898 aa  TAOK3_MOUSE RecName: Full=Serine/threonine-protein kinase TAO3;    
   27::284     2e-17  29%  595 aa  PLK5_MOUSE RecName: Full=Serine/threonine-protein kinase PLK5;     
   29::269     2e-17  27%  416 aa  MST4_MOUSE RecName: Full=Serine/threonine-protein kinase MST4;     
   29::269     2e-17  27%  416 aa  MST4_HUMAN RecName: Full=Serine/threonine-protein kinase MST4;     
  655::902     2e-17  32% 1291 aa  M3K6_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
   14::265     2e-17  26%  527 aa  KCC2G_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   14::265     2e-17  26%  529 aa  KCC2G_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   14::265     2e-17  26%  558 aa  KCC2G_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   13::221     2e-17  32%  743 aa  IKKA_XENTR RecName: Full=Inhibitor of nuclear factor kappa-B kinase
  323::530     2e-17  31%  615 aa  CRK1_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase
   12::275     2e-17  29%  461 aa  CIPK5_ORYSJ RecName: Full=CBL-interacting protein kinase 5;        
   85::345     2e-17  26%  533 aa  CDPK2_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform
   82::306     2e-17  30%  360 aa  AURKB_XENTR RecName: Full=Serine/threonine-protein kinase 12;      
   27::274     2e-17  29%  305 aa  AIR2_CAEEL RecName: Full=Aurora/Ipl1-related protein kinase 2;     
  401::607     2e-17  30%  738 aa  WAK4_ARATH RecName: Full=Wall-associated receptor kinase 4;        
  473::678     2e-17  32%  834 aa  PUB33_ARATH RecName: Full=U-box domain-containing protein
  454::695     2e-17  30%  719 aa  PAK7_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 7;    
   59::309     2e-17  29%  485 aa  KS6B2_MOUSE RecName: Full=Ribosomal protein S6 kinase beta-2;      
  191::383     2e-17  33%  459 aa  IRAK4_MOUSE RecName: Full=Interleukin-1 receptor-associated kinase
  680::878     2e-17  27%  971 aa  CLA4_CANAL RecName: Full=Serine/threonine-protein kinase CLA4;     
   16::269     2e-17  27%  447 aa  CIPK9_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   59::319     2e-17  30%  541 aa  CDPKU_ARATH RecName: Full=Calcium-dependent protein kinase 30;     
   62::325     2e-17  29%  535 aa  CDPK5_SOLTU RecName: Full=Calcium-dependent protein kinase 5;      
   40::288     2e-17  28%  309 aa  AURKC_HUMAN RecName: Full=Serine/threonine-protein kinase 13;      
   61::315     2e-17  27%  344 aa  AURKB_PIG RecName: Full=Serine/threonine-protein kinase 12;        
   12::272     3e-17  25%  783 aa  SIK1_HUMAN RecName: Full=Serine/threonine-protein kinase SIK1;     
   38::293     3e-17  30%  312 aa  MYLKC_DICDI RecName: Full=Probable myosin light chain kinase
  192::386     3e-17  31%  461 aa  IRAK4_BOVIN RecName: Full=Interleukin-1 receptor-associated kinase
  339::537     3e-17  31%  648 aa  CRK38_ARATH RecName: Full=Cysteine-rich receptor-like protein
   17::280     3e-17  26%  449 aa  CIPKV_ORYSJ RecName: Full=CBL-interacting protein kinase 31;       
    8::278     4e-17  26%  472 aa  ULK3_HUMAN RecName: Full=Serine/threonine-protein kinase ULK3;     
   30::272     4e-17  28%  898 aa  TAOK3_CHICK RecName: Full=Serine/threonine-protein kinase TAO3;    
   57::303     4e-17  24%  630 aa  NUAK2_RAT RecName: Full=NUAK family SNF1-like kinase 2;       
   18::281     4e-17  28% 1037 aa  KCC4_YEAST RecName: Full=Probable serine/threonine-protein kinase
   89::352     4e-17  27%  574 aa  FRAY1_DICDI RecName: Full=Serine/threonine-protein kinase fray1;   
  218::472     4e-17  24%  595 aa  FHKC_DICDI RecName: Full=Probable serine/threonine-protein kinase
  317::504     4e-17  31%  636 aa  CRK24_ARATH RecName: Full=Cysteine-rich receptor-like protein
    8::282     4e-17  29%  446 aa  CIPKO_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   49::330     4e-17  27%  582 aa  CDPKO_ARATH RecName: Full=Calcium-dependent protein kinase 24;     
   75::338     4e-17  28%  544 aa  CDPK6_ARATH RecName: Full=Calcium-dependent protein kinase 6;      
   84::347     4e-17  30%  557 aa  CDPK4_SOLTU RecName: Full=Calcium-dependent protein kinase 4;      
   55::318     4e-17  26%  513 aa  CDPK2_MAIZE RecName: Full=Calcium-dependent protein kinase 2;      
   29::245     4e-17  30%  311 aa  CC2H3_TRYBB RecName: Full=Cell division control protein 2 homolog
   97::338     4e-17  27%  368 aa  AUKBB_XENLA RecName: Full=Serine/threonine-protein kinase 12-B;    
   22::278     4e-17  28%  727 aa  AMPKA_DICDI RecName: Full=5'-AMP-activated serine/threonine-protein
   24::271     4e-17  28%  302 aa  AIR2_CAEBR RecName: Full=Aurora/Ipl1-related protein kinase 2;     
   86::333     5e-17  29%  411 aa  Y1639_DICDI RecName: Full=Probable serine/threonine-protein kinase
   44::261     5e-17  33%  495 aa  SPKF_SYNY3 RecName: Full=Serine/threonine-protein kinase F;        
   36::294     5e-17  28%  612 aa  SNF1_CANGA RecName: Full=Carbon catabolite-derepressing protein
   16::268     5e-17  29%  873 aa  M4K3_RAT RecName: Full=Mitogen-activated protein kinase kinase
  186::401     5e-17  29%  467 aa  M3K8_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  172::393     5e-17  29% 1064 aa  KIN1_YEAST RecName: Full=Serine/threonine protein kinase KIN1;     
   57::334     5e-17  28%  533 aa  CDPK8_ARATH RecName: Full=Calcium-dependent protein kinase 8;      
  150::409     5e-17  31%  610 aa  CDPK1_ARATH RecName: Full=Calcium-dependent protein kinase 1;      
  328::569     6e-17  30%  593 aa  PAK4_MOUSE RecName: Full=Serine/threonine-protein kinase PAK 4;    
   16::268     6e-17  29%  894 aa  M4K3_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  186::401     6e-17  28%  467 aa  M3K8_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  658::903     6e-17  28% 1313 aa  M3K15_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  117::370     6e-17  25%  444 aa  KRAC_DICDI RecName: Full=RAC family serine/threonine-protein kinase
  333::541     6e-17  32%  642 aa  CRK27_ARATH RecName: Full=Cysteine-rich receptor-like protein
  186::445     6e-17  27%  646 aa  CDPK2_ARATH RecName: Full=Calcium-dependent protein kinase 2;      
  400::654     6e-17  29%  659 aa  BYR2_SCHPO RecName: Full=Protein kinase byr2;       
   13::273     6e-17  27%  552 aa  AAPK2_MOUSE RecName: Full=5'-AMP-activated protein kinase catalytic
   30::224     8e-17  27%  485 aa  STK4_XENLA RecName: Full=Serine/threonine-protein kinase 4;        
   51::311     8e-17  28%  633 aa  SNF1_YEAST RecName: Full=Carbon catabolite-derepressing protein
   50::298     8e-17  25%  423 aa  PPK25_SCHPO RecName: Full=Serine/threonine-protein kinase ppk25;   
    2::264     8e-17  29%  613 aa  PKPA_PHYBL RecName: Full=Serine/threonine-protein kinase pkpA;     
    4::236     8e-17  32%  934 aa  PKND_CHLTR RecName: Full=Serine/threonine-protein kinase pknD;     
    4::236     8e-17  32%  934 aa  PKND_CHLTA RecName: Full=Serine/threonine-protein kinase pknD;     
   57::311     8e-17  25%  639 aa  NUAK2_MOUSE RecName: Full=NUAK family SNF1-like kinase 2;       
   20::275     8e-17  28%  847 aa  M4K5_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  186::401     8e-17  28%  467 aa  M3K8_RAT RecName: Full=Mitogen-activated protein kinase kinase
   16::284     8e-17  28% 1142 aa  GIN4_YEAST RecName: Full=Serine/threonine-protein kinase GIN4;     
   68::318     8e-17  26%  857 aa  DLK1_CAEBR RecName: Full=Mitogen-activated protein kinase kinase
   10::263     8e-17  27%  439 aa  CIPKQ_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   85::321     8e-17  29%  525 aa  CIPKL_ORYSJ RecName: Full=CBL-interacting protein kinase 21;       
   14::277     8e-17  26%  484 aa  CDPKQ_ARATH RecName: Full=Calcium-dependent protein kinase 26;     
   68::343     8e-17  29%  529 aa  CDPK3_ARATH RecName: Full=Calcium-dependent protein kinase 3;      
   50::291     8e-17  27%  320 aa  AURKB_DANRE RecName: Full=Serine/threonine-protein kinase 12;      
   90::306     8e-17  29%  361 aa  AUKBA_XENLA RecName: Full=Serine/threonine-protein kinase 12-A;    
   13::273     8e-17  27%  552 aa  AAPK2_PONAB RecName: Full=5'-AMP-activated protein kinase catalytic
   13::273     8e-17  27%  552 aa  AAPK2_HUMAN RecName: Full=5'-AMP-activated protein kinase catalytic
   21::282     8e-17  27%  589 aa  AAPK1_CAEEL RecName: Full=5'-AMP-activated protein kinase catalytic
    3::261     1e-16  28%  273 aa  TSSK6_MOUSE RecName: Full=Testis-specific serine/threonine-protein
   30::224     1e-16  29%  487 aa  STK4_PAPAN RecName: Full=Serine/threonine-protein kinase 4;        
   30::224     1e-16  29%  487 aa  STK4_AOTNA RecName: Full=Serine/threonine-protein kinase 4;        
    2::270     1e-16  27%  746 aa  SNRK_RAT RecName: Full=SNF-related serine/threonine-protein kinase;
    2::270     1e-16  27%  748 aa  SNRK_MOUSE RecName: Full=SNF-related serine/threonine-protein
    2::263     1e-16  27%  765 aa  SNRK_HUMAN RecName: Full=SNF-related serine/threonine-protein
    4::236     1e-16  32%  934 aa  PKND_CHLTB RecName: Full=Serine/threonine-protein kinase pknD;     
    4::236     1e-16  32%  934 aa  PKND_CHLT2 RecName: Full=Serine/threonine-protein kinase pknD;     
    4::236     1e-16  32%  934 aa  PKND_CHLMU RecName: Full=Serine/threonine-protein kinase pknD;     
  227::495     1e-16  27%  508 aa  MKK1_YEAST RecName: Full=MAP kinase kinase MKK1/SSP32;       
   20::275     1e-16  28%  846 aa  M4K5_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  654::901     1e-16  31% 1288 aa  M3K6_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  125::345     1e-16  28%  361 aa  IPL1_KLULA RecName: Full=Spindle assembly checkpoint kinase;       
   20::271     1e-16  26% 1142 aa  DST2_DICDI RecName: Full=Serine/threonine-protein kinase dst2;     
  318::522     1e-16  29%  649 aa  CRK2_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase
  546::820     1e-16  28%  842 aa  CLA4_YEAST RecName: Full=Serine/threonine-protein kinase CLA4;     
    9::260     1e-16  25%  416 aa  CIPKL_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   10::260     1e-16  27%  446 aa  CIPK8_ORYSJ RecName: Full=CBL-interacting protein kinase 8;        
   45::331     1e-16  27%  530 aa  CDPKE_ARATH RecName: Full=Calcium-dependent protein kinase 14;     
  311::592     1e-16  30%  606 aa  ARAF_PIG RecName: Full=A-Raf proto-oncogene
  311::592     1e-16  30%  606 aa  ARAF_HUMAN RecName: Full=A-Raf proto-oncogene
   13::273     1e-16  27%  552 aa  AAPK2_PIG RecName: Full=5'-AMP-activated protein kinase catalytic
  412::622     1e-16  27%  751 aa  WAKLI_ARATH RecName: Full=Wall-associated receptor kinase-like 22; 
  416::697     1e-16  27%  761 aa  WAKLD_ARATH RecName: Full=Wall-associated receptor kinase-like 4;  
   30::224     1e-16  29%  487 aa  STK4_COLGU RecName: Full=Serine/threonine-protein kinase 4;        
   30::276     1e-16  27%  487 aa  STK4_BOVIN RecName: Full=Serine/threonine-protein kinase 4;        
   24::274     1e-16  30%  640 aa  SMKX_MOUSE RecName: Full=Sperm motility kinase X;       
   20::271     1e-16  28%  798 aa  SIK2_CHICK RecName: Full=Serine/threonine-protein kinase SIK2;     
    1::284     1e-16  30%  387 aa  PHKG1_RABIT RecName: Full=Phosphorylase b kinase gamma catalytic
  166::386     1e-16  27% 1192 aa  PAR1_CAEEL RecName: Full=Serine/threonine-protein kinase par-1;    
  124::344     1e-16  27% 1088 aa  PAR1_CAEBR RecName: Full=Serine/threonine-protein kinase par-1;    
   51::305     1e-16  27%  752 aa  MARK4_MOUSE RecName: Full=MAP/microtubule affinity-regulating
   51::305     1e-16  27%  752 aa  MARK4_HUMAN RecName: Full=MAP/microtubule affinity-regulating
  158::381     1e-16  30% 1147 aa  KIN2_YEAST RecName: Full=Serine/threonine-protein kinase KIN2;     
   14::265     1e-16  27%  542 aa  KCC2B_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   14::265     1e-16  27%  542 aa  KCC2B_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   14::265     1e-16  27%  664 aa  KCC2B_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   15::221     1e-16  33%  745 aa  IKKA_MOUSE RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   58::324     1e-16  26%  714 aa  HUNK_PANTR RecName: Full=Hormonally up-regulated neu
   58::324     1e-16  26%  714 aa  HUNK_HUMAN RecName: Full=Hormonally up-regulated neu
  300::519     1e-16  32%  636 aa  CRK33_ARATH RecName: Full=Putative cysteine-rich receptor-like
  309::590     1e-16  30%  604 aa  ARAF_RAT RecName: Full=A-Raf proto-oncogene
  309::590     1e-16  30%  604 aa  ARAF_MOUSE RecName: Full=A-Raf proto-oncogene
   13::273     1e-16  27%  552 aa  AAPK2_RAT RecName: Full=5'-AMP-activated protein kinase catalytic
   53::298     1e-16  29%  559 aa  AAPK1_RAT RecName: Full=5'-AMP-activated protein kinase catalytic
   48::293     1e-16  29%  554 aa  AAPK1_PONAB RecName: Full=5'-AMP-activated protein kinase catalytic
   53::298     1e-16  29%  559 aa  AAPK1_HUMAN RecName: Full=5'-AMP-activated protein kinase catalytic
   33::282     2e-16  27%  901 aa  YP150_YEAST RecName: Full=Putative serine/threonine-protein kinase
  423::632     2e-16  28%  731 aa  WAKLE_ARATH RecName: Full=Wall-associated receptor kinase-like 5;  
  524::786     2e-16  27%  856 aa  TTK_MACFA RecName: Full=Dual specificity protein kinase TTK;       
  525::787     2e-16  27%  857 aa  TTK_HUMAN RecName: Full=Dual specificity protein kinase TTK;       
   30::224     2e-16  29%  487 aa  STK4_OTOGA RecName: Full=Serine/threonine-protein kinase 4;        
   30::224     2e-16  29%  487 aa  STK4_MOUSE RecName: Full=Serine/threonine-protein kinase 4;        
   30::224     2e-16  29%  487 aa  STK4_MACMU RecName: Full=Serine/threonine-protein kinase 4;        
   30::224     2e-16  29%  487 aa  STK4_LEMCA RecName: Full=Serine/threonine-protein kinase 4;        
   30::224     2e-16  29%  487 aa  STK4_HUMAN RecName: Full=Serine/threonine-protein kinase 4;        
   30::224     2e-16  29%  487 aa  STK4_CERAE RecName: Full=Serine/threonine-protein kinase 4;        
   47::291     2e-16  24%  683 aa  PLO1_SCHPO RecName: Full=Serine/threonine-protein kinase plo1;     
  220::417     2e-16  32%  493 aa  PAKC_DICDI RecName: Full=Serine/threonine-protein kinase pakC;     
    4::254     2e-16  27%  697 aa  NEK8_DANRE RecName: Full=Serine/threonine-protein kinase Nek8;     
  363::572     2e-16  29%  691 aa  LRKA3_ARATH RecName: Full=Lectin-domain containing receptor kinase
   58::329     2e-16  27%  523 aa  CDPKY_ARATH RecName: Full=Calcium-dependent protein kinase 34;     
   80::339     2e-16  25%  531 aa  CDPKL_ARATH RecName: Full=Calcium-dependent protein kinase 21;     
   19::279     2e-16  28%  282 aa  AUR2_ARATH RecName: Full=Serine/threonine-protein kinase Aurora-2; 
   99::305     2e-16  29%  433 aa  WAKLS_ARATH RecName: Full=Putative wall-associated receptor
   24::266     2e-16  28%  654 aa  SMK_RAT RecName: Full=Sperm motility kinase;         EC=2.7.11.-;
    1::284     2e-16  29%  387 aa  PHKG1_HUMAN RecName: Full=Phosphorylase b kinase gamma catalytic
  179::368     2e-16  39%  636 aa  PDPK1_CAEEL RecName: Full=3-phosphoinositide-dependent protein
   16::268     2e-16  28%  894 aa  M4K3_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  174::414     2e-16  26%  966 aa  M3K13_PONAB RecName: Full=Mitogen-activated protein kinase kinase
  191::385     2e-16  32%  460 aa  IRAK4_HUMAN RecName: Full=Interleukin-1 receptor-associated kinase
   15::221     2e-16  33%  745 aa  IKKA_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase
    4::249     2e-16  27%  805 aa  FUSED_DROME RecName: Full=Serine/threonine-protein kinase fused;   
    9::265     2e-16  29%  404 aa  CIPKR_ORYSJ RecName: Full=Putative CBL-interacting protein kinase
   34::285     2e-16  27%  488 aa  CIPKP_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   28::281     2e-16  26%  482 aa  CIPKN_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   63::334     2e-16  28%  528 aa  CDPKH_ARATH RecName: Full=Calcium-dependent protein kinase 17;     
  420::629     3e-16  28%  730 aa  WAKLA_ARATH RecName: Full=Wall-associated receptor kinase-like 1;  
    8::278     3e-16  26%  472 aa  ULK3_MOUSE RecName: Full=Serine/threonine-protein kinase ULK3;     
   20::268     3e-16  28%  461 aa  STK4_DICDI RecName: Full=Serine/threonine-protein kinase 4 homolog
   14::256     3e-16  28%  499 aa  SMKW_MOUSE RecName: Full=Sperm motility kinase W;       
  693::940     3e-16  28% 1380 aa  M3K5_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  686::933     3e-16  28% 1374 aa  M3K5_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  581::833     3e-16  30%  889 aa  KPCD3_MOUSE RecName: Full=Serine/threonine-protein kinase D3;      
   19::272     3e-16  30%  456 aa  CIPKG_ORYSJ RecName: Full=CBL-interacting protein kinase 16;       
    5::233     3e-16  26%  441 aa  CIPK3_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   54::340     3e-16  28%  538 aa  CDPKW_ARATH RecName: Full=Calcium-dependent protein kinase 32;     
   75::350     3e-16  29%  666 aa  ANP1_ARATH RecName: Full=Mitogen-activated protein kinase kinase
  420::628     4e-16  28%  730 aa  WAKLC_ARATH RecName: Full=Wall-associated receptor kinase-like 3;  
 1037::1310    4e-16  31% 1331 aa  SSK22_YEAST RecName: Full=Serine/threonine-protein kinase SSK22;     
   42::305     4e-16  25%  773 aa  MRKC_DICDI RecName: Full=Probable serine/threonine-protein kinase
   52::302     4e-16  27%  797 aa  MARK3_RAT RecName: Full=MAP/microtubule affinity-regulating kinase
   52::302     4e-16  27%  753 aa  MARK3_MOUSE RecName: Full=MAP/microtubule affinity-regulating
  173::413     4e-16  25%  959 aa  M3K13_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  174::414     4e-16  25%  966 aa  M3K13_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
   83::335     4e-16  29%  525 aa  KS6B1_RAT RecName: Full=Ribosomal protein S6 kinase beta-1;        
   83::335     4e-16  29%  525 aa  KS6B1_RABIT RecName: Full=Ribosomal protein S6 kinase beta-1;      
   83::335     4e-16  29%  525 aa  KS6B1_MOUSE RecName: Full=Ribosomal protein S6 kinase beta-1;      
   83::335     4e-16  29%  525 aa  KS6B1_HUMAN RecName: Full=Ribosomal protein S6 kinase beta-1;      
   83::335     4e-16  29%  527 aa  KS6B1_BOVIN RecName: Full=Ribosomal protein S6 kinase beta-1;      
   15::221     4e-16  33%  740 aa  IKKA_BOVIN RecName: Full=Inhibitor of nuclear factor kappa-B kinase
  358::632     4e-16  30%  676 aa  CRK8_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase
  349::542     4e-16  31%  666 aa  CRK20_ARATH RecName: Full=Putative cysteine-rich receptor-like
  498::719     4e-16  29%  793 aa  CLA4_ASHGO RecName: Full=Serine/threonine-protein kinase CLA4;     
  399::683     5e-16  29%  733 aa  WAK5_ARATH RecName: Full=Wall-associated receptor kinase 5;        
    8::266     5e-16  28%  468 aa  ULK3_CHICK RecName: Full=Serine/threonine-protein kinase ULK3;     
   49::308     5e-16  28%  619 aa  SNF1_CANTR RecName: Full=Carbon catabolite-derepressing protein
    6::94      5e-16  32%  380 aa  PKN5_MYXXA RecName: Full=Serine/threonine-protein kinase pkn5;     
   56::301     5e-16  24%  658 aa  NUAK1_MOUSE RecName: Full=NUAK family SNF1-like kinase 1;       
   56::306     5e-16  26%  795 aa  MARK1_HUMAN RecName: Full=Serine/threonine-protein kinase MARK1;   
   17::270     5e-16  27%  833 aa  M4K1_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  368::617     5e-16  26%  626 aa  M3K3_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
   23::272     5e-16  25%  385 aa  KCC1D_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   23::272     5e-16  25%  385 aa  KCC1D_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
  118::281     5e-16  32%  351 aa  KAPCG_HUMAN RecName: Full=cAMP-dependent protein kinase catalytic
  356::630     5e-16  31%  674 aa  CRK6_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase
   52::256     5e-16  30%  775 aa  CDR2_SCHPO RecName: Full=Mitosis inducer protein kinase cdr2;      
    9::252     5e-16  28%  593 aa  CDR1_SCHPO RecName: Full=Mitosis inducer protein kinase cdr1;      
  192::393     5e-16  29%  520 aa  CDPKP_ARATH RecName: Full=Calcium-dependent protein kinase 25;     
   53::298     5e-16  28%  559 aa  AAPK1_MOUSE RecName: Full=5'-AMP-activated protein kinase catalytic
  782::1012    7e-16  28% 1385 aa  Y9956_DICDI RecName: Full=Probable serine/threonine-protein kinase
  792::995     7e-16  32% 1141 aa  RCH2_ARATH RecName: Full=Receptor-like protein kinase 2;       
   69::333     7e-16  28%  359 aa  MOS_XENLA RecName: Full=Serine/threonine-protein kinase mos;       
  435::695     7e-16  30%  715 aa  MKCE_DICDI RecName: Full=Probable serine/threonine-protein kinase
   17::270     7e-16  28%  827 aa  M4K1_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  582::834     7e-16  29%  890 aa  KPCD3_HUMAN RecName: Full=Serine/threonine-protein kinase D3;      
   28::281     7e-16  27% 1094 aa  KINX_DICDI RecName: Full=Probable serine/threonine-protein kinase
   31::286     7e-16  27%  474 aa  KCC4_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   14::265     7e-16  27%  542 aa  KCC2B_BOVIN RecName: Full=Calcium/calmodulin-dependent protein
   14::265     7e-16  25%  530 aa  KCC2A_DROME RecName: Full=Calcium/calmodulin-dependent protein
   23::284     7e-16  26%  414 aa  KCC1_EMENI RecName: Full=Calcium/calmodulin-dependent protein
   27::235     7e-16  33%  759 aa  IKKA_CHICK RecName: Full=Inhibitor of nuclear factor kappa-B kinase
 1351::1550    7e-16  30% 1620 aa  GDT4_DICDI RecName: Full=Probable serine/threonine-protein kinase
  343::601     7e-16  27%  619 aa  DCLK3_MOUSE RecName: Full=Serine/threonine-protein kinase DCLK3;   
  356::549     7e-16  32%  676 aa  CRK4_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase
   87::350     7e-16  28%  556 aa  CDPK5_ARATH RecName: Full=Calcium-dependent protein kinase 5;      
  408::616     9e-16  26%  748 aa  WAKLB_ARATH RecName: Full=Wall-associated receptor kinase-like 2;  
   32::226     9e-16  28%  491 aa  STK4_SQUAC RecName: Full=Serine/threonine-protein kinase 3/4;      
   26::272     9e-16  27%  493 aa  STK3_XENLA RecName: Full=Serine/threonine-protein kinase 3;        
   37::291     9e-16  27%  371 aa  ST17B_RAT RecName: Full=Serine/threonine-protein kinase 17B;       
   46::290     9e-16  28%  473 aa  KCC4_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   14::265     9e-16  25%  533 aa  KCC2D_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   14::265     9e-16  25%  533 aa  KCC2D_RABIT RecName: Full=Calcium/calmodulin-dependent protein
   14::265     9e-16  25%  499 aa  KCC2D_PIG RecName: Full=Calcium/calmodulin-dependent protein kinase
   14::265     9e-16  25%  499 aa  KCC2D_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   14::265     9e-16  25%  499 aa  KCC2D_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   14::265     9e-16  25%  488 aa  KCC2D_BOVIN RecName: Full=Calcium/calmodulin-dependent protein
  923::1120    9e-16  30% 1192 aa  EXS_ARATH RecName: Full=Leucine-rich repeat receptor protein kinase
   63::323     9e-16  28%  545 aa  CDPKA_ARATH RecName: Full=Calcium-dependent protein kinase 10;     
    6::256     1e-15  26%  833 aa  Y7165_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1452::1628    1e-15  27% 1634 aa  Y1199_DICDI RecName: Full=Probable serine/threonine-protein kinase
    3::261     1e-15  27%  273 aa  TSSK6_HUMAN RecName: Full=Testis-specific serine/threonine-protein
   30::224     1e-15  27%  485 aa  STK4_XENTR RecName: Full=Serine/threonine-protein kinase 4;        
   26::272     1e-15  27%  492 aa  STK3_DANRE RecName: Full=Serine/threonine-protein kinase 3;        
   48::297     1e-15  27%  397 aa  ST17A_RABIT RecName: Full=Serine/threonine-protein kinase 17A;     
   18::216     1e-15  31%  490 aa  SPS1_YEAST RecName: Full=Sporulation-specific protein 1;       
  360::654     1e-15  26%  655 aa  SKM1_YEAST RecName: Full=Serine/threonine-protein kinase SKM1;     
  399::641     1e-15  26% 1176 aa  PAKF_DICDI RecName: Full=Serine/threonine-protein kinase pakF;     
   49::299     1e-15  26%  776 aa  MARK2_MOUSE RecName: Full=Serine/threonine-protein kinase MARK2;   
  368::617     1e-15  26%  626 aa  M3K3_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  270::511     1e-15  28%  583 aa  KDC2_DROME RecName: Full=Protein kinase DC2;         EC=2.7.11.1;
   42::286     1e-15  28%  469 aa  KCC4_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   13::282     1e-15  26%  478 aa  KCC2A_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   13::282     1e-15  26%  478 aa  KCC2A_PONAB RecName: Full=Calcium/calmodulin-dependent protein
   13::282     1e-15  26%  478 aa  KCC2A_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
   13::282     1e-15  26%  478 aa  KCC2A_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   13::222     1e-15  30%  758 aa  IKKA_DANRE RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   58::324     1e-15  25%  714 aa  HUNK_MOUSE RecName: Full=Hormonally up-regulated neu
   22::271     1e-15  25%  960 aa  GEFX_DICDI RecName: Full=RasGEF domain-containing
  141::388     1e-15  25%  928 aa  DLK1_CAEEL RecName: Full=Mitogen-activated protein kinase kinase
  306::512     1e-15  28%  651 aa  CRK42_ARATH RecName: Full=Cysteine-rich receptor-like protein
  351::547     1e-15  30%  700 aa  CRK30_ARATH RecName: Full=Putative cysteine-rich receptor-like
  357::565     1e-15  31%  679 aa  CRK29_ARATH RecName: Full=Cysteine-rich receptor-like protein
   72::332     1e-15  26%  513 aa  CDPK2_PLAFK RecName: Full=Calcium-dependent protein kinase 2;      
   72::332     1e-15  26%  509 aa  CDPK2_PLAF7 RecName: Full=Calcium-dependent protein kinase 2;      
   28::291     1e-15  27%  294 aa  AUR1_ARATH RecName: Full=Serine/threonine-protein kinase Aurora-1; 
   30::312     1e-15  31%  982 aa  SULU_CAEEL RecName: Full=Serine/threonine-protein kinase SULU;     
   27::221     1e-15  28%  491 aa  STK3_RAT RecName: Full=Serine/threonine-protein kinase 3;       
    8::258     1e-15  29%  484 aa  SMK2B_MOUSE RecName: Full=Sperm motility kinase 2B;       
  406::655     1e-15  27%  824 aa  SCH9_YEAST RecName: Full=Serine/threonine-protein kinase SCH9;     
   55::300     1e-15  24%  661 aa  NUAK1_HUMAN RecName: Full=NUAK family SNF1-like kinase 1;       
  177::407     1e-15  26%  961 aa  M313B_XENLA RecName: Full=Mitogen-activated protein kinase kinase
  185::340     1e-15  38%  355 aa  M2K1_ORYSJ RecName: Full=Mitogen-activated protein kinase kinase 1;
  141::323     1e-15  33%  354 aa  M2K1_ARATH RecName: Full=Mitogen-activated protein kinase kinase 1;
   91::361     1e-15  26%  367 aa  IPL1_ASHGO RecName: Full=Spindle assembly checkpoint kinase;       
   51::286     1e-15  31%  508 aa  CIPKJ_ORYSJ RecName: Full=CBL-interacting protein kinase 19;       
  338::584     2e-15  28%  677 aa  YPK2_YEAST RecName: Full=Serine/threonine-protein kinase YPK2/YKR2;
    4::181     2e-15  30%  516 aa  Y255_ENCCU RecName: Full=Probable serine/threonine-protein kinase
    5::220     2e-15  27% 2247 aa  TSUA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   29::223     2e-15  28%  486 aa  STK4_CHICK RecName: Full=Serine/threonine-protein kinase 4;        
   27::221     2e-15  28%  497 aa  STK3_MOUSE RecName: Full=Serine/threonine-protein kinase 3;        
  354::626     2e-15  29%  648 aa  RAF1_RAT RecName: Full=RAF proto-oncogene serine/threonine-protein
    8::294     2e-15  26% 1501 aa  NINAC_DROME RecName: Full=Neither inactivation nor afterpotential
    4::253     2e-15  28%  555 aa  NEK4_ARATH RecName: Full=Serine/threonine-protein kinase Nek4;     
    3::264     2e-15  25%  313 aa  MYLKD_DICDI RecName: Full=Probable myosin light chain kinase
   74::275     2e-15  30%  395 aa  MP2K1_XENLA RecName: Full=Dual specificity mitogen-activated
  585::831     2e-15  26%  860 aa  MKCA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   56::306     2e-15  26%  793 aa  MARK1_RAT RecName: Full=Serine/threonine-protein kinase MARK1;     
   56::306     2e-15  26%  795 aa  MARK1_MOUSE RecName: Full=Serine/threonine-protein kinase MARK1;   
  323::582     2e-15  29%  608 aa  M3K1_ARATH RecName: Full=Mitogen-activated protein kinase kinase
   64::263     2e-15  27%  595 aa  KIN1_ENTBH RecName: Full=Probable serine/threonine-protein kinase
   37::299     2e-15  27%  446 aa  KCC1_YEAST RecName: Full=Calcium/calmodulin-dependent protein
  352::626     2e-15  29%  675 aa  CRK25_ARATH RecName: Full=Cysteine-rich receptor-like protein
   10::263     2e-15  24%  450 aa  CIPKN_ORYSJ RecName: Full=CBL-interacting protein kinase 23;       
   29::269     3e-15  27% 1105 aa  STK4L_DICDI RecName: Full=Serine/threonine-protein kinase 4 homolog
   37::291     3e-15  29%  372 aa  ST17B_MOUSE RecName: Full=Serine/threonine-protein kinase 17B;     
  309::564     3e-15  26%  589 aa  SHK2_SCHPO RecName: Full=Serine/threonine-protein kinase shk2;     
  354::626     3e-15  29%  648 aa  RAF1_PONAB RecName: Full=RAF proto-oncogene
  354::626     3e-15  29%  648 aa  RAF1_HUMAN RecName: Full=RAF proto-oncogene
   49::299     3e-15  26%  722 aa  MARK2_RAT RecName: Full=Serine/threonine-protein kinase MARK2;     
   49::299     3e-15  26%  788 aa  MARK2_HUMAN RecName: Full=Serine/threonine-protein kinase MARK2;   
  123::337     3e-15  28%  471 aa  KPK19_ARATH RecName: Full=Serine/threonine-protein kinase AtPK19;  
  117::399     3e-15  26%  891 aa  KIN1_SCHPO RecName: Full=Protein kinase kin1;         EC=2.7.11.1;
   47::309     3e-15  26%  447 aa  KCC2_YEAST RecName: Full=Calcium/calmodulin-dependent protein
   13::264     3e-15  25%  554 aa  KC2D2_DANRE RecName: Full=Calcium/calmodulin-dependent protein
   93::294     3e-15  34%  396 aa  DSOR1_DROME RecName: Full=Dual specificity mitogen-activated
  540::797     3e-15  27%  821 aa  CTR1_ARATH RecName: Full=Serine/threonine-protein kinase CTR1;     
  342::535     3e-15  31%  658 aa  CRK10_ARATH RecName: Full=Cysteine-rich receptor-like protein
   12::261     3e-15  27%  421 aa  CIPKF_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   24::228     3e-15  29%  456 aa  CIPK9_ORYSJ RecName: Full=CBL-interacting protein kinase 9;        
   79::297     3e-15  29%  520 aa  CCAMK_LILLO RecName: Full=Calcium and calcium/calmodulin-dependent
   58::315     3e-15  25%  344 aa  AURKB_HUMAN RecName: Full=Serine/threonine-protein kinase 12;      
 1400::1645    3e-15  26% 1657 aa  YR826_MIMIV RecName: Full=Putative serine/threonine-protein
  126::327     3e-15  30%  441 aa  Y31E_CAEEL RecName: Full=Putative serine/threonine-protein kinase
   65::314     3e-15  26%  414 aa  ST17A_HUMAN RecName: Full=Serine/threonine-protein kinase 17A;     
   28::278     3e-15  27%  504 aa  SMK3_MOUSE RecName: Full=Sperm motility kinase 3;       
  354::629     3e-15  29%  647 aa  RAF1_CHICK RecName: Full=RAF proto-oncogene
  354::626     3e-15  29%  648 aa  RAF1_BOVIN RecName: Full=RAF proto-oncogene
  185::333     3e-15  37%  559 aa  PDPK1_RAT RecName: Full=3-phosphoinositide-dependent protein kinase
  575::832     3e-15  27%  852 aa  PAKB_DICDI RecName: Full=Serine/threonine-protein kinase pakB;     
    4::218     3e-15  27%  692 aa  NEK8_HUMAN RecName: Full=Serine/threonine-protein kinase Nek8;     
  167::414     3e-15  25%  448 aa  MP2K5_RAT RecName: Full=Dual specificity mitogen-activated protein
   43::281     3e-15  30%  606 aa  M3K7_RAT RecName: Full=Mitogen-activated protein kinase kinase
   43::281     3e-15  30%  606 aa  M3K7_PONAB RecName: Full=Mitogen-activated protein kinase kinase
   43::281     3e-15  30%  579 aa  M3K7_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
   43::281     3e-15  30%  606 aa  M3K7_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
   43::281     3e-15  30%  579 aa  M3K7_BOVIN RecName: Full=Mitogen-activated protein kinase kinase
  356::611     3e-15  25%  619 aa  M3K2_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  174::414     3e-15  25%  966 aa  M3K13_BOVIN RecName: Full=Mitogen-activated protein kinase kinase
   13::264     3e-15  25%  491 aa  KC2D1_DANRE RecName: Full=Calcium/calmodulin-dependent protein
  342::616     3e-15  32%  627 aa  CRK15_ARATH RecName: Full=Cysteine-rich receptor-like protein
   92::360     3e-15  26%  554 aa  CDPKF_ARATH RecName: Full=Calcium-dependent protein kinase 15;     
   83::274     4e-15  26%  635 aa  Y0146_DICDI RecName: Full=Probable serine/threonine-protein kinase
  442::728     4e-15  26%  793 aa  WAKLN_ARATH RecName: Full=Wall-associated receptor kinase-like 18; 
  422::631     4e-15  28%  769 aa  WAKLJ_ARATH RecName: Full=Wall-associated receptor kinase-like 10; 
   27::273     4e-15  26%  491 aa  STK3_HUMAN RecName: Full=Serine/threonine-protein kinase 3;        
   19::270     4e-15  27%  532 aa  PPK9_SCHPO RecName: Full=Protein kinase domain-containing protein
   12::201     4e-15  32%  585 aa  PKNI_MYCTU RecName: Full=Probable serine/threonine-protein kinase
   12::201     4e-15  32%  585 aa  PKNI_MYCBO RecName: Full=Probable serine/threonine-protein kinase
  185::333     4e-15  37%  559 aa  PDPK1_MOUSE RecName: Full=3-phosphoinositide-dependent protein
  182::330     4e-15  37%  556 aa  PDPK1_HUMAN RecName: Full=3-phosphoinositide-dependent protein
  167::414     4e-15  25%  448 aa  MP2K5_HUMAN RecName: Full=Dual specificity mitogen-activated
   74::275     4e-15  31%  393 aa  MP2K1_RAT RecName: Full=Dual specificity mitogen-activated protein
   74::275     4e-15  31%  393 aa  MP2K1_MOUSE RecName: Full=Dual specificity mitogen-activated
  446::621     4e-15  31%  652 aa  MKCD_DICDI RecName: Full=Probable serine/threonine-protein kinase
  595::847     4e-15  28%  918 aa  KPCD1_RAT RecName: Full=Serine/threonine-protein kinase D1;        
  589::841     4e-15  28%  912 aa  KPCD1_HUMAN RecName: Full=Serine/threonine-protein kinase D1;      
   65::339     4e-15  30%  504 aa  KCC2_SCHPO RecName: Full=Calcium/calmodulin-dependent protein
  120::283     4e-15  32%  353 aa  KAPC_DROME RecName: Full=cAMP-dependent protein kinase catalytic
  100::330     4e-15  25%  358 aa  IPL1_CANGA RecName: Full=Spindle assembly checkpoint kinase;       
  110::366     4e-15  25%  435 aa  FUZ7_USTMA RecName: Full=Dual specificity protein kinase FUZ7;     
  776::1001    4e-15  30% 1070 aa  DKF2_CAEEL RecName: Full=Serine/threonine-protein kinase dkf-2;      
  897::1122    4e-15  30% 1191 aa  DKF2_CAEBR RecName: Full=Serine/threonine-protein kinase dkf-2;      
   26::228     4e-15  32%  431 aa  CIPKM_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   12::261     4e-15  29%  439 aa  CIPKK_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   73::333     4e-15  26%  521 aa  CDPKX_ARATH RecName: Full=Calcium-dependent protein kinase 33;     
   88::309     4e-15  30%  523 aa  CCAMK_MEDTR RecName: Full=Calcium and calcium/calmodulin-dependent
    4::216     4e-15  27%  668 aa  ATG1_DICDI RecName: Full=Serine/threonine-protein kinase atg1;     
   53::347     4e-15  28%  834 aa  ATG1_CANAL RecName: Full=Serine/threonine-protein kinase ATG1;     
   14::232     6e-15  30% 1323 aa  TNIK_MOUSE RecName: Full=Traf2 and NCK-interacting protein kinase; 
   14::232     6e-15  30% 1360 aa  TNIK_HUMAN RecName: Full=TRAF2 and NCK-interacting protein kinase; 
   63::310     6e-15  24%  631 aa  PLK3_MOUSE RecName: Full=Serine/threonine-protein kinase PLK3;     
  155::303     6e-15  37%  396 aa  PDPK2_HUMAN RecName: Full=Putative 3-phosphoinositide-dependent
    4::218     6e-15  27%  698 aa  NEK8_MOUSE RecName: Full=Serine/threonine-protein kinase Nek8;     
  167::414     6e-15  25%  448 aa  MP2K5_MOUSE RecName: Full=Dual specificity mitogen-activated
   74::275     6e-15  31%  393 aa  MP2K1_RABIT RecName: Full=Dual specificity mitogen-activated
   74::275     6e-15  31%  393 aa  MP2K1_HUMAN RecName: Full=Dual specificity mitogen-activated
  595::847     6e-15  28%  918 aa  KPCD1_MOUSE RecName: Full=Serine/threonine-protein kinase D1;      
   23::220     6e-15  25%  382 aa  KCC1_METAN RecName: Full=Calcium/calmodulin-dependent protein
  118::281     6e-15  31%  351 aa  KAPCB_RAT RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     6e-15  31%  351 aa  KAPCB_PIG RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     6e-15  31%  351 aa  KAPCB_MOUSE RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     6e-15  31%  351 aa  KAPCB_HUMAN RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     6e-15  31%  351 aa  KAPCB_CRIGR RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     6e-15  31%  351 aa  KAPCB_BOVIN RecName: Full=cAMP-dependent protein kinase catalytic
  451::704     6e-15  28%  760 aa  DKF1_CAEBR RecName: Full=Serine/threonine-protein kinase dkf-1;    
   35::229     6e-15  27%  497 aa  CST1_CAEEL RecName: Full=Serine/threonine-protein kinase cst-1;    
  341::534     6e-15  32%  659 aa  CRK7_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase
  340::609     6e-15  29%  659 aa  CRK5_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase
  368::555     6e-15  29%  690 aa  CRK21_ARATH RecName: Full=Cysteine-rich receptor-like protein
   91::317     6e-15  30%  527 aa  CCAMK_PEA RecName: Full=Calcium and calcium/calmodulin-dependent
  443::725     7e-15  27%  788 aa  WAKLK_ARATH RecName: Full=Putative wall-associated receptor
   37::318     7e-15  27%  372 aa  ST17B_HUMAN RecName: Full=Serine/threonine-protein kinase 17B;     
  168::408     7e-15  29%  496 aa  SGK3_PONAB RecName: Full=Serine/threonine-protein kinase Sgk3;     
  168::408     7e-15  29%  496 aa  SGK3_HUMAN RecName: Full=Serine/threonine-protein kinase Sgk3;     
   35::278     7e-15  24%  615 aa  PLK3_RAT RecName: Full=Serine/threonine-protein kinase PLK3;       
    8::255     7e-15  25% 1203 aa  NEK1_MOUSE RecName: Full=Serine/threonine-protein kinase Nek1;     
  293::535     7e-15  26%  586 aa  MPS1_ENCCU RecName: Full=Probable serine/threonine-protein kinase
   75::278     7e-15  31%  397 aa  MP2K2_CYPCA RecName: Full=Dual specificity mitogen-activated
   79::296     7e-15  29%  387 aa  MEK2_CAEEL RecName: Full=Dual specificity mitogen-activated protein
   97::325     7e-15  29%  363 aa  M2K2_ARATH RecName: Full=Mitogen-activated protein kinase kinase 2;
   42::288     7e-15  29%  535 aa  KIN10_ARATH RecName: Full=SNF1-related protein kinase catalytic
   14::265     7e-15  25%  479 aa  KCC2D_CHICK RecName: Full=Calcium/calmodulin-dependent protein
  118::281     7e-15  31%  351 aa  KAPCA_SHEEP RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     7e-15  31%  351 aa  KAPCA_RAT RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     7e-15  31%  351 aa  KAPCA_PIG RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     7e-15  31%  351 aa  KAPCA_HUMAN RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     7e-15  31%  351 aa  KAPCA_CRIGR RecName: Full=cAMP-dependent protein kinase catalytic
  117::280     7e-15  31%  350 aa  KAPCA_CANFA RecName: Full=cAMP-dependent protein kinase catalytic
  118::281     7e-15  31%  351 aa  KAPCA_BOVIN RecName: Full=cAMP-dependent protein kinase catalytic
  161::364     7e-15  26% 1518 aa  HSL1_YEAST RecName: Full=Probable serine/threonine-protein kinase
   42::237     7e-15  30%  669 aa  HIPPO_DROME RecName: Full=Serine/threonine-protein kinase hippo;   
  485::749     7e-15  27%  749 aa  DRKC_DICDI RecName: Full=Probable serine/threonine-protein kinase
  354::626     1e-14  29%  648 aa  RAF1_MOUSE RecName: Full=RAF proto-oncogene
  153::284     1e-14  32%  649 aa  PLK1_CAEEL RecName: Full=Serine/threonine-protein kinase plk-1;    
  558::752     1e-14  30%  875 aa  KPCD2_RAT RecName: Full=Serine/threonine-protein kinase D2;        
  558::752     1e-14  30%  875 aa  KPCD2_MOUSE RecName: Full=Serine/threonine-protein kinase D2;      
  557::751     1e-14  30%  878 aa  KPCD2_HUMAN RecName: Full=Serine/threonine-protein kinase D2;      
  217::470     1e-14  25%  569 aa  GAD8_SCHPO RecName: Full=Serine/threonine-protein kinase gad8;     
  413::664     1e-14  29%  722 aa  DKF1_CAEEL RecName: Full=Serine/threonine-protein kinase dkf-1;    
  331::524     1e-14  31%  645 aa  CRK19_ARATH RecName: Full=Cysteine-rich receptor-like protein
  698::895     1e-14  27%  980 aa  CLV1_ARATH RecName: Full=Receptor protein kinase CLAVATA1;       
 1366::1621    1e-14  26% 1624 aa  YR831_MIMIV RecName: Full=Putative serine/threonine-protein
  168::408     1e-14  29%  496 aa  SGK3_RAT RecName: Full=Serine/threonine-protein kinase Sgk3;       
  168::408     1e-14  29%  496 aa  SGK3_MOUSE RecName: Full=Serine/threonine-protein kinase Sgk3;     
   14::272     1e-14  31%  898 aa  PKH3_YEAST RecName: Full=Serine/threonine-protein kinase PKH3;     
    4::262     1e-14  26%  708 aa  NEK5_HUMAN RecName: Full=Serine/threonine-protein kinase Nek5;     
   29::293     1e-14  26%  645 aa  NEK11_HUMAN RecName: Full=Serine/threonine-protein kinase Nek11;   
   67::268     1e-14  31%  388 aa  MP2K1_SERCA RecName: Full=Dual specificity mitogen-activated
   74::275     1e-14  31%  393 aa  MP2K1_CRIGR RecName: Full=Dual specificity mitogen-activated
  175::415     1e-14  25%  961 aa  M313A_XENLA RecName: Full=Mitogen-activated protein kinase kinase
   16::262     1e-14  29%  461 aa  CIPK1_ORYSJ RecName: Full=CBL-interacting protein kinase 1;        
   23::319     1e-14  29%  964 aa  ATG1_ASPTN RecName: Full=Serine/threonine-protein kinase atg1;     
   24::234     1e-14  27%  385 aa  AAPK1_PIG RecName: Full=5'-AMP-activated protein kinase catalytic
  229::473     2e-14  26%  516 aa  Y9452_DICDI RecName: Full=Probable serine/threonine-protein kinase
  435::645     2e-14  28%  786 aa  WAKLM_ARATH RecName: Full=Wall-associated receptor kinase-like 17; 
   25::217     2e-14  32%  328 aa  TSSK4_HUMAN RecName: Full=Testis-specific serine/threonine-protein
   49::306     2e-14  27%  432 aa  STK11_XENLA RecName: Full=Serine/threonine-protein kinase 11;      
  112::417     2e-14  27%  580 aa  SRK1_SCHPO RecName: Full=Serine/threonine-protein kinase srk1;     
   29::301     2e-14  29%  323 aa  RAF_MSV36 RecName: Full=Serine/threonine-protein
   85::326     2e-14  22%  682 aa  PLK2_MOUSE RecName: Full=Serine/threonine-protein kinase PLK2;     
    3::265     2e-14  24%  710 aa  PKN6_MYXXA RecName: Full=Serine/threonine-protein kinase pkn6;     
   23::323     2e-14  30%  421 aa  OXI1_ARATH RecName: Full=Serine/threonine-protein kinase OXI1;     
    1::266     2e-14  27%  445 aa  NEK2_HUMAN RecName: Full=Serine/threonine-protein kinase Nek2;     
  446::714     2e-14  28%  764 aa  MPS1_YEAST RecName: Full=Serine/threonine-protein kinase MPS1;     
   78::287     2e-14  32%  400 aa  MP2K2_HUMAN RecName: Full=Dual specificity mitogen-activated
   87::362     2e-14  29%  380 aa  MIL_AVIMH RecName: Full=Serine/threonine-protein
  474::737     2e-14  29%  782 aa  KRAF1_DROME RecName: Full=Raf homolog serine/threonine-protein
  131::331     2e-14  26%  465 aa  KPK1_ARATH RecName: Full=Serine/threonine-protein kinase
  513::700     2e-14  31%  830 aa  CRK23_ARATH RecName: Full=Putative cysteine-rich receptor-like
   63::333     2e-14  26%  534 aa  CDPK1_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform
  533::731     2e-14  32%  849 aa  SRK6_BRAOE RecName: Full=Putative serine/threonine-protein kinase
   71::277     2e-14  28%  497 aa  SMKZ_MOUSE RecName: Full=Sperm motility kinase Z;       
   85::326     2e-14  22%  682 aa  PLK2_RAT RecName: Full=Serine/threonine-protein kinase PLK2;       
   88::329     2e-14  22%  685 aa  PLK2_PONAB RecName: Full=Serine/threonine-protein kinase PLK2;     
   88::329     2e-14  22%  685 aa  PLK2_HUMAN RecName: Full=Serine/threonine-protein kinase PLK2;     
   39::300     2e-14  26%  603 aa  PLK1_HUMAN RecName: Full=Serine/threonine-protein kinase PLK1;     
    4::254     2e-14  25%  506 aa  NEK3_HUMAN RecName: Full=Serine/threonine-protein kinase Nek3;     
  155::355     2e-14  26%  510 aa  KPK2_PLAFK RecName: Full=Probable serine/threonine-protein kinase
   84::304     2e-14  27%  443 aa  CIPKT_ORYSJ RecName: Full=CBL-interacting protein kinase 29;       
   19::273     2e-14  30%  447 aa  CIPK7_ORYSJ RecName: Full=CBL-interacting protein kinase 7;        
    3::213     2e-14  30%  445 aa  CIPK5_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   10::183     3e-14  27%  268 aa  TSSK3_MOUSE RecName: Full=Testis-specific serine/threonine-protein
   41::281     3e-14  31%  367 aa  SGK2_RAT RecName: Full=Serine/threonine-protein kinase Sgk2;       
   58::332     3e-14  29%  367 aa  RMIL_AVII1 RecName: Full=Serine/threonine-protein
   74::348     3e-14  29%  450 aa  RMIL_AVEVR RecName: Full=Serine/threonine-protein
    9::273     3e-14  23%  831 aa  PP395_ARATH RecName: Full=Pentatricopeptide repeat-containing
  165::298     3e-14  35%  602 aa  PLK1_BOVIN RecName: Full=Serine/threonine-protein kinase PLK1;     
   30::291     3e-14  26%  628 aa  NEK11_MOUSE RecName: Full=Serine/threonine-protein kinase Nek11;   
  289::476     3e-14  30%  506 aa  MKK2_YEAST RecName: Full=MAP kinase kinase MKK2/SSP33;       
   14::232     3e-14  29% 1308 aa  MINK1_MOUSE RecName: Full=Misshapen-like kinase 1;       
   14::232     3e-14  29% 1332 aa  MINK1_HUMAN RecName: Full=Misshapen-like kinase 1;       
    8::273     3e-14  29%  678 aa  M3K7_DROME RecName: Full=Mitogen-activated protein kinase kinase
  164::404     3e-14  25%  888 aa  M3K12_RAT RecName: Full=Mitogen-activated protein kinase kinase
  119::368     3e-14  29%  850 aa  M3K11_RAT RecName: Full=Mitogen-activated protein kinase kinase
  119::368     3e-14  29%  850 aa  M3K11_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  118::367     3e-14  29%  847 aa  M3K11_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
   13::264     3e-14  24%  475 aa  KCC2D_XENLA RecName: Full=Calcium/calmodulin-dependent protein
  155::318     3e-14  31%  404 aa  KAPC_CAEEL RecName: Full=cAMP-dependent protein kinase catalytic
  344::531     3e-14  28%  666 aa  CRK31_ARATH RecName: Full=Putative cysteine-rich receptor-like
   33::286     3e-14  26%  626 aa  CCR1_MAIZE RecName: Full=Probable serine/threonine-protein kinase
   64::280     3e-14  28%  421 aa  CAMKV_TAKRU RecName: Full=CaM kinase-like vesicle-associated
  485::759     3e-14  29%  804 aa  BRAF1_MOUSE RecName: Full=B-Raf proto-oncogene
  448::722     3e-14  29%  766 aa  BRAF1_HUMAN RecName: Full=B-Raf proto-oncogene
  488::762     3e-14  29%  807 aa  BRAF1_COTJA RecName: Full=B-Raf proto-oncogene
  488::762     3e-14  29%  806 aa  BRAF1_CHICK RecName: Full=B-Raf proto-oncogene
  364::605     4e-14  25% 1024 aa  Y9871_DICDI RecName: Full=Probable serine/threonine-protein kinase
    1::265     4e-14  27%  468 aa  ULK3_XENLA RecName: Full=Serine/threonine-protein kinase ULK3;     
   50::270     4e-14  28%  620 aa  SNF1_CANAL RecName: Full=Carbon catabolite-derepressing protein
  269::536     4e-14  28%  744 aa  SHKD_DICDI RecName: Full=Dual specificity protein kinase shkD;     
   38::309     4e-14  24%  646 aa  PLK3_HUMAN RecName: Full=Serine/threonine-protein kinase PLK3;     
    4::252     4e-14  26%  511 aa  NEK3_MOUSE RecName: Full=Serine/threonine-protein kinase Nek3;     
 1228::1484    4e-14  27% 1493 aa  M3K1_RAT RecName: Full=Mitogen-activated protein kinase kinase kinase
  535::731     4e-14  28%  817 aa  KPRO_MAIZE RecName: Full=Putative receptor protein kinase ZmPK1;   
  459::692     4e-14  26%  762 aa  KGP2_RAT RecName: Full=cGMP-dependent protein kinase 2;       
  459::692     4e-14  26%  762 aa  KGP2_MOUSE RecName: Full=cGMP-dependent protein kinase 2;       
  459::692     4e-14  26%  762 aa  KGP2_HUMAN RecName: Full=cGMP-dependent protein kinase 2;       
  356::614     4e-14  26%  648 aa  DCLK3_HUMAN RecName: Full=Serine/threonine-protein kinase DCLK3;   
   12::281     4e-14  26%  909 aa  CSKP_RAT RecName: Full=Peripheral plasma membrane protein CASK;    
   12::281     4e-14  26%  926 aa  CSKP_MOUSE RecName: Full=Peripheral plasma membrane protein CASK;  
   12::281     4e-14  26%  926 aa  CSKP_HUMAN RecName: Full=Peripheral plasma membrane protein CASK;  
  349::538     4e-14  29%  665 aa  CRK41_ARATH RecName: Full=Cysteine-rich receptor-like protein
  314::520     4e-14  28%  646 aa  CRK3_ARATH RecName: Full=Cysteine-rich receptor-like protein kinase
   57::306     4e-14  28%  502 aa  CIPKD_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   13::213     4e-14  30%  443 aa  CIPK2_ORYSJ RecName: Full=CBL-interacting protein kinase 2;        
  224::494     4e-14  30%  546 aa  CHK2_MOUSE RecName: Full=Serine/threonine-protein kinase Chk2;     
   28::292     4e-14  26%  485 aa  CDPKR_ARATH RecName: Full=Calcium-dependent protein kinase 27;     
  108::328     4e-14  27%  520 aa  CDPKN_ARATH RecName: Full=Calcium-dependent protein kinase 23;     
    4::199     4e-14  31%  593 aa  CDKL3_RAT RecName: Full=Cyclin-dependent kinase-like 3;       
   39::222     5e-14  32%  527 aa  Y9853_DICDI RecName: Full=Probable serine/threonine-protein kinase
   29::277     5e-14  26%  921 aa  Y9851_DICDI RecName: Full=Probable serine/threonine-protein kinase
  446::654     5e-14  28%  764 aa  WAKLL_ARATH RecName: Full=Putative wall-associated receptor
   41::281     5e-14  28%  367 aa  SGK2_MOUSE RecName: Full=Serine/threonine-protein kinase Sgk2;     
 3014::3195    5e-14  28% 3365 aa  ROCO9_DICDI RecName: Full=Probable serine/threonine-protein kinase
   28::239     5e-14  28%  672 aa  PPK16_SCHPO RecName: Full=Serine/threonine-protein kinase ppk16;   
  167::300     5e-14  33%  603 aa  PLK1_RAT RecName: Full=Serine/threonine-protein kinase PLK1;       
  167::300     5e-14  33%  603 aa  PLK1_MOUSE RecName: Full=Serine/threonine-protein kinase PLK1;     
   29::290     5e-14  26%  637 aa  NEK11_MACFA RecName: Full=Serine/threonine-protein kinase Nek11;   
   78::281     5e-14  32%  400 aa  MP2K2_RAT RecName: Full=Dual specificity mitogen-activated protein
   78::291     5e-14  32%  401 aa  MP2K2_MOUSE RecName: Full=Dual specificity mitogen-activated
   23::239     5e-14  26%  646 aa  MASK_MYXXD RecName: Full=Tyrosine-protein kinase masK;       
   74::325     5e-14  25%  651 aa  M3K3_ARATH RecName: Full=Mitogen-activated protein kinase kinase
  356::611     5e-14  25%  619 aa  M3K2_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
 1247::1503    5e-14  27% 1512 aa  M3K1_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
   53::262     5e-14  26%  566 aa  KIN1_ENCCU RecName: Full=Probable serine/threonine-protein kinase
  694::887     5e-14  34% 1207 aa  JIL1_DROME RecName: Full=Chromosomal serine/threonine-protein
  195::432     5e-14  29%  476 aa  CHK2_CAEEL RecName: Full=Serine/threonine-protein kinase chk-2;    
   79::332     5e-14  27%  542 aa  CDPKB_ORYSJ RecName: Full=Calcium-dependent protein kinase isoform
    5::201     5e-14  30%  301 aa  CC2H1_TRYCO RecName: Full=Cell division control protein 2 homolog
  206::343     6e-14  31%  430 aa  SGK1_RAT RecName: Full=Serine/threonine-protein kinase Sgk1;       
  141::376     6e-14  28%  463 aa  SGK1_CAEEL RecName: Full=Serine/threonine-protein kinase sgk-1;    
    9::263     6e-14  21%  781 aa  PLK4_DROVI RecName: Full=Serine/threonine-protein kinase PLK4;     
   42::308     6e-14  27%  313 aa  NEK6_RAT RecName: Full=Serine/threonine-protein kinase Nek6;       
    4::252     6e-14  24%  416 aa  NEK6_ARATH RecName: Full=Serine/threonine-protein kinase Nek6;     
  288::542     6e-14  26%  596 aa  MYLK2_HUMAN RecName: Full=Myosin light chain kinase 2,
   78::281     6e-14  31%  400 aa  MP2K2_CANFA RecName: Full=Dual specificity mitogen-activated
 1228::1484    6e-14  27% 1493 aa  M3K1_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  356::591     6e-14  27%  679 aa  KPC1_DROME RecName: Full=Protein kinase C, brain isozyme;       
  120::416     6e-14  28%  525 aa  KBN8_YEAST RecName: Full=Probable serine/threonine-protein kinase
  118::281     6e-14  30%  351 aa  KAPCA_MOUSE RecName: Full=cAMP-dependent protein kinase catalytic
   99::338     6e-14  24%  371 aa  IPL1_YARLI RecName: Full=Spindle assembly checkpoint kinase;       
  350::561     6e-14  30%  683 aa  CRK28_ARATH RecName: Full=Cysteine-rich receptor-like protein
    5::201     6e-14  28%  301 aa  CRK1_LEIME RecName: Full=Cell division protein kinase 2 homolog
   15::254     6e-14  23% 1062 aa  CDC7_SCHPO RecName: Full=Cell division control protein 7;       
   21::309     6e-14  27%  831 aa  ATG1_KLULA RecName: Full=Serine/threonine-protein kinase ATG1;     
   16::271     8e-14  26%  504 aa  SMK2A_MOUSE RecName: Full=Sperm motility kinase 2a;       
   82::335     8e-14  27%  436 aa  PSK1_SCHPO RecName: Full=Serine/threonine-protein kinase psk1;     
  107::348     8e-14  28%  656 aa  PMY13_CAEBR RecName: Full=Membrane-associated tyrosine- and
   36::278     8e-14  26%  632 aa  PLK2_CAEEL RecName: Full=Serine/threonine-protein kinase plk-2;    
  158::291     8e-14  35%  598 aa  PLK1_XENLA RecName: Full=Serine/threonine-protein kinase PLK1;     
    3::218     8e-14  30%  288 aa  PEF1_SCHPO RecName: Full=Serine/threonine-protein kinase pef1;     
  115::255     8e-14  32% 1258 aa  NEK1_HUMAN RecName: Full=Serine/threonine-protein kinase Nek1;     
  302::556     8e-14  26%  610 aa  MYLK2_RAT RecName: Full=Myosin light chain kinase 2,
  438::590     8e-14  33%  682 aa  LRKA1_ARATH RecName: Full=Lectin-domain containing receptor kinase
  414::624     8e-14  29%  737 aa  KPCE_MOUSE RecName: Full=Protein kinase C epsilon type;       
  375::589     8e-14  26%  704 aa  KPC1_CAEEL RecName: Full=Protein kinase C-like 1;       
  125::397     8e-14  28%  505 aa  KKCC1_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   12::212     8e-14  29%  493 aa  CIPKQ_ORYSJ RecName: Full=CBL-interacting protein kinase 26;       
  501::713     1e-13  27%  717 aa  STE11_YEAS6 RecName: Full=Serine/threonine-protein kinase STE11;   
 2681::2877    1e-13  23% 2995 aa  SPEG_DANRE RecName: Full=Striated muscle preferentially expressed
  345::605     1e-13  28%  638 aa  RAF1_XENLA RecName: Full=RAF proto-oncogene
  122::387     1e-13  24%  766 aa  PKH1_YEAST RecName: Full=Serine/threonine-protein kinase PKH1;     
   27::294     1e-13  28%  313 aa  NEK6_MOUSE RecName: Full=Serine/threonine-protein kinase Nek6;     
   20::249     1e-13  33%  720 aa  MK06_MOUSE RecName: Full=Mitogen-activated protein kinase 6;       
   80::358     1e-13  28%  940 aa  M3K10_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  352::596     1e-13  27%  683 aa  KPCL_MOUSE RecName: Full=Protein kinase C eta type;       
  414::624     1e-13  27%  737 aa  KPCE_RAT RecName: Full=Protein kinase C epsilon type;       
  413::623     1e-13  29%  736 aa  KPCE_RABIT RecName: Full=Protein kinase C epsilon type;       
  414::624     1e-13  29%  737 aa  KPCE_HUMAN RecName: Full=Protein kinase C epsilon type;       
   14::273     1e-13  30%  485 aa  DST4_DICDI RecName: Full=Serine/threonine-protein kinase dst4;     
   16::283     1e-13  24%  448 aa  DAPK3_RAT RecName: Full=Death-associated protein kinase 3;       
   16::283     1e-13  24%  448 aa  DAPK3_MOUSE RecName: Full=Death-associated protein kinase 3;       
   13::262     1e-13  26%  451 aa  CIPKA_ORYSJ RecName: Full=CBL-interacting protein kinase 10;       
    4::199     1e-13  30%  595 aa  CDKL3_MOUSE RecName: Full=Cyclin-dependent kinase-like 3;       
 1395::1638    1e-13  24% 1651 aa  YR818_MIMIV RecName: Full=Putative serine/threonine-protein
  439::645     1e-13  27%  792 aa  WAKLH_ARATH RecName: Full=Wall-associated receptor kinase-like 9;  
   10::183     1e-13  28%  268 aa  TSSK3_HUMAN RecName: Full=Testis-specific serine/threonine-protein
  501::713     1e-13  27%  717 aa  STE11_YEAST RecName: Full=Serine/threonine-protein kinase STE11;   
  501::713     1e-13  27%  717 aa  STE11_YEAS7 RecName: Full=Serine/threonine-protein kinase STE11;   
    5::285     1e-13  25%  506 aa  SHKC_DICDI RecName: Full=Dual specificity protein kinase shkC;     
   53::300     1e-13  25%  406 aa  PHKG2_MOUSE RecName: Full=Phosphorylase b kinase gamma catalytic
   34::283     1e-13  28%  302 aa  NEK7_HUMAN RecName: Full=Serine/threonine-protein kinase Nek7;     
   42::294     1e-13  28%  313 aa  NEK6_PIG RecName: Full=Serine/threonine-protein kinase Nek6;       
   42::310     1e-13  27%  313 aa  NEK6_HUMAN RecName: Full=Serine/threonine-protein kinase Nek6;     
    1::266     1e-13  26%  443 aa  NEK2_MOUSE RecName: Full=Serine/threonine-protein kinase Nek2;     
   76::279     1e-13  31%  398 aa  MP2K2_CHICK RecName: Full=Dual specificity mitogen-activated
   74::325     1e-13  25%  651 aa  M3K2_ARATH RecName: Full=Mitogen-activated protein kinase kinase
  164::404     1e-13  25%  888 aa  M3K12_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  131::371     1e-13  25%  859 aa  M3K12_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  407::571     1e-13  29%  688 aa  LRKA2_ARATH RecName: Full=Lectin-domain containing receptor kinase
   20::266     1e-13  28%  512 aa  KIN11_ARATH RecName: Full=SNF1-related protein kinase catalytic
  463::658     1e-13  29%  768 aa  KGP1_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 1; 
   85::308     1e-13  29%  415 aa  KCCS_MALDO RecName: Full=Calcium/calmodulin-dependent
  145::406     1e-13  29%  712 aa  FHKE_DICDI RecName: Full=Probable serine/threonine-protein kinase
    6::226     1e-13  26%  445 aa  CIPK8_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   16::220     1e-13  28%  445 aa  CIPK3_ORYSJ RecName: Full=CBL-interacting protein kinase 3;        
   34::295     1e-13  25%  508 aa  CDPK_SOYBN RecName: Full=Calcium-dependent protein kinase SK5;     
  926::1191    2e-13  28% 1224 aa  Y2350_DICDI RecName: Full=Probable serine/threonine-protein kinase
  524::785     2e-13  27%  856 aa  TTK_MOUSE RecName: Full=Dual specificity protein kinase TTK;       
   16::273     2e-13  30%  422 aa  SPM1_SCHPO RecName: Full=Mitogen-activated protein kinase spm1;    
   31::235     2e-13  28% 1206 aa  SLK_RAT RecName: Full=STE20-like serine/threonine-protein kinase;  
   31::235     2e-13  28% 1233 aa  SLK_MOUSE RecName: Full=STE20-like serine/threonine-protein kinase;
  243::538     2e-13  28%  710 aa  SHKE_DICDI RecName: Full=Dual specificity protein kinase shkE;     
   42::236     2e-13  22%  513 aa  PAKH_DICDI RecName: Full=Serine/threonine-protein kinase pakH;     
   84::329     2e-13  29%  366 aa  M2K4_ARATH RecName: Full=Mitogen-activated protein kinase kinase 4;
  326::537     2e-13  27%  649 aa  KPC1_APLCA RecName: Full=Calcium-dependent protein kinase C;       
    8::228     2e-13  27%  432 aa  CIPKH_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   21::279     2e-13  24%  451 aa  CIPK6_ORYSJ RecName: Full=CBL-interacting protein kinase 6;        
   91::351     2e-13  26%  541 aa  CDPK9_ARATH RecName: Full=Calcium-dependent protein kinase 9;      
   72::287     2e-13  27%  501 aa  CDPK4_ARATH RecName: Full=Calcium-dependent protein kinase 4;      
    4::199     2e-13  30%  590 aa  CDKL3_MACFA RecName: Full=Cyclin-dependent kinase-like 3;       
    4::199     2e-13  30%  592 aa  CDKL3_HUMAN RecName: Full=Cyclin-dependent kinase-like 3;       
    4::225     2e-13  30%  317 aa  CDC28_CANAL RecName: Full=Cell division control protein 28;        
  889::1085    2e-13  30% 1196 aa  BRI1_ARATH RecName: Full=Protein BRASSINOSTEROID INSENSITIVE 1;      
  341::587     2e-13  26%  680 aa  YPK1_YEAST RecName: Full=Serine/threonine-protein kinase YPK1;     
  196::439     2e-13  30%  515 aa  STE7_YEAST RecName: Full=Serine/threonine-protein kinase STE7;     
   31::235     2e-13  28% 1231 aa  SLK_CAVPO RecName: Full=STE20-like serine/threonine-protein kinase;
  158::291     2e-13  35%  598 aa  PLK1_XENTR RecName: Full=Serine/threonine-protein kinase PLK1;     
  650::899     2e-13  25%  926 aa  PAKE_DICDI RecName: Full=Serine/threonine-protein kinase pakE;     
   64::344     2e-13  26%  346 aa  MOS_CERAE RecName: Full=Proto-oncogene serine/threonine-protein
   20::238     2e-13  33%  720 aa  MK06_RAT RecName: Full=Mitogen-activated protein kinase 6;       
   20::238     2e-13  33%  721 aa  MK06_PONAB RecName: Full=Mitogen-activated protein kinase 6;       
   20::238     2e-13  33%  721 aa  MK06_HUMAN RecName: Full=Mitogen-activated protein kinase 6;       
   52::325     2e-13  27%  776 aa  MARK3_HUMAN RecName: Full=MAP/microtubule affinity-regulating
  352::571     2e-13  28%  683 aa  KPCL_RAT RecName: Full=Protein kinase C eta type;       
  692::897     2e-13  27%  993 aa  HSL2_ARATH RecName: Full=Receptor-like protein kinase HSL2;        
    2::182     2e-13  31%  435 aa  CIPKS_ORYSJ RecName: Full=CBL-interacting protein kinase 28;       
   15::257     2e-13  28%  457 aa  CIPKI_ORYSJ RecName: Full=CBL-interacting protein kinase 18;       
   73::287     2e-13  27%  495 aa  CDPKB_ARATH RecName: Full=Calcium-dependent protein kinase 11;     
   13::209     2e-13  24%  938 aa  CDKL5_MOUSE RecName: Full=Cyclin-dependent kinase-like 5;       
   13::209     2e-13  24% 1030 aa  CDKL5_HUMAN RecName: Full=Cyclin-dependent kinase-like 5;       
  169::428     3e-13  29% 1243 aa  WNK4_HUMAN RecName: Full=Serine/threonine-protein kinase WNK4;     
  803::937     3e-13  34% 1019 aa  STK31_HUMAN RecName: Full=Serine/threonine-protein kinase 31;      
   21::271     3e-13  29%  362 aa  SRK2E_ARATH RecName: Full=Serine/threonine-protein kinase SRK2E;   
  822::1009    3e-13  31% 1109 aa  RPK1_IPONI RecName: Full=Receptor-like protein kinase;       
   42::300     3e-13  25%  406 aa  PHKG2_HUMAN RecName: Full=Phosphorylase b kinase gamma catalytic
  689::925     3e-13  27% 1016 aa  PCK2_SCHPO RecName: Full=Protein kinase C-like 2;       
  207::385     3e-13  28% 1179 aa  PAKG_DICDI RecName: Full=Serine/threonine-protein kinase pakG;     
  315::569     3e-13  26%  623 aa  MYLK2_BOVIN RecName: Full=Myosin light chain kinase 2,
  713::976     3e-13  28%  983 aa  MPS1_DICDI RecName: Full=Probable serine/threonine-protein kinase
   74::262     3e-13  30%  393 aa  MP2K1_PANTR RecName: Full=Dual specificity mitogen-activated
  412::668     3e-13  28%  733 aa  KS6AA_XENLA RecName: Full=Ribosomal protein S6 kinase 2 alpha;     
  125::397     3e-13  28%  505 aa  KKCC1_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
  331::548     3e-13  28%  648 aa  KAPC_DICDI RecName: Full=cAMP-dependent protein kinase catalytic
  129::343     3e-13  24%  367 aa  IPL1_YEAST RecName: Full=Spindle assembly checkpoint kinase;       
  343::528     3e-13  28%  658 aa  CRK14_ARATH RecName: Full=Cysteine-rich receptor-like protein
   17::254     3e-13  27%  444 aa  CIPK1_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   17::234     3e-13  32%  470 aa  CDKE1_ARATH RecName: Full=Cyclin-dependent kinase E-1;       
  119::257     4e-13  32%  276 aa  YR436_MIMIV RecName: Full=Putative serine/threonine-protein kinase
  160::355     4e-13  27%  472 aa  Y1154_ARATH RecName: Full=Probable serine/threonine-protein kinase
  166::425     4e-13  29% 1222 aa  WNK4_MOUSE RecName: Full=Serine/threonine-protein kinase WNK4;     
   36::289     4e-13  27%  966 aa  STK10_MOUSE RecName: Full=Serine/threonine-protein kinase 10;      
  844::1092    4e-13  27% 1125 aa  RCKA_DICDI RecName: Full=RGS domain-containing
  123::277     4e-13  31%  358 aa  PRKX_HUMAN RecName: Full=Serine/threonine-protein kinase PRKX;     
   34::283     4e-13  28%  302 aa  NEK7_MOUSE RecName: Full=Serine/threonine-protein kinase Nek7;     
    4::252     4e-13  27%  534 aa  NEK6_ORYSJ RecName: Full=Serine/threonine-protein kinase Nek6;     
 1464::1661    4e-13  28% 1914 aa  MYLK_HUMAN RecName: Full=Myosin light chain kinase, smooth muscle;   
  566::863     4e-13  28%  928 aa  MYLKF_DICDI RecName: Full=Probable myosin light chain kinase
  305::559     4e-13  26%  613 aa  MYLK2_MOUSE RecName: Full=Myosin light chain kinase 2,
   64::345     4e-13  26%  346 aa  MOS_HUMAN RecName: Full=Proto-oncogene serine/threonine-protein
   74::276     4e-13  26%  415 aa  KPSH1_PINFU RecName: Full=Serine/threonine-protein kinase H1
  352::571     4e-13  28%  683 aa  KPCL_HUMAN RecName: Full=Protein kinase C eta type;       
  199::460     4e-13  27%  749 aa  FHKD_DICDI RecName: Full=Probable serine/threonine-protein kinase
   10::256     4e-13  30%  454 aa  CIPKH_ORYSJ RecName: Full=CBL-interacting protein kinase 17;       
   15::240     4e-13  29%  469 aa  CIPKG_ARATH RecName: Full=CBL-interacting serine/threonine-protein
   69::283     4e-13  25%  490 aa  CDPKC_ARATH RecName: Full=Calcium-dependent protein kinase 12;     
  143::419     4e-13  27%  600 aa  CAMK1_ORYSJ RecName: Full=Calcium/calmodulin-dependent
   25::217     5e-13  27%  328 aa  TSSK4_MOUSE RecName: Full=Testis-specific serine/threonine-protein
   34::235     5e-13  27% 1235 aa  SLK_HUMAN RecName: Full=STE20-like serine/threonine-protein kinase;
 1059::1304    5e-13  26% 1338 aa  PYK3_DICDI RecName: Full=Dual specificity protein kinase pyk3;       
  124::327     5e-13  35%  474 aa  PMK3_CAEEL RecName: Full=Mitogen-activated protein kinase pmk-3;   
   20::212     5e-13  34%  396 aa  MPKC_ASPNC RecName: Full=Mitogen-activated protein kinase mpkC;    
   20::238     5e-13  34%  721 aa  MK06_CHICK RecName: Full=Mitogen-activated protein kinase 6;       
  100::230     5e-13  32% 1096 aa  MIG15_CAEEL RecName: Full=Serine/threonine-protein kinase mig-15;  
  238::437     5e-13  33%  497 aa  MEK1_YEAST RecName: Full=Meiosis-specific serine/threonine-protein
  104::358     5e-13  28%  954 aa  M3K10_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  375::594     5e-13  25%  707 aa  KPC1B_CAEEL RecName: Full=Protein kinase C-like 1B;       
  109::367     5e-13  29%  463 aa  JNK1_CAEEL RecName: Full=Stress-activated protein kinase jnk-1;    
   19::281     5e-13  30%  562 aa  DST3_DICDI RecName: Full=Serine/threonine-protein kinase dst3;     
  336::613     5e-13  26%  625 aa  CRK43_ARATH RecName: Full=Putative cysteine-rich receptor-like
  655::911     7e-13  27%  982 aa  TTK_DANRE RecName: Full=Dual specificity protein kinase Ttk;       
   45::302     7e-13  30%  560 aa  TOS3_YEAST RecName: Full=Serine/threonine-protein kinase TOS3;     
   45::302     7e-13  30%  560 aa  TOS3_YEAS7 RecName: Full=Serine/threonine-protein kinase TOS3;     
   36::289     7e-13  27%  968 aa  STK10_HUMAN RecName: Full=Serine/threonine-protein kinase 10;      
    4::254     7e-13  29%  343 aa  SRK2C_ARATH RecName: Full=Serine/threonine-protein kinase SRK2C;   
  207::345     7e-13  32%  432 aa  SGK1_CHICK RecName: Full=Serine/threonine-protein kinase Sgk1;     
    5::259     7e-13  28%  334 aa  SAPK3_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK3;   
    5::259     7e-13  28%  334 aa  SAPK3_ORYSI RecName: Full=Serine/threonine-protein kinase SAPK3;   
   94::303     7e-13  29%  423 aa  RLCK7_ARATH RecName: Full=Probable serine/threonine-protein kinase
   53::300     7e-13  25%  406 aa  PHKG2_RAT RecName: Full=Phosphorylase b kinase gamma catalytic
 2249::2510    7e-13  31% 3184 aa  PATS1_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1376::1642    7e-13  26% 1678 aa  PAKD_DICDI RecName: Full=Serine/threonine-protein kinase pakD;       
   36::314     7e-13  29%  658 aa  P2C31_ARATH RecName: Full=Protein kinase and PP2C-like
   14::245     7e-13  32%  549 aa  MK15_MOUSE RecName: Full=Mitogen-activated protein kinase 15;      
   27::222     7e-13  34%  367 aa  MK12_HUMAN RecName: Full=Mitogen-activated protein kinase 12;      
  426::698     7e-13  26%  745 aa  KS6A6_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-6;     
  351::543     7e-13  30%  669 aa  CRK35_ARATH RecName: Full=Putative cysteine-rich receptor-like
  372::559     7e-13  29%  690 aa  CRK12_ARATH RecName: Full=Putative cysteine-rich receptor-like
   22::281     7e-13  27%  441 aa  CIPK6_ARATH RecName: Full=CBL-interacting serine/threonine-protein
    4::276     7e-13  28%  433 aa  CDKF3_ORYSJ RecName: Full=Cyclin-dependent kinase F-3;       
    5::201     7e-13  30%  301 aa  CC2H1_TRYBB RecName: Full=Cell division control protein 2 homolog
 1181::1436    7e-13  25% 1478 aa  BCK1_YEAST RecName: Full=Serine/threonine-protein kinase
   23::287     9e-13  26%  508 aa  SMKY_MOUSE RecName: Full=Sperm motility kinase Y;       
  206::344     9e-13  31%  431 aa  SGK1_MACFA RecName: Full=Serine/threonine-protein kinase Sgk1;     
  206::344     9e-13  31%  431 aa  SGK1_HUMAN RecName: Full=Serine/threonine-protein kinase Sgk1;     
  440::646     9e-13  31%  801 aa  PUB34_ARATH RecName: Full=U-box domain-containing protein
    9::263     9e-13  21%  762 aa  PLK4_DROGR RecName: Full=Serine/threonine-protein kinase PLK4;     
  149::391     9e-13  31%  750 aa  PKNG_MYCTU RecName: Full=Probable serine/threonine-protein kinase
  149::391     9e-13  31%  750 aa  PKNG_MYCBO RecName: Full=Probable serine/threonine-protein kinase
   13::265     9e-13  23%  481 aa  MYLKE_DICDI RecName: Full=Probable myosin light chain kinase
   55::260     9e-13  31%  427 aa  MKNK1_MOUSE RecName: Full=MAP kinase-interacting
   26::222     9e-13  31%  384 aa  MK08_DANRE RecName: Full=Mitogen-activated protein kinase 8;       
  144::402     9e-13  29% 1161 aa  M3KSL_DROME RecName: Full=Mitogen-activated protein kinase kinase
  149::408     9e-13  27%  602 aa  CRK_DAUCA RecName: Full=CDPK-related protein kinase;       
   26::308     9e-13  25%  498 aa  CDPKM_ARATH RecName: Full=Calcium-dependent protein kinase 22;     
    4::199     9e-13  29%  342 aa  CDKL4_MOUSE RecName: Full=Cyclin-dependent kinase-like 4;       
   64::282     9e-13  26%  504 aa  CAMKV_RAT RecName: Full=CaM kinase-like vesicle-associated
   64::282     9e-13  26%  512 aa  CAMKV_MOUSE RecName: Full=CaM kinase-like vesicle-associated
   64::282     9e-13  26%  501 aa  CAMKV_HUMAN RecName: Full=CaM kinase-like vesicle-associated
   64::281     9e-13  25%  436 aa  CAMKV_DANRE RecName: Full=CaM kinase-like vesicle-associated
  166::424     1e-12  28% 1222 aa  WNK4_RAT RecName: Full=Serine/threonine-protein kinase WNK4;       
 1043::1308    1e-12  27% 1401 aa  WIS4_SCHPO RecName: Full=MAP kinase kinase kinase wis4;       
  203::336     1e-12  32%  427 aa  SGK2_HUMAN RecName: Full=Serine/threonine-protein kinase Sgk2;     
  206::344     1e-12  31%  431 aa  SGK1_BOVIN RecName: Full=Serine/threonine-protein kinase Sgk1;     
   33::305     1e-12  30%  371 aa  SAPK8_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK8;   
   60::308     1e-12  26%  550 aa  PPK21_SCHPO RecName: Full=Serine/threonine-protein kinase ppk21;   
    9::252     1e-12  26%  766 aa  PLK4_DROYA RecName: Full=Serine/threonine-protein kinase PLK4;     
    9::252     1e-12  26%  769 aa  PLK4_DROSI RecName: Full=Serine/threonine-protein kinase PLK4;     
    9::263     1e-12  21%  778 aa  PLK4_DROMO RecName: Full=Serine/threonine-protein kinase PLK4;     
    9::252     1e-12  26%  766 aa  PLK4_DROER RecName: Full=Serine/threonine-protein kinase PLK4;     
    1::284     1e-12  27%  388 aa  PHKG1_RAT RecName: Full=Phosphorylase b kinase gamma catalytic
    8::284     1e-12  28%  388 aa  PHKG1_MOUSE RecName: Full=Phosphorylase b kinase gamma catalytic
  130::320     1e-12  32%  515 aa  NLK_MOUSE RecName: Full=Serine/threonine protein kinase NLK;       
  130::320     1e-12  32%  515 aa  NLK_HUMAN RecName: Full=Serine/threonine protein kinase NLK;       
  300::554     1e-12  25%  608 aa  MYLK2_RABIT RecName: Full=Myosin light chain kinase 2,
   27::222     1e-12  33%  367 aa  MK12_RAT RecName: Full=Mitogen-activated protein kinase 12;        
   27::222     1e-12  33%  367 aa  MK12_MOUSE RecName: Full=Mitogen-activated protein kinase 12;      
  845::1116    1e-12  27% 1125 aa  KXCB_DICDI RecName: Full=Kinase and exchange factor for Rac B;       
   90::281     1e-12  28%  473 aa  GLKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  326::521     1e-12  28%  656 aa  CRK32_ARATH RecName: Full=Putative cysteine-rich receptor-like
  350::553     1e-12  28%  667 aa  CRK11_ARATH RecName: Full=Cysteine-rich receptor-like protein
   12::212     1e-12  31%  479 aa  CIPKA_ARATH RecName: Full=CBL-interacting serine/threonine-protein
    8::228     1e-12  32%  298 aa  CDC28_YEAST RecName: Full=Cell division control protein 28;        
  502::688     2e-12  31%  813 aa  Y5392_ARATH RecName: Full=Probable receptor-like protein kinase
  353::561     2e-12  27%  657 aa  WAKLQ_ARATH RecName: Full=Wall-associated receptor kinase-like 20; 
  390::590     2e-12  26%  720 aa  WAKLG_ARATH RecName: Full=Wall-associated receptor kinase-like 8;  
  206::344     2e-12  31%  431 aa  SGK1_RABIT RecName: Full=Serine/threonine-protein kinase Sgk1;     
  206::344     2e-12  31%  431 aa  SGK1_MOUSE RecName: Full=Serine/threonine-protein kinase Sgk1;     
 2166::2439    2e-12  30% 2800 aa  ROCO5_DICDI RecName: Full=Probable serine/threonine-protein kinase
  689::897     2e-12  30%  999 aa  RLK5_ARATH RecName: Full=Receptor-like protein kinase 5;       
  123::261     2e-12  31%  277 aa  PRKY_HUMAN RecName: Full=Serine/threonine-protein kinase PRKY;     
   42::284     2e-12  25%  406 aa  PHKG2_BOVIN RecName: Full=Phosphorylase b kinase gamma catalytic
    6::276     2e-12  29% 1305 aa  MYO3B_MOUSE RecName: Full=Myosin-IIIB;         EC=2.7.11.1;
   26::212     2e-12  34%  415 aa  MPKC_EMENI RecName: Full=Mitogen-activated protein kinase mpkC;    
   23::184     2e-12  37%  370 aa  MPKC_ASPTN RecName: Full=Mitogen-activated protein kinase mpkC;    
   20::294     2e-12  30%  365 aa  MK13_HUMAN RecName: Full=Mitogen-activated protein kinase 13;      
   25::222     2e-12  34%  363 aa  MK12_DANRE RecName: Full=Mitogen-activated protein kinase 12;      
  377::580     2e-12  30%  700 aa  KPC2_DROME RecName: Full=Protein kinase C, eye isozyme;       
   43::221     2e-12  30%  322 aa  KAPC_ENCCU RecName: Full=Probable cAMP-dependent protein kinase
   15::269     2e-12  30%  357 aa  HOG1_TRIAT RecName: Full=Mitogen-activated protein kinase hog1;    
  471::758     2e-12  29%  800 aa  FGFR4_RAT RecName: Full=Fibroblast growth factor receptor 4;       
   21::276     2e-12  27%  514 aa  CIPKP_ORYSJ RecName: Full=CBL-interacting protein kinase 25;       
  124::366     2e-12  27%  562 aa  CDPK3_PLAF7 RecName: Full=Calcium-dependent protein kinase 3;      
   60::318     2e-12  24%  524 aa  CDPK1_PLAFK RecName: Full=Calcium-dependent protein kinase 1;      
   60::318     2e-12  24%  524 aa  CDPK1_PLAF7 RecName: Full=Calcium-dependent protein kinase 1;      
    4::218     2e-12  29%  292 aa  CDK5_DICDI RecName: Full=Cell division protein kinase 5 homolog;   
  158::392     2e-12  28%  481 aa  AKT2_HUMAN RecName: Full=RAC-beta serine/threonine-protein kinase; 
    9::225     2e-12  28% 1051 aa  ULK1_MOUSE RecName: Full=Serine/threonine-protein kinase ULK1;     
  193::326     2e-12  33%  418 aa  SGK1_XENTR RecName: Full=Serine/threonine-protein kinase Sgk1;     
  206::339     2e-12  33%  431 aa  SGK1_FUNHE RecName: Full=Serine/threonine-protein kinase Sgk1;     
  208::341     2e-12  33%  433 aa  SGK1_DANRE RecName: Full=Serine/threonine-protein kinase Sgk1;     
  209::346     2e-12  31%  434 aa  SGK1B_XENLA RecName: Full=Serine/threonine-protein kinase Sgk1-B;  
  120::259     2e-12  31%  355 aa  PRKX_MOUSE RecName: Full=Serine/threonine-protein kinase PRKX;     
  108::350     2e-12  29%  677 aa  PMY13_CAEEL RecName: Full=Membrane-associated tyrosine- and
    9::263     2e-12  23%  777 aa  PLK4_DROPS RecName: Full=Serine/threonine-protein kinase PLK4;     
    9::263     2e-12  23%  777 aa  PLK4_DROPE RecName: Full=Serine/threonine-protein kinase PLK4;     
 7518::7664    2e-12  29% 8891 aa  OBSCN_MOUSE RecName: Full=Obscurin;         EC=2.7.11.1;AltName:
  696::893     2e-12  27% 1147 aa  MYLK_RABIT RecName: Full=Myosin light chain kinase, smooth muscle; 
  725::922     2e-12  27% 1176 aa  MYLK_BOVIN RecName: Full=Myosin light chain kinase, smooth muscle; 
   38::225     2e-12  31%  368 aa  MPK7_ARATH RecName: Full=Mitogen-activated protein kinase 7;       
   65::330     2e-12  28%  342 aa  MOS_MSVTS RecName: Full=Serine/threonine-protein
  143::388     2e-12  29% 1077 aa  M3K9_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  345::580     2e-12  26%  672 aa  KPCA_MOUSE RecName: Full=Protein kinase C alpha type;       
    4::197     2e-12  28%  292 aa  CDK5_RAT RecName: Full=Cell division protein kinase 5;       
    9::199     2e-12  29%  288 aa  CDC2H_PLAFK RecName: Full=Cell division control protein 2 homolog; 
    9::199     2e-12  29%  288 aa  CDC2H_PLAF7 RecName: Full=Cell division control protein 2 homolog; 
   46::236     2e-12  28%  345 aa  CC2H2_TRYBB RecName: Full=Cell division control protein 2 homolog
  326::573     3e-12  30%  605 aa  WIS1_SCHPO RecName: Full=Protein kinase wis1;       
  206::443     3e-12  28%  607 aa  SID2_SCHPO RecName: Full=Serine/threonine-protein kinase sid2;     
  209::342     3e-12  32%  434 aa  SGK1A_XENLA RecName: Full=Serine/threonine-protein kinase Sgk1-A;  
  374::557     3e-12  30%  696 aa  SCK1_SCHPO RecName: Full=Serine/threonine-protein kinase sck1;     
    4::288     3e-12  26%  342 aa  SAPK1_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK1;   
    9::252     3e-12  25%  770 aa  PLK4_DROAN RecName: Full=Serine/threonine-protein kinase PLK4;     
    7::253     3e-12  24%  761 aa  PLK4_CULQU RecName: Full=Serine/threonine-protein kinase PLK4;     
  994::1264    3e-12  28% 1323 aa  PASK_HUMAN RecName: Full=PAS domain-containing
   71::261     3e-12  31%  454 aa  NLK2_XENTR RecName: Full=Serine/threonine protein kinase NLK2;     
   64::254     3e-12  31%  447 aa  NLK2_XENLA RecName: Full=Serine/threonine protein kinase NLK2;     
   27::287     3e-12  28%  944 aa  NEK9_XENLA RecName: Full=Serine/threonine-protein kinase Nek9;     
 1486::1683    3e-12  27% 1941 aa  MYLK_MOUSE RecName: Full=Myosin light chain kinase, smooth muscle;   
   15::212     3e-12  33%  380 aa  MPKC_ASPCL RecName: Full=Mitogen-activated protein kinase mpkC;    
   64::250     3e-12  31%  464 aa  MK10_RAT RecName: Full=Mitogen-activated protein kinase 10;        
  175::327     3e-12  36%  356 aa  M2K6_ARATH RecName: Full=Mitogen-activated protein kinase kinase 6;
   75::320     3e-12  29%  348 aa  M2K5_ARATH RecName: Full=Mitogen-activated protein kinase kinase 5;
   80::322     3e-12  27%  752 aa  KS6AA_CHICK RecName: Full=Ribosomal protein S6 kinase 2 alpha;     
  418::670     3e-12  27%  735 aa  KS6A1_RAT RecName: Full=Ribosomal protein S6 kinase alpha-1;       
  345::556     3e-12  27%  672 aa  KPCA_RABIT RecName: Full=Protein kinase C alpha type;       
  198::435     3e-12  26%  512 aa  KAPB_SCHPO RecName: Full=cAMP-dependent protein kinase catalytic
   87::324     3e-12  26%  397 aa  KAPA_YEAST RecName: Full=cAMP-dependent protein kinase type 1;     
   15::269     3e-12  30%  356 aa  HOG1_TRIHA RecName: Full=Mitogen-activated protein kinase hog1;    
   15::269     3e-12  30%  358 aa  HOG1_BEABA RecName: Full=Mitogen-activated protein kinase HOG1;    
    9::200     3e-12  28%  289 aa  CDC2H_PLAYO RecName: Full=Cell division control protein 2 homolog; 
 1117::1368    3e-12  28% 1460 aa  ARKA_DICDI RecName: Full=Ankyrin repeat-containing protein kinase A; 
  158::392     3e-12  28%  481 aa  AKT2_RAT RecName: Full=RAC-beta serine/threonine-protein kinase;   
  163::397     3e-12  28%  486 aa  AKT2A_XENLA RecName: Full=RAC-beta serine/threonine-protein kinase
    2::218     3e-12  26% 1037 aa  ULK2_MOUSE RecName: Full=Serine/threonine-protein kinase ULK2;     
    9::225     3e-12  28% 1050 aa  ULK1_HUMAN RecName: Full=Serine/threonine-protein kinase ULK1;     
  749::1019    3e-12  26% 1021 aa  PSKR1_DAUCA RecName: Full=Phytosulfokine receptor 1;       
    9::283     3e-12  22%  787 aa  PLK4_DROWI RecName: Full=Serine/threonine-protein kinase PLK4;     
  127::265     3e-12  35%  726 aa  PKH3_ASHGO RecName: Full=Serine/threonine-protein kinase PKH3;     
    9::241     3e-12  25%  417 aa  PKAB_STRCO RecName: Full=Serine/threonine-protein kinase pkaB;     
  115::256     3e-12  30%  841 aa  NEK4_HUMAN RecName: Full=Serine/threonine-protein kinase Nek4;     
   25::256     3e-12  31%  344 aa  MPKC_ASPOR RecName: Full=Mitogen-activated protein kinase mpkC;    
   14::238     3e-12  33%  547 aa  MK15_RAT RecName: Full=Mitogen-activated protein kinase 15;        
   20::294     3e-12  32%  366 aa  MK13_MOUSE RecName: Full=Mitogen-activated protein kinase 13;      
   26::216     3e-12  31%  427 aa  MK08A_CYPCA RecName: Full=Mitogen-activated protein kinase 8A;     
  150::395     3e-12  29% 1104 aa  M3K9_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  214::360     3e-12  35%  592 aa  KSG1_SCHPO RecName: Full=Serine/threonine-protein kinase ksg1;     
  415::667     3e-12  27%  733 aa  KS6A2_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-2;     
  345::556     3e-12  27%  672 aa  KPCA_RAT RecName: Full=Protein kinase C alpha type;       
  345::556     3e-12  27%  672 aa  KPCA_HUMAN RecName: Full=Protein kinase C alpha type;       
  345::556     3e-12  27%  672 aa  KPCA_BOVIN RecName: Full=Protein kinase C alpha type;       
   26::269     3e-12  30%  365 aa  HOG1_CRYNV RecName: Full=Mitogen-activated protein kinase HOG1;    
   26::269     3e-12  30%  365 aa  HOG1_CRYNE RecName: Full=Mitogen-activated protein kinase HOG1;    
   26::212     3e-12  32%  364 aa  HOG1_COCIM RecName: Full=Mitogen-activated protein kinase HOG1;    
    4::199     3e-12  29%  315 aa  CDKL4_HUMAN RecName: Full=Cyclin-dependent kinase-like 4;       
    4::197     3e-12  28%  292 aa  CDK5_MOUSE RecName: Full=Cell division protein kinase 5;       
    4::197     3e-12  28%  292 aa  CDK5_HUMAN RecName: Full=Cell division protein kinase 5;       
    4::197     3e-12  28%  292 aa  CDK5_BOVIN RecName: Full=Cell division protein kinase 5;       
    9::198     3e-12  30%  305 aa  CDK3_HUMAN RecName: Full=Cell division protein kinase 3;       
    4::239     3e-12  33%  323 aa  CDC2_EMENI RecName: Full=Cell division control protein 2;       
   10::197     3e-12  32%  296 aa  CDC28_ENCCU RecName: Full=Probable cell division control protein 28
   31::247     4e-12  30%  328 aa  YBC9_ENCCU RecName: Full=Probable cell division protein kinase
  339::559     4e-12  28%  708 aa  WAKLO_ARATH RecName: Full=Wall-associated receptor kinase-like 14; 
   18::216     4e-12  27%  367 aa  TSSK1_BOVIN RecName: Full=Testis-specific serine/threonine-protein
33040::33295   4e-12  28% 35213 aa  TITIN_MOUSE RecName: Full=Titin;         EC=2.7.11.1;AltName:
32178::32435   4e-12  27% 34350 aa  TITIN_HUMAN RecName: Full=Titin;         EC=2.7.11.1;AltName:
  740::1003    4e-12  28% 1008 aa  PSKR1_ARATH RecName: Full=Phytosulfokine receptor 1;       
  108::349     4e-12  26%  548 aa  PMYT1_XENLA RecName: Full=Membrane-associated tyrosine- and
    9::252     4e-12  27%  769 aa  PLK4_DROSE RecName: Full=Serine/threonine-protein kinase PLK4;     
  676::917     4e-12  24%  992 aa  PK4_DICDI RecName: Full=Protein kinase 4;       
   64::280     4e-12  30%  393 aa  MPK10_ARATH RecName: Full=Mitogen-activated protein kinase 10;     
   67::329     4e-12  26%  345 aa  MOS_PIG RecName: Full=Proto-oncogene serine/threonine-protein
  130::274     4e-12  29%  961 aa  LIN2_CAEEL RecName: Full=Protein lin-2;AltName: Full=Abnormal cell
  409::619     4e-12  28%  743 aa  KPC2_APLCA RecName: Full=Calcium-independent protein kinase C;     
  125::353     4e-12  30%  505 aa  KKCC1_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
   33::310     4e-12  27%  579 aa  KINY_DICDI RecName: Full=Probable serine/threonine-protein kinase
   88::342     4e-12  25%  390 aa  HT1_ARATH RecName: Full=Serine/threonine-protein kinase HT1;       
  625::890     4e-12  27% 1142 aa  FHKB_DICDI RecName: Full=Probable serine/threonine-protein kinase
   26::278     4e-12  24%  370 aa  DAPK2_HUMAN RecName: Full=Death-associated protein kinase 2;       
   12::271     4e-12  29%  466 aa  CIPKK_ORYSJ RecName: Full=CBL-interacting protein kinase 20;       
    4::197     4e-12  28%  292 aa  CDK5_XENLA RecName: Full=Cell division protein kinase 5;       
    4::227     4e-12  30%  298 aa  CDC2H_THEAN RecName: Full=Cell division control protein 2 homolog; 
  158::392     4e-12  28%  481 aa  AKT2_MOUSE RecName: Full=RAC-beta serine/threonine-protein kinase; 
    4::276     6e-12  27%  507 aa  Y8078_DICDI RecName: Full=Probable serine/threonine-protein kinase
  335::534     6e-12  30%  654 aa  Y1839_ARATH RecName: Full=Probable serine/threonine-protein kinase
    2::218     6e-12  25% 1036 aa  ULK2_HUMAN RecName: Full=Serine/threonine-protein kinase ULK2;     
  401::598     6e-12  29%  703 aa  SRF8_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY
  567::764     6e-12  28%  868 aa  RLK7_ARATH RecName: Full=Receptor-like protein kinase At5g59670;   
  163::411     6e-12  23%  978 aa  PLK_DICDI RecName: Full=Probable serine/threonine-protein kinase
    9::252     6e-12  25%  769 aa  PLK4_DROME RecName: Full=Serine/threonine-protein kinase PLK4;     
  576::747     6e-12  31%  910 aa  PK3_DICDI RecName: Full=Protein kinase 3;         Short=PK3;       
   42::224     6e-12  30%  369 aa  MPK5_ORYSJ RecName: Full=Mitogen-activated protein kinase 5;       
   42::224     6e-12  30%  369 aa  MPK5_ORYSI RecName: Full=Mitogen-activated protein kinase 5;       
   21::232     6e-12  28%  370 aa  MAPK1_PNECA RecName: Full=Mitogen-activated protein kinase 1;      
  368::643     6e-12  28%  650 aa  LIMK_DICDI RecName: Full=Probable LIM domain-containing
  407::659     6e-12  27%  724 aa  KS6A1_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-1;     
   25::356     6e-12  30%  435 aa  KIN3_YEAST RecName: Full=Serine/threonine-protein kinase KIN3;     
  237::424     6e-12  31% 1625 aa  KEG_ARATH RecName: Full=E3 ubiquitin-protein ligase KEG;       
  217::420     6e-12  30%  710 aa  IRAK1_MOUSE RecName: Full=Interleukin-1 receptor-associated kinase
  682::892     6e-12  29%  996 aa  HSL1_ARATH RecName: Full=Receptor-like protein kinase HSL1;        
   15::269     6e-12  29%  358 aa  HOG1_NEUCR RecName: Full=Mitogen-activated protein kinase hog-1;   
   15::269     6e-12  29%  357 aa  HOG1_GLOLA RecName: Full=Mitogen-activated protein kinase HOG1;    
    9::198     6e-12  31%  303 aa  CDK3_MOUSE RecName: Full=Cell division protein kinase 3;       
    9::199     6e-12  29%  288 aa  CDC2H_PLAKH RecName: Full=Cell division control protein 2 homolog; 
   64::283     6e-12  25%  377 aa  CAMKV_XENLA RecName: Full=CaM kinase-like vesicle-associated
    4::217     8e-12  26%  309 aa  Y8H9_ENCCU RecName: Full=Probable cell division protein kinase
  536::757     8e-12  28% 1505 aa  Y8013_DICDI RecName: Full=Probable serine/threonine-protein kinase
   36::253     8e-12  28%  439 aa  WNK6_ORYSJ RecName: Full=Probable serine/threonine-protein kinase
  303::527     8e-12  26%  620 aa  WAKLR_ARATH RecName: Full=Wall-associated receptor kinase-like 21; 
 1269::1553    8e-12  30% 1579 aa  SSK2_YEAST RecName: Full=MAP kinase kinase kinase SSK2;       
  107::347     8e-12  25%  533 aa  PMYT1_DROME RecName: Full=Membrane-associated tyrosine- and
  158::345     8e-12  31%  763 aa  PKNG_MYCLE RecName: Full=Probable serine/threonine-protein kinase
   43::248     8e-12  31%  413 aa  MKNK1_RAT RecName: Full=MAP kinase-interacting
   20::294     8e-12  31%  366 aa  MK13_RAT RecName: Full=Mitogen-activated protein kinase 13;        
   26::222     8e-12  30%  427 aa  MK08B_CYPCA RecName: Full=Mitogen-activated protein kinase 8B;     
  101::231     8e-12  33% 1233 aa  M4K4_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
   17::262     8e-12  26%  393 aa  M3K7L_DROME RecName: Full=Putative mitogen-activated protein kinase
  667::931     8e-12  30%  950 aa  KSR2_HUMAN RecName: Full=Kinase suppressor of Ras 2;       
   49::301     8e-12  27%  802 aa  KS6A5_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-5;     
  454::705     8e-12  26%  784 aa  KS6A1_CAEEL RecName: Full=Putative ribosomal protein S6 kinase
   29::237     8e-12  35%  387 aa  HOG1_DEBHA RecName: Full=Mitogen-activated protein kinase HOG1;    
  186::474     8e-12  30%  593 aa  FHKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
    4::281     8e-12  27%  459 aa  CDKF4_ORYSJ RecName: Full=Cyclin-dependent kinase F-4;       
    9::196     8e-12  28%  288 aa  CDC2H_PLAVI RecName: Full=Cell division control protein 2 homolog; 
  405::621     8e-12  29%  780 aa  CD2L2_HUMAN RecName: Full=PITSLRE serine/threonine-protein kinase
  864::1061    8e-12  29% 1164 aa  BRL3_ARATH RecName: Full=Receptor-like protein kinase BRI1-like 3;   
  830::1042    8e-12  27% 1143 aa  BRL2_ARATH RecName: Full=Serine/threonine-protein kinase BRI1-like 2;
    6::248     8e-12  28%  796 aa  ATG1_PICPA RecName: Full=Serine/threonine-protein kinase ATG1;     
  373::618     8e-12  25% 1620 aa  ABL_DROME RecName: Full=Tyrosine-protein kinase Abl;       
   49::314     1e-11  25%  628 aa  TESK1_RAT RecName: Full=Dual specificity testis-specific protein
   99::345     1e-11  28%  362 aa  SRK2_SPOLA RecName: Full=Tyrosine-protein kinase SRK2;       
    9::261     1e-11  24%  505 aa  SPKD_SYNY3 RecName: Full=Serine/threonine-protein kinase D;        
   76::297     1e-11  30% 1369 aa  ROCK1_RAT RecName: Full=Rho-associated protein kinase 1;       
   76::297     1e-11  30% 1354 aa  ROCK1_RABIT RecName: Full=Rho-associated protein kinase 1;       
   76::297     1e-11  30% 1354 aa  ROCK1_MOUSE RecName: Full=Rho-associated protein kinase 1;       
   76::297     1e-11  30% 1354 aa  ROCK1_HUMAN RecName: Full=Rho-associated protein kinase 1;       
   10::252     1e-11  26%  627 aa  NEK5_MOUSE RecName: Full=Serine/threonine-protein kinase Nek5;     
  514::779     1e-11  28% 1111 aa  NEK10_MOUSE RecName: Full=Serine/threonine-protein kinase Nek10;   
 1453::1650    1e-11  26% 1906 aa  MYLK_CHICK RecName: Full=Myosin light chain kinase, smooth muscle;   
   96::362     1e-11  29%  376 aa  MOS_MSVMM RecName: Full=Serine/threonine-protein
   96::362     1e-11  29%  374 aa  MOS_MSVMH RecName: Full=Serine/threonine-protein
   35::236     1e-11  30%  371 aa  MMK2_MEDSA RecName: Full=Mitogen-activated protein kinase homolog
   20::294     1e-11  30%  366 aa  MK13_BOVIN RecName: Full=Mitogen-activated protein kinase 13;      
  124::369     1e-11  28% 1005 aa  M3K10_XENLA RecName: Full=Mitogen-activated protein kinase kinase
  677::941     1e-11  30%  959 aa  KSR2_MOUSE RecName: Full=Kinase suppressor of Ras 2;
   68::262     1e-11  29%  629 aa  KS6AB_XENLA RecName: Full=Ribosomal protein S6 kinase 2 beta;      
   48::300     1e-11  27%  863 aa  KS6A5_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-5;     
  415::667     1e-11  27%  733 aa  KS6A2_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-2;     
  830::1066    1e-11  28% 1151 aa  KPC1_YEAST RecName: Full=Protein kinase C-like 1;         Short=PKC
   26::269     1e-11  30%  386 aa  HOG1_YARLI RecName: Full=Mitogen-activated protein kinase HOG1;    
   26::269     1e-11  29%  358 aa  HOG1_USTMA RecName: Full=Mitogen-activated protein kinase HOG1;    
   15::212     1e-11  31%  359 aa  HOG1_HORWE RecName: Full=Mitogen-activated protein kinase HOG1;    
   12::265     1e-11  25%  439 aa  CIPKE_ORYSJ RecName: Full=CBL-interacting protein kinase 14;       
   10::221     1e-11  34%  296 aa  CDC2_DICDI RecName: Full=Cell division control protein 2 homolog;  
    4::199     1e-11  30%  298 aa  CDC2H_THEPA RecName: Full=Cell division control protein 2 homolog; 
    9::199     1e-11  29%  288 aa  CDC2H_PLACH RecName: Full=Cell division control protein 2 homolog; 
    9::199     1e-11  29%  288 aa  CDC2H_PLABA RecName: Full=Cell division control protein 2 homolog; 
   10::268     1e-11  29%  990 aa  ATG1_USTMA RecName: Full=Serine/threonine-protein kinase ATG1;     
   21::276     1e-11  29%  935 aa  ATG1_EMENI RecName: Full=Serine/threonine-protein kinase atg1;     
 1480::1750    1e-11  27% 1761 aa  Y9844_DICDI RecName: Full=Probable serine/threonine-protein kinase
   18::216     1e-11  26%  364 aa  TSSK1_MOUSE RecName: Full=Testis-specific serine/threonine-protein
 2732::2971    1e-11  23% 3028 aa  TRIO_DANRE RecName: Full=Triple functional domain protein;       
  268::537     1e-11  24%  557 aa  SRC_AVIST RecName: Full=Tyrosine-protein kinase transforming
    4::253     1e-11  27%  585 aa  NEK3_ORYSJ RecName: Full=Serine/threonine-protein kinase Nek3;     
  514::729     1e-11  29% 1172 aa  NEK10_HUMAN RecName: Full=Serine/threonine-protein kinase Nek10;   
  112::378     1e-11  29%  390 aa  MOS_MOUSE RecName: Full=Proto-oncogene serine/threonine-protein
   64::250     1e-11  30%  464 aa  MK10_MOUSE RecName: Full=Mitogen-activated protein kinase 10;      
   64::250     1e-11  30%  464 aa  MK10_HUMAN RecName: Full=Mitogen-activated protein kinase 10;      
   16::217     1e-11  27%  351 aa  MAPK2_PNECA RecName: Full=Mitogen-activated protein kinase 2;      
  102::232     1e-11  33% 1239 aa  M4K4_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
 1347::1595    1e-11  27% 1607 aa  M3K4_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  405::670     1e-11  29%  947 aa  M3K14_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  166::459     1e-11  26%  476 aa  LOK_DROME RecName: Full=Ovarian-specific serine/threonine-protein
  446::698     1e-11  25%  764 aa  KS6A6_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-6;     
  417::670     1e-11  26%  740 aa  KS6A3_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-3;     
  417::670     1e-11  26%  740 aa  KS6A3_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-3;     
  331::537     1e-11  27%  658 aa  KPC1_LYTPI RecName: Full=Protein kinase C;         EC=2.7.11.13;
  185::437     1e-11  26% 1081 aa  KOK0_YEAST RecName: Full=Probable serine/threonine-protein kinase
   85::316     1e-11  27%  398 aa  KAPC_YEAST RecName: Full=cAMP-dependent protein kinase type 3;     
   14::272     1e-11  29%  376 aa  JNK1_ANCCA RecName: Full=Stress-activated protein kinase JNK-1;    
   20::212     1e-11  32%  349 aa  HOG1_SCHPO RecName: Full=Mitogen-activated protein kinase sty1;    
   15::212     1e-11  30%  358 aa  HOG1_CRYPA RecName: Full=Mitogen-activated protein kinase HOG1;    
   15::212     1e-11  30%  354 aa  HOG1_COCMI RecName: Full=Mitogen-activated protein kinase HOG1;    
   15::212     1e-11  30%  355 aa  HOG1_COCHE RecName: Full=Mitogen-activated protein kinase HOG1;    
  470::757     1e-11  29%  799 aa  FGFR4_MOUSE RecName: Full=Fibroblast growth factor receptor 4;     
  473::760     1e-11  29%  802 aa  FGFR4_HUMAN RecName: Full=Fibroblast growth factor receptor 4;     
   26::278     1e-11  24%  370 aa  DAPK2_MOUSE RecName: Full=Death-associated protein kinase 2;       
   12::265     1e-11  25%  434 aa  CIPKF_ORYSJ RecName: Full=CBL-interacting protein kinase 15;       
   28::292     1e-11  24%  484 aa  CDPKV_ARATH RecName: Full=Calcium-dependent protein kinase 31;     
  115::317     1e-11  24%  535 aa  CDPK1_PLAYO RecName: Full=Calcium-dependent protein kinase 1;      
  420::636     1e-11  29%  795 aa  CD2L1_HUMAN RecName: Full=PITSLRE serine/threonine-protein kinase
  259::439     2e-11  31% 1090 aa  Y0133_DICDI RecName: Full=Probable serine/threonine-protein kinase
   66::220     2e-11  31%  856 aa  UNC51_CAEEL RecName: Full=Serine/threonine-protein kinase unc-51;  
  241::486     2e-11  26%  509 aa  STK_HYDAT RecName: Full=Tyrosine-protein kinase STK;       
   57::246     2e-11  29%  574 aa  SPKB_SYNY3 RecName: Full=Serine/threonine-protein kinase B;        
  154::269     2e-11  35%  363 aa  SKH1_SCHPO RecName: Full=MAP kinase kinase skh1/pek1;       
  578::868     2e-11  27%  876 aa  SIRK_ARATH RecName: Full=Senescence-induced receptor-like
  114::259     2e-11  34% 1123 aa  NEK3_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1337::1585    2e-11  27% 1597 aa  M3K4_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  239::451     2e-11  28%  592 aa  KPCZ_RAT RecName: Full=Protein kinase C zeta type;       
  239::451     2e-11  28%  592 aa  KPCZ_MOUSE RecName: Full=Protein kinase C zeta type;       
  239::451     2e-11  28%  592 aa  KPCZ_HUMAN RecName: Full=Protein kinase C zeta type;       
  309::572     2e-11  23%  634 aa  KPC3_DROME RecName: Full=Protein kinase C;         Short=PKC;      
 1048::1303    2e-11  25% 1477 aa  HTK7_HYDAT RecName: Full=Putative insulin-like peptide receptor;     
  423::675     2e-11  24% 1055 aa  FAK1_RAT RecName: Full=Focal adhesion kinase 1;         Short=FADK
  461::713     2e-11  24% 1090 aa  FAK1_MOUSE RecName: Full=Focal adhesion kinase 1;       
  282::474     2e-11  27%  593 aa  CTK1_SCHPO RecName: Full=CTD kinase subunit alpha;       
  342::537     2e-11  28%  659 aa  CRK18_ARATH RecName: Full=Cysteine-rich receptor-like protein
   70::345     2e-11  23%  528 aa  CDPK4_PLAYO RecName: Full=Calcium-dependent protein kinase 4;      
   70::345     2e-11  23%  528 aa  CDPK4_PLABA RecName: Full=Calcium-dependent protein kinase 4;      
    9::194     2e-11  33%  298 aa  CDK2_CARAU RecName: Full=Cell division protein kinase 2;       
   40::300     2e-11  26%  745 aa  ANKK1_MOUSE RecName: Full=Ankyrin repeat and protein kinase
  235::368     2e-11  30%  456 aa  Y2070_DICDI RecName: Full=Probable serine/threonine-protein kinase
   34::229     2e-11  29%  567 aa  WNK6_ARATH RecName: Full=Probable serine/threonine-protein kinase
   37::284     2e-11  27%  314 aa  WNK11_ARATH RecName: Full=Probable serine/threonine-protein kinase
   54::319     2e-11  25%  626 aa  TESK1_HUMAN RecName: Full=Dual specificity testis-specific protein
   23::219     2e-11  29%  362 aa  SRK2D_ARATH RecName: Full=Serine/threonine-protein kinase SRK2D;   
  268::515     2e-11  28%  526 aa  SRC_RSVSA RecName: Full=Tyrosine-protein kinase transforming
  268::515     2e-11  28%  526 aa  SRC_AVISR RecName: Full=Tyrosine-protein kinase transforming
 2965::3222    2e-11  21% 3267 aa  SPEG_HUMAN RecName: Full=Striated muscle preferentially expressed
   92::313     2e-11  28% 1388 aa  ROCK2_BOVIN RecName: Full=Rho-associated protein kinase 2;       
   81::346     2e-11  29%  370 aa  PIM2_MOUSE RecName: Full=Serine/threonine-protein kinase Pim-2;    
  366::623     2e-11  29%  668 aa  PBS2_YEAST RecName: Full=MAP kinase kinase PBS2;       
    4::253     2e-11  25%  568 aa  NEK3_ARATH RecName: Full=Serine/threonine-protein kinase Nek3;     
  521::712     2e-11  28%  819 aa  MYLK3_PONAB RecName: Full=Putative myosin light chain kinase 3;    
  521::712     2e-11  28%  819 aa  MYLK3_HUMAN RecName: Full=Putative myosin light chain kinase 3;    
  579::828     2e-11  27% 2626 aa  MAST4_HUMAN RecName: Full=Microtubule-associated
  353::618     2e-11  28%  662 aa  LIMK1_CHICK RecName: Full=LIM domain kinase 1;       
   62::304     2e-11  26%  735 aa  KS6A1_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-1;     
   35::241     2e-11  28%  337 aa  KAPC_ASCSU RecName: Full=cAMP-dependent protein kinase catalytic
  666::966     2e-11  25%  991 aa  IKU2_ARATH RecName: Full=Receptor-like protein kinase HAIKU2;      
   52::324     2e-11  22%  691 aa  HUNKA_XENLA RecName: Full=Hormonally up-regulated neu
   15::212     2e-11  30%  355 aa  HOG1_ALTBR RecName: Full=Mitogen-activated protein kinase HOG1;    
 1297::1502    2e-11  34% 1577 aa  GDT9_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1058::1291    2e-11  24% 1326 aa  GDT8_DICDI RecName: Full=Probable serine/threonine-protein kinase
  938::1135    2e-11  28% 1321 aa  FNKE_DICDI RecName: Full=Probable serine/threonine-protein kinase
  423::675     2e-11  24% 1052 aa  FAK1_HUMAN RecName: Full=Focal adhesion kinase 1;       
  149::343     2e-11  32%  529 aa  ERK1_DICDI RecName: Full=Extracellular signal-regulated kinase 1;  
  357::557     2e-11  27%  686 aa  CRK17_ARATH RecName: Full=Cysteine-rich receptor-like protein
  108::370     2e-11  27%  571 aa  CDPKG_ARATH RecName: Full=Calcium-dependent protein kinase 16;     
   70::345     2e-11  23%  528 aa  CDPK4_PLAF7 RecName: Full=Calcium-dependent protein kinase 4;      
   10::200     2e-11  26%  566 aa  CDKL2_RABIT RecName: Full=Cyclin-dependent kinase-like 2;       
    4::208     2e-11  33%  327 aa  CDKF2_ORYSJ RecName: Full=Putative cyclin-dependent kinase F-2;    
    4::195     2e-11  32%  294 aa  CDKA1_ARATH RecName: Full=Cyclin-dependent kinase A-1;       
  295::574     2e-11  28%  615 aa  BAK1_ARATH RecName: Full=BRASSINOSTEROID INSENSITIVE 1-associated
  494::692     3e-11  28%  834 aa  Y2232_ARATH RecName: Full=Probable receptor-like protein kinase
  594::789     3e-11  27%  942 aa  TMK1_ARATH RecName: Full=Probable receptor protein kinase TMK1;    
  410::602     3e-11  26%  699 aa  SRF5_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY
  268::515     3e-11  28%  526 aa  SRC_RSVSE RecName: Full=Tyrosine-protein kinase transforming
   83::304     3e-11  28% 1379 aa  ROCK2_RAT RecName: Full=Rho-associated protein kinase 2;       
   92::313     3e-11  28% 1388 aa  ROCK2_MOUSE RecName: Full=Rho-associated protein kinase 2;       
   92::313     3e-11  28% 1388 aa  ROCK2_HUMAN RecName: Full=Rho-associated protein kinase 2;       
   15::221     3e-11  33%  389 aa  PKNS_MYCPN RecName: Full=Putative serine/threonine-protein kinase; 
    8::242     3e-11  37%  339 aa  PDK1A_XENLA RecName: Full=Serine/threonine-protein kinase pdik1l-A;
    8::257     3e-11  28%  943 aa  NEK4_ORYSJ RecName: Full=Serine/threonine-protein kinase Nek4;     
    4::253     3e-11  26%  606 aa  NEK2_ARATH RecName: Full=Serine/threonine-protein kinase Nek2;     
   41::242     3e-11  29%  376 aa  MPK5_ARATH RecName: Full=Mitogen-activated protein kinase 5;       
   20::220     3e-11  34%  361 aa  MK14B_CYPCA RecName: Full=Mitogen-activated protein kinase 14b;    
  244::422     3e-11  33% 1036 aa  M3KL4_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  634::835     3e-11  29%  921 aa  KSR1_HUMAN RecName: Full=Kinase suppressor of Ras 1;
   49::301     3e-11  26%  802 aa  KS6A5_PONAB RecName: Full=Ribosomal protein S6 kinase alpha-5;     
   15::205     3e-11  30%  355 aa  HOG1_PHANO RecName: Full=Mitogen-activated protein kinase HOG1;    
   15::212     3e-11  31%  357 aa  HOG1_BLUGR RecName: Full=Mitogen-activated protein kinase HOG1;    
   15::205     3e-11  32%  364 aa  HOG1_ASPTN RecName: Full=Mitogen-activated protein kinase hog1;    
   15::212     3e-11  31%  365 aa  HOG1_ASPCL RecName: Full=Mitogen-activated protein kinase hog1;    
    4::216     3e-11  29%  722 aa  FIN1_SCHPO RecName: Full=G2-specific protein kinase fin1;       
  436::688     3e-11  24% 1068 aa  FAK1_XENLA RecName: Full=Focal adhesion kinase 1;       
    9::213     3e-11  27%  496 aa  CHK1_SCHPO RecName: Full=Serine/threonine-protein kinase chk1;     
    4::193     3e-11  28%  292 aa  CDK5_GLOMM RecName: Full=Cell division protein kinase 5 homolog;   
    9::198     3e-11  29%  298 aa  CDK2_CRIGR RecName: Full=Cell division protein kinase 2;       
    9::198     3e-11  29%  298 aa  CDK2_BOVIN RecName: Full=Cell division protein kinase 2;       
    4::206     3e-11  32%  305 aa  CDC2C_ANTMA RecName: Full=Cell division control protein 2 homolog
    4::284     3e-11  28%  710 aa  ATG1_YARLI RecName: Full=Serine/threonine-protein kinase ATG1;     
   24::324     3e-11  28% 1007 aa  ATG1_ASPNC RecName: Full=Serine/threonine-protein kinase atg1;     
  358::594     4e-11  25%  597 aa  Y9863_DICDI RecName: Full=Probable serine/threonine-protein kinase
  146::298     4e-11  34%  784 aa  Y2666_DROME RecName: Full=Probable serine/threonine-protein kinase
   34::273     4e-11  29%  621 aa  WNK2_ORYSJ RecName: Full=Probable serine/threonine-protein kinase
   49::309     4e-11  25%  627 aa  TESK1_MOUSE RecName: Full=Dual specificity testis-specific protein
   22::218     4e-11  30%  361 aa  SRK2I_ARATH RecName: Full=Serine/threonine-protein kinase SRK2I;   
    1::251     4e-11  24%  484 aa  SMOK1_MOUSE RecName: Full=Sperm motility kinase 1;       
  308::501     4e-11  29%  625 aa  SERK1_ARATH RecName: Full=Somatic embryogenesis receptor kinase 1; 
  305::464     4e-11  32%  563 aa  RK_HUMAN RecName: Full=Rhodopsin kinase;         Short=RK;       
  745::1031    4e-11  25% 1036 aa  PSKR2_ARATH RecName: Full=Phytosulfokine receptor 2;       
  118::326     4e-11  31%  354 aa  PPK34_SCHPO RecName: Full=Serine/threonine-protein kinase ppk34;   
  170::378     4e-11  30%  496 aa  PCTK1_RAT RecName: Full=Serine/threonine-protein kinase PCTAIRE-1; 
   25::229     4e-11  33%  598 aa  MPK19_ARATH RecName: Full=Mitogen-activated protein kinase 19;     
   13::212     4e-11  29%  426 aa  MK08_XENLA RecName: Full=Mitogen-activated protein kinase 8;       
  163::377     4e-11  29%  445 aa  MEK1_SCHPO RecName: Full=Meiosis-specific serine/threonine-protein
  373::622     4e-11  27% 1309 aa  MAST3_HUMAN RecName: Full=Microtubule-associated
  354::565     4e-11  27%  682 aa  KPC2_CAEEL RecName: Full=Protein kinase C-like 2;       
   15::212     4e-11  31%  366 aa  HOG1_NEOFI RecName: Full=Mitogen-activated protein kinase hog1;    
   15::205     4e-11  32%  365 aa  HOG1_ASPNC RecName: Full=Mitogen-activated protein kinase hog1;    
   15::212     4e-11  31%  366 aa  HOG1_ASPFU RecName: Full=Mitogen-activated protein kinase hog1;    
   26::212     4e-11  31%  400 aa  HOG1_ARXAD RecName: Full=Mitogen-activated protein kinase hog1;    
  196::421     4e-11  26%  513 aa  DUN1_YEAST RecName: Full=DNA damage response protein kinase DUN1;  
   15::318     4e-11  25%  451 aa  CIPKM_ORYSJ RecName: Full=CBL-interacting protein kinase 22;       
   10::200     4e-11  27%  507 aa  CDKL2_RAT RecName: Full=Cyclin-dependent kinase-like 2;       
   10::200     4e-11  27%  568 aa  CDKL2_MOUSE RecName: Full=Cyclin-dependent kinase-like 2;       
    9::198     4e-11  29%  298 aa  CDK2_RAT RecName: Full=Cell division protein kinase 2;       
    4::283     4e-11  32%  324 aa  CDC2_AJECA RecName: Full=Cell division control protein 2;       
   12::280     4e-11  24%  898 aa  CAKI_DROME RecName: Full=Calcium/calmodulin-dependent protein
  852::1145    4e-11  27% 1166 aa  BRL1_ARATH RecName: Full=Serine/threonine-protein kinase BRI1-like 1;
  162::396     4e-11  27%  485 aa  AKT2B_XENLA RecName: Full=RAC-beta serine/threonine-protein kinase
   26::291     5e-11  26%  549 aa  WNK5_ARATH RecName: Full=Probable serine/threonine-protein kinase
  268::529     5e-11  24%  568 aa  SRC_AVISS RecName: Full=Tyrosine-protein kinase transforming
  257::516     5e-11  25%  532 aa  SRC1_XENLA RecName: Full=Tyrosine-protein kinase Src-1;       
    4::254     5e-11  27%  359 aa  SAPK7_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK7;   
 1362::1626    5e-11  28% 2147 aa  ROCO6_DICDI RecName: Full=Probable serine/threonine-protein kinase
    4::263     5e-11  26%  502 aa  RKIN1_SECCE RecName: Full=Carbon catabolite-derepressing protein
  115::355     5e-11  30%  499 aa  PMYT1_HUMAN RecName: Full=Membrane-associated tyrosine- and
   10::256     5e-11  22%  978 aa  PLK4_NEMVE RecName: Full=Serine/threonine-protein kinase PLK4;     
  345::521     5e-11  27%  908 aa  PDPKB_DICDI RecName: Full=3-phosphoinositide-dependent protein
  106::253     5e-11  31%  612 aa  NEK1_ARATH RecName: Full=Serine/threonine-protein kinase Nek1;     
   18::235     5e-11  31% 1341 aa  MYO3B_HUMAN RecName: Full=Myosin-IIIB;         EC=2.7.11.1;
   96::362     5e-11  28%  374 aa  MOS_MSVMO RecName: Full=Serine/threonine-protein
  823::1073    5e-11  28% 1142 aa  KPC1_NEUCR RecName: Full=Protein kinase C-like;         EC=2.7.11.13;
  144::282     5e-11  32%  380 aa  KAPB_YEAST RecName: Full=cAMP-dependent protein kinase type 2;     
   52::324     5e-11  22%  697 aa  HUNK_XENTR RecName: Full=Hormonally up-regulated neu
   82::199     5e-11  35%  530 aa  FNKB_DICDI RecName: Full=Probable serine/threonine-protein kinase
   14::193     5e-11  30%  369 aa  ERK2_DICDI RecName: Full=Extracellular signal-regulated kinase 2;  
   26::296     5e-11  30%  493 aa  CHK1_CAEBR RecName: Full=Serine/threonine-protein kinase chk-1;    
    4::228     5e-11  29%  294 aa  CDK5_DROME RecName: Full=Cell division protein kinase 5 homolog;   
    9::194     5e-11  29%  346 aa  CDK2_MOUSE RecName: Full=Cell division protein kinase 2;       
   53::269     5e-11  25%  329 aa  AURKB_DROME RecName: Full=Serine/threonine-protein kinase Ial;     
   22::289     5e-11  29%  988 aa  ATG1_CRYNE RecName: Full=Serine/threonine-protein kinase ATG1;     
  154::388     5e-11  27%  479 aa  AKT3_RAT RecName: Full=RAC-gamma serine/threonine-protein kinase;  
  154::388     5e-11  27%  479 aa  AKT3_MOUSE RecName: Full=RAC-gamma serine/threonine-protein kinase;
  154::388     5e-11  27%  479 aa  AKT3_HUMAN RecName: Full=RAC-gamma serine/threonine-protein kinase;
 1145::1323    6e-11  28% 1331 aa  Y9963_DICDI RecName: Full=Probable serine/threonine-protein kinase
   61::309     6e-11  28%  327 aa  WNK5_ORYSJ RecName: Full=Probable serine/threonine-protein kinase
   67::312     6e-11  25%  334 aa  SRK3_SPOLA RecName: Full=Tyrosine-protein kinase SRK3;       
    4::200     6e-11  30%  360 aa  SRK2H_ARATH RecName: Full=Serine/threonine-protein kinase SRK2H;   
   34::256     6e-11  28%  372 aa  SPK1_SCHPO RecName: Full=Mitogen-activated protein kinase spk1;    
  174::426     6e-11  27%  653 aa  SHKB_DICDI RecName: Full=Dual specificity protein kinase shkB;     
  129::309     6e-11  34%  417 aa  SBK1_RAT RecName: Full=Serine/threonine-protein kinase SBK1;       
  129::309     6e-11  34%  417 aa  SBK1_MOUSE RecName: Full=Serine/threonine-protein kinase SBK1;     
   53::309     6e-11  31%  424 aa  SBK1_HUMAN RecName: Full=Serine/threonine-protein kinase SBK1;     
   23::219     6e-11  29%  362 aa  SAPKA_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK10;  
  477::753     6e-11  25%  757 aa  RPKL_ARATH RecName: Full=Receptor protein kinase-like protein
    7::291     6e-11  25%  769 aa  PLK4_AEDAE RecName: Full=Serine/threonine-protein kinase PLK4;     
  135::322     6e-11  29%  469 aa  PFTK1_MOUSE RecName: Full=Serine/threonine-protein kinase
  160::300     6e-11  31%  979 aa  NEK9_HUMAN RecName: Full=Serine/threonine-protein kinase Nek9;     
    8::257     6e-11  26%  943 aa  NEK5_ORYSJ RecName: Full=Serine/threonine-protein kinase Nek5;     
    8::257     6e-11  25%  956 aa  NEK5_ARATH RecName: Full=Serine/threonine-protein kinase Nek5;     
    4::253     6e-11  24%  591 aa  NEK2_ORYSJ RecName: Full=Serine/threonine-protein kinase Nek2;     
    4::253     6e-11  24%  591 aa  NEK2_ORYSI RecName: Full=Serine/threonine-protein kinase Nek2;     
   25::294     6e-11  30%  365 aa  MK13_PANTR RecName: Full=Mitogen-activated protein kinase 13;      
   26::212     6e-11  30%  411 aa  MK08_RAT RecName: Full=Mitogen-activated protein kinase 8;       
   26::212     6e-11  30%  384 aa  MK08_MOUSE RecName: Full=Mitogen-activated protein kinase 8;       
   26::212     6e-11  30%  427 aa  MK08_HUMAN RecName: Full=Mitogen-activated protein kinase 8;       
  574::823     6e-11  27% 2618 aa  MAST4_MOUSE RecName: Full=Microtubule-associated
  405::676     6e-11  28% 1482 aa  MAST3_XENLA RecName: Full=Microtubule-associated
  346::611     6e-11  28%  647 aa  LIMK1_HUMAN RecName: Full=LIM domain kinase 1;       
  586::787     6e-11  29%  873 aa  KSR1_MOUSE RecName: Full=Kinase suppressor of Ras 1;       
  471::746     6e-11  27%  811 aa  KRAF1_CAEBR RecName: Full=Raf homolog serine/threonine-protein
   15::205     6e-11  30%  379 aa  HOG1_EMENI RecName: Full=Mitogen-activated protein kinase hog1;    
   29::215     6e-11  32%  447 aa  HOG1_ASHGO RecName: Full=Mitogen-activated protein kinase HOG1;    
    4::262     6e-11  27%  372 aa  EPHA8_RAT RecName: Full=Ephrin type-A receptor 8;       
   10::200     6e-11  26%  493 aa  CDKL2_PONAB RecName: Full=Cyclin-dependent kinase-like 2;       
   10::200     6e-11  26%  570 aa  CDKL2_MACFA RecName: Full=Cyclin-dependent kinase-like 2;       
   10::200     6e-11  26%  493 aa  CDKL2_HUMAN RecName: Full=Cyclin-dependent kinase-like 2;       
   19::208     6e-11  30%  424 aa  CDKD1_ORYSJ RecName: Full=Cyclin-dependent kinase D-1;       
    9::194     6e-11  29%  297 aa  CDK2_XENLA RecName: Full=Cell division protein kinase 2;       
  409::625     6e-11  29%  784 aa  CD2L1_MOUSE RecName: Full=PITSLRE serine/threonine-protein kinase
   13::192     8e-11  29%  470 aa  YPC2_CAEEL RecName: Full=Putative serine/threonine-protein kinase
   46::297     8e-11  26%  436 aa  STK11_MOUSE RecName: Full=Serine/threonine-protein kinase 11;      
  369::447     8e-11  42%  589 aa  STE7_CANAL RecName: Full=Serine/threonine-protein kinase STE7
    4::200     8e-11  29%  361 aa  SRK2B_ARATH RecName: Full=Serine/threonine-protein kinase SRK2B;   
    4::200     8e-11  28%  363 aa  SRK2A_ARATH RecName: Full=Serine/threonine-protein kinase SRK2A;   
    4::254     8e-11  27%  370 aa  SAPK5_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK5;   
  106::356     8e-11  28%  490 aa  PMYT1_MOUSE RecName: Full=Membrane-associated tyrosine- and
   12::204     8e-11  29%  294 aa  PHO85_YARLI RecName: Full=Negative regulator of the PHO system;    
    6::206     8e-11  30%  302 aa  PHO85_CANGA RecName: Full=Negative regulator of the PHO system;    
  135::322     8e-11  29%  469 aa  PFTK1_HUMAN RecName: Full=Serine/threonine-protein kinase
  176::350     8e-11  25%  470 aa  PEPK2_ARATH RecName: Full=Serine/threonine-protein kinase PEPKR2;  
    8::242     8e-11  33%  339 aa  PDK1B_XENLA RecName: Full=Serine/threonine-protein kinase pdik1l-B;
  244::434     8e-11  32%  634 aa  NLK_CAEEL RecName: Full=Serine/threonine kinase NLK;       
  106::253     8e-11  29%  599 aa  NEK1_ORYSJ RecName: Full=Serine/threonine-protein kinase Nek1;     
  150::297     8e-11  28% 1713 aa  MRCKB_RAT RecName: Full=Serine/threonine-protein kinase MRCK beta; 
  150::297     8e-11  28% 1713 aa  MRCKB_MOUSE RecName: Full=Serine/threonine-protein kinase MRCK
  150::297     8e-11  28% 1711 aa  MRCKB_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
   44::226     8e-11  31%  370 aa  MPK3_ARATH RecName: Full=Mitogen-activated protein kinase 3;       
   13::217     8e-11  33%  603 aa  MPK18_ARATH RecName: Full=Mitogen-activated protein kinase 18;     
   38::222     8e-11  31%  361 aa  MPK14_ARATH RecName: Full=Mitogen-activated protein kinase 14;     
   76::342     8e-11  28%  354 aa  MOS_MSVMT RecName: Full=Serine/threonine-protein
  395::644     8e-11  28% 1321 aa  MAST3_MOUSE RecName: Full=Microtubule-associated
   37::281     8e-11  25%  351 aa  KAPL_APLCA RecName: Full=Spermatozoon-associated protein kinase;   
  255::408     8e-11  28%  412 aa  IPL1_DEBHA RecName: Full=Spindle assembly checkpoint kinase;       
   18::298     8e-11  32%  447 aa  HOG1_CANGA RecName: Full=Mitogen-activated protein kinase HOG1;    
  277::517     8e-11  25%  533 aa  FPS_AVISP RecName: Full=Tyrosine-protein kinase transforming
  423::675     8e-11  24% 1053 aa  FAK1_CHICK RecName: Full=Focal adhesion kinase 1;       
  556::844     8e-11  28%  854 aa  DDR2_MOUSE RecName: Full=Discoidin domain-containing receptor 2;   
  167::405     8e-11  24%  460 aa  CDS1_SCHPO RecName: Full=Serine/threonine-protein kinase cds1;     
  118::360     8e-11  25%  538 aa  CDPK3_PLAYO RecName: Full=Calcium-dependent protein kinase 3;      
    9::198     8e-11  29%  298 aa  CDK2_MESAU RecName: Full=Cell division protein kinase 2;       
    9::198     8e-11  29%  298 aa  CDK2_HUMAN RecName: Full=Cell division protein kinase 2;       
   51::249     8e-11  32%  362 aa  CCR35_ARATH RecName: Full=Serine/threonine-protein kinase-like
  199::433     8e-11  25%  541 aa  AKT1_CAEEL RecName: Full=Serine/threonine-protein kinase akt-1;    
  344::550     1e-10  27%  639 aa  WAKLP_ARATH RecName: Full=Wall-associated receptor kinase-like 15; 
  651::902     1e-10  26%  965 aa  TLK1_CAEEL RecName: Full=Serine/threonine-protein kinase
  804::938     1e-10  32% 1018 aa  STK31_MOUSE RecName: Full=Serine/threonine-protein kinase 31;      
   46::303     1e-10  24%  440 aa  STK11_CHICK RecName: Full=Serine/threonine-protein kinase 11;      
  265::512     1e-10  27%  523 aa  SRC_RSVPA RecName: Full=Tyrosine-protein kinase transforming
  257::516     1e-10  24%  532 aa  SRC2_XENLA RecName: Full=Tyrosine-protein kinase Src-2;       
  311::504     1e-10  29%  628 aa  SERK2_ARATH RecName: Full=Somatic embryogenesis receptor kinase 2; 
  663::936     1e-10  27%  996 aa  PHOT1_ARATH RecName: Full=Phototropin-1;       
  227::465     1e-10  29%  471 aa  MLKL_HUMAN RecName: Full=Mixed lineage kinase domain-like protein;
   43::248     1e-10  30%  420 aa  MKNK1_BOVIN RecName: Full=MAP kinase-interacting
   20::220     1e-10  34%  348 aa  MK14B_DANRE RecName: Full=Mitogen-activated protein kinase 14b;    
   31::220     1e-10  34%  361 aa  MK14A_CYPCA RecName: Full=Mitogen-activated protein kinase 14a;    
    1::220     1e-10  33%  274 aa  MK04_RAT RecName: Full=Mitogen-activated protein kinase 4;       
  338::533     1e-10  27%  638 aa  LIMK2_RAT RecName: Full=LIM domain kinase 2;         Short=LIMK-2; 
   13::286     1e-10  25%  368 aa  KSS1_YEAST RecName: Full=Mitogen-activated protein kinase KSS1;    
    7::223     1e-10  29%  772 aa  KS6A2_CAEEL RecName: Full=Putative ribosomal protein S6 kinase
  473::748     1e-10  27%  813 aa  KRAF1_CAEEL RecName: Full=Raf homolog serine/threonine-protein
  202::420     1e-10  30%  501 aa  KPEL_DROME RecName: Full=Serine/threonine-protein kinase pelle;    
   39::262     1e-10  30%  751 aa  IKKB_DROME RecName: Full=Inhibitor of nuclear factor kappa-B kinase
    2::185     1e-10  31%  329 aa  HOG1_SETTU RecName: Full=Mitogen-activated protein kinase HOG1;    
   28::297     1e-10  33%  444 aa  HOG1_KLULA RecName: Full=Mitogen-activated protein kinase HOG1;    
  358::551     1e-10  26%  660 aa  CRK22_ARATH RecName: Full=Cysteine-rich receptor-like protein
    9::213     1e-10  25%  502 aa  CIPKB_ORYSJ RecName: Full=CBL-interacting protein kinase 11;       
  220::489     1e-10  26%  543 aa  CHK2_HUMAN RecName: Full=Serine/threonine-protein kinase Chk2;     
    4::199     1e-10  32%  294 aa  CDC2_VIGUN RecName: Full=Cell division control protein 2 homolog;  
   61::277     1e-10  28%  436 aa  CD2L1_RAT RecName: Full=PITSLRE serine/threonine-protein kinase
    4::202     1e-10  28%  346 aa  CCRK_PONAB RecName: Full=Cell cycle-related kinase;       
   16::345     1e-10  25%  969 aa  ATG1_COCIM RecName: Full=Serine/threonine-protein kinase ATG1;     
  529::703     1e-10  34%  766 aa  TLK1_MOUSE RecName: Full=Serine/threonine-protein kinase
  529::703     1e-10  34%  766 aa  TLK1_HUMAN RecName: Full=Serine/threonine-protein kinase
    4::200     1e-10  28%  350 aa  SRK2F_ARATH RecName: Full=Serine/threonine-protein kinase SRK2F;   
  298::461     1e-10  31%  561 aa  RK_BOVIN RecName: Full=Rhodopsin kinase;         Short=RK;       
    8::247     1e-10  34%  341 aa  PDK1L_DANRE RecName: Full=Serine/threonine-protein kinase pdik1l;  
  170::378     1e-10  30%  496 aa  PCTK1_MOUSE RecName: Full=Serine/threonine-protein kinase
    1::256     1e-10  30% 1582 aa  NRK_HUMAN RecName: Full=Nik-related protein kinase;       
   47::242     1e-10  28%  376 aa  MPK6_ORYSJ RecName: Full=Mitogen-activated protein kinase 6;       
   39::240     1e-10  33%  372 aa  MPK12_ARATH RecName: Full=Mitogen-activated protein kinase 12;     
  212::396     1e-10  36%  419 aa  MP2K7_HUMAN RecName: Full=Dual specificity mitogen-activated
   19::219     1e-10  34%  360 aa  MK14_PANTR RecName: Full=Mitogen-activated protein kinase 14;      
   19::219     1e-10  34%  360 aa  MK14_HUMAN RecName: Full=Mitogen-activated protein kinase 14;      
   19::219     1e-10  34%  360 aa  MK14_CANFA RecName: Full=Mitogen-activated protein kinase 14;      
   28::194     1e-10  37%  364 aa  MK11_HUMAN RecName: Full=Mitogen-activated protein kinase 11;      
   26::216     1e-10  30%  423 aa  MK09_MOUSE RecName: Full=Mitogen-activated protein kinase 9;       
   23::224     1e-10  27%  355 aa  MAPK_FUSSO RecName: Full=Mitogen-activated protein kinase;       
  346::611     1e-10  28%  647 aa  LIMK1_MOUSE RecName: Full=LIM domain kinase 1;       
  403::619     1e-10  30% 1257 aa  LIMK1_DROME RecName: Full=LIM domain kinase 1;       
  246::490     1e-10  27%  509 aa  LCK_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
  246::490     1e-10  27%  509 aa  LCK_AOTNA RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
  820::1056    1e-10  26% 1139 aa  KPC1_TRIRE RecName: Full=Protein kinase C-like;         EC=2.7.11.13;
   13::276     1e-10  23% 1442 aa  DAPK1_MOUSE RecName: Full=Death-associated protein kinase 1;       
   11::229     1e-10  30%  335 aa  CRK1_SCHPO RecName: Full=Serine/threonine-protein kinase crk1;     
   21::293     1e-10  27%  527 aa  CHK1_YEAST RecName: Full=Serine/threonine-protein kinase CHK1;     
    4::199     1e-10  29%  294 aa  CDC2_CHERU RecName: Full=Cell division control protein 2 homolog;  
   26::288     1e-10  26%  765 aa  ANKK1_HUMAN RecName: Full=Ankyrin repeat and protein kinase
  150::391     1e-10  27%  480 aa  AKT1_BOVIN RecName: Full=RAC-alpha serine/threonine-protein kinase;
  127::377     1e-10  27% 1040 aa  ACK1_RAT RecName: Full=Activated CDC42 kinase 1;       
  504::690     2e-10  34%  806 aa  Y5393_ARATH RecName: Full=Probable receptor-like protein kinase
  402::607     2e-10  32%  697 aa  TLK2_DANRE RecName: Full=Serine/threonine-protein kinase
  268::517     2e-10  24%  533 aa  SRC_CHICK RecName: Full=Proto-oncogene tyrosine-protein kinase Src;
  268::517     2e-10  24%  587 aa  SRC_AVIS2 RecName: Full=Tyrosine-protein kinase transforming
    4::200     2e-10  28%  339 aa  SAPK2_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK2;   
    4::200     2e-10  28%  339 aa  SAPK2_ORYSI RecName: Full=Serine/threonine-protein kinase SAPK2;   
  183::391     2e-10  23%  593 aa  SAMKB_DICDI RecName: Full=Probable serine/threonine-protein kinase
   71::265     2e-10  31%  398 aa  PPK23_SCHPO RecName: Full=Serine/threonine-protein kinase ppk23;   
  197::405     2e-10  30%  523 aa  PCTK2_RAT RecName: Full=Serine/threonine-protein kinase PCTAIRE-2; 
  170::378     2e-10  30%  496 aa  PCTK1_HUMAN RecName: Full=Serine/threonine-protein kinase
   66::352     2e-10  28%  393 aa  NTF4_TOBAC RecName: Full=Mitogen-activated protein kinase homolog
   74::355     2e-10  27%  389 aa  NAK_ARATH RecName: Full=Probable serine/threonine-protein kinase
  112::303     2e-10  26%  388 aa  MYLK4_HUMAN RecName: Full=Myosin light chain kinase family member
  182::300     2e-10  29% 1551 aa  MRCKG_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
   28::194     2e-10  37%  364 aa  MK11_MOUSE RecName: Full=Mitogen-activated protein kinase 11;      
  338::533     2e-10  27%  642 aa  LIMK2_CHICK RecName: Full=LIM domain kinase 2;       
  338::533     2e-10  27%  638 aa  LIMK2_BOVIN RecName: Full=LIM domain kinase 2;       
  321::507     2e-10  27%  615 aa  LIMK1_XENLA RecName: Full=LIM domain kinase 1;       
   39::291     2e-10  26%  789 aa  KS6A5_CHICK RecName: Full=Ribosomal protein S6 kinase alpha-5;     
  161::439     2e-10  26%  587 aa  KKCC2_RAT RecName: Full=Calcium/calmodulin-dependent protein kinase
  162::440     2e-10  26%  588 aa  KKCC2_HUMAN RecName: Full=Calcium/calmodulin-dependent protein
   86::368     2e-10  28%  419 aa  CX32_ARATH RecName: Full=Probable serine/threonine-protein kinase
    4::200     2e-10  26%  350 aa  CDKL1_DANRE RecName: Full=Cyclin-dependent kinase-like 1;       
    4::199     2e-10  30%  294 aa  CDKA1_ORYSJ RecName: Full=Cyclin-dependent kinase A-1;       
   16::227     2e-10  29%  372 aa  CDK9_CHICK RecName: Full=Cell division protein kinase 9;       
    9::263     2e-10  29%  297 aa  CDC2_RAT RecName: Full=Cell division control protein 2 homolog;    
    4::195     2e-10  30%  294 aa  CDC22_MEDSA RecName: Full=Cell division control protein 2 homolog
    3::299     2e-10  27%  950 aa  ATG1_NEOFI RecName: Full=Serine/threonine-protein kinase atg1;     
   20::314     2e-10  29%  952 aa  ATG1_BOTFU RecName: Full=Serine/threonine-protein kinase ATG1;     
   20::314     2e-10  29%  952 aa  ATG1_BOTFB RecName: Full=Serine/threonine-protein kinase atg1;     
   20::316     2e-10  27%  973 aa  ATG1_ASPFU RecName: Full=Serine/threonine-protein kinase atg1;     
   20::332     2e-10  27%  765 aa  Y9866_DICDI RecName: Full=Probable serine/threonine-protein kinase
  572::760     2e-10  30%  877 aa  WEE1_SCHPO RecName: Full=Mitosis inhibitor protein kinase wee1;    
    4::200     2e-10  29%  360 aa  SAPK4_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK4;   
  857::1117    2e-10  24% 1155 aa  PYK2_DICDI RecName: Full=Dual specificity protein kinase pyk2;       
  481::691     2e-10  29%  845 aa  PUB52_ARATH RecName: Full=U-box domain-containing protein
    7::207     2e-10  30%  305 aa  PHO85_YEAST RecName: Full=Cyclin-dependent protein kinase PHO85;   
  197::405     2e-10  30%  523 aa  PCTK2_MOUSE RecName: Full=Serine/threonine-protein kinase
  197::405     2e-10  30%  523 aa  PCTK2_HUMAN RecName: Full=Serine/threonine-protein kinase
   17::256     2e-10  30% 1455 aa  NRK_MOUSE RecName: Full=Nik-related protein kinase;       
  115::223     2e-10  32%  792 aa  NEK4_MOUSE RecName: Full=Serine/threonine-protein kinase Nek4;     
   15::212     2e-10  31%  377 aa  MPKC_NEOFI RecName: Full=Mitogen-activated protein kinase mpkC;    
  212::413     2e-10  35%  419 aa  MP2K7_RAT RecName: Full=Dual specificity mitogen-activated protein
   70::349     2e-10  29%  349 aa  MOS_CHICK RecName: Full=Serine/threonine-protein kinase mos;       
   31::220     2e-10  34%  361 aa  MK14A_DANRE RecName: Full=Mitogen-activated protein kinase 14a;    
   12::198     2e-10  28%  443 aa  MHK_ARATH RecName: Full=Serine/threonine-protein kinase MHK;       
  228::394     2e-10  31% 1002 aa  M3KL4_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  246::490     2e-10  27%  509 aa  LCK_RAT RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;  
  246::490     2e-10  27%  509 aa  LCK_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
  420::672     2e-10  26%  740 aa  KS6A6_DANRE RecName: Full=Ribosomal protein S6 kinase alpha-6;     
  238::450     2e-10  28%  591 aa  KPCZ_RABIT RecName: Full=Protein kinase C zeta type;       
  235::440     2e-10  25%  588 aa  KKCC2_MOUSE RecName: Full=Calcium/calmodulin-dependent protein
  152::248     2e-10  36%  376 aa  KDC1_DROME RecName: Full=Protein kinase DC1;         EC=2.7.11.1;
   18::298     2e-10  31%  435 aa  HOG1_YEAST RecName: Full=Mitogen-activated protein kinase HOG1;    
   15::269     2e-10  29%  357 aa  HOG1_GIBZE RecName: Full=Mitogen-activated protein kinase HOG1;    
  275::516     2e-10  24%  537 aa  FYN_XENLA RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
   16::222     2e-10  28%  366 aa  CPK1_CRYNE RecName: Full=Mitogen-activated protein kinase CPK1;    
   12::212     2e-10  28%  456 aa  CIPK2_ARATH RecName: Full=CBL-interacting serine/threonine-protein
    9::200     2e-10  26%  352 aa  CDKL1_MOUSE RecName: Full=Cyclin-dependent kinase-like 1;       
    9::200     2e-10  26%  357 aa  CDKL1_HUMAN RecName: Full=Cyclin-dependent kinase-like 1;       
    2::200     2e-10  29%  398 aa  CDKD1_ARATH RecName: Full=Cyclin-dependent kinase D-1;       
   42::221     2e-10  31%  361 aa  CDK10_BOVIN RecName: Full=Cell division protein kinase 10;       
    9::263     2e-10  29%  297 aa  CDC2_MOUSE RecName: Full=Cell division control protein 2 homolog;  
    9::263     2e-10  29%  297 aa  CDC2_HUMAN RecName: Full=Cell division control protein 2 homolog;  
    9::263     2e-10  29%  297 aa  CDC2_BOVIN RecName: Full=Cell division control protein 2 homolog;  
    7::283     2e-10  27%  804 aa  ATG1_PICAN RecName: Full=Serine/threonine-protein kinase ATG1;     
   16::315     2e-10  28%  934 aa  ATG1_ASPOR RecName: Full=Serine/threonine-protein kinase atg1;     
    4::171     3e-10  29%  265 aa  Y823_ENCCU RecName: Full=Probable cell division protein kinase
 1126::1401    3e-10  32% 1436 aa  WIN1_SCHPO RecName: Full=MAP kinase kinase kinase win1;       
   46::297     3e-10  25%  433 aa  STK11_HUMAN RecName: Full=Serine/threonine-protein kinase 11;      
    1::258     3e-10  25%  433 aa  SMK4A_MOUSE RecName: Full=Sperm motility kinase 4a;       
  420::639     3e-10  30%  796 aa  PUB51_ARATH RecName: Full=U-box domain-containing protein
  542::795     3e-10  28%  878 aa  PKN3_MOUSE RecName: Full=Serine/threonine-protein kinase N3;       
   13::223     3e-10  31%  326 aa  PHO85_CANAL RecName: Full=Negative regulator of the PHO system;    
   69::251     3e-10  30%  395 aa  MPK6_ARATH RecName: Full=Mitogen-activated protein kinase 6;       
   13::217     3e-10  35%  506 aa  MPK13_ORYSJ RecName: Full=Mitogen-activated protein kinase 13;     
   13::217     3e-10  35%  506 aa  MPK13_ORYSI RecName: Full=Mitogen-activated protein kinase 13;     
   26::221     3e-10  29%  423 aa  MK09_RAT RecName: Full=Mitogen-activated protein kinase 9;       
   26::221     3e-10  29%  424 aa  MK09_HUMAN RecName: Full=Mitogen-activated protein kinase 9;       
   26::221     3e-10  29%  382 aa  MK09_CHICK RecName: Full=Mitogen-activated protein kinase 9;       
  254::453     3e-10  27%  596 aa  KPCI_PONAB RecName: Full=Protein kinase C iota type;       
  253::452     3e-10  27%  595 aa  KPCI_MOUSE RecName: Full=Protein kinase C iota type;       
  254::453     3e-10  27%  596 aa  KPCI_HUMAN RecName: Full=Protein kinase C iota type;       
  348::558     3e-10  26%  671 aa  KPCB_RAT RecName: Full=Protein kinase C beta type;       
  348::558     3e-10  26%  671 aa  KPCB_RABIT RecName: Full=Protein kinase C beta type;       
  348::558     3e-10  26%  673 aa  KPCB_MOUSE RecName: Full=Protein kinase C beta type;       
  348::558     3e-10  26%  671 aa  KPCB_HUMAN RecName: Full=Protein kinase C beta type;       
  348::558     3e-10  26%  673 aa  KPCB_BOVIN RecName: Full=Protein kinase C beta type;       
  629::821     3e-10  27%  934 aa  KGP25_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 2
  783::975     3e-10  27% 1088 aa  KGP24_DROME RecName: Full=cGMP-dependent protein kinase, isozyme 2
 2728::2925    3e-10  26% 2959 aa  KALRN_RAT RecName: Full=Kalirin;         EC=2.7.11.1;AltName:
 2727::2924    3e-10  26% 2964 aa  KALRN_MOUSE RecName: Full=Kalirin;         EC=2.7.11.1;AltName:
 2754::2951    3e-10  26% 2985 aa  KALRN_HUMAN RecName: Full=Kalirin;         EC=2.7.11.1;AltName:
   28::218     3e-10  30%  361 aa  JNK_SUBDO RecName: Full=Stress-activated protein kinase JNK;       
 1292::1474    3e-10  27% 1637 aa  GDT2_DICDI RecName: Full=Probable serine/threonine-protein kinase
  236::484     3e-10  26%  506 aa  FRK_RAT RecName: Full=Tyrosine-protein kinase FRK;       
   62::318     3e-10  26%  523 aa  CDPKS_ARATH RecName: Full=Calcium-dependent protein kinase 28;     
   42::221     3e-10  30%  358 aa  CDK10_RAT RecName: Full=Cell division protein kinase 10;       
   44::223     3e-10  31%  360 aa  CDK10_HUMAN RecName: Full=Cell division protein kinase 10;       
    4::269     3e-10  30%  297 aa  CDC2_SCHPO RecName: Full=Cell division control protein 2;       
    6::226     3e-10  33%  291 aa  CDC21_MEDSA RecName: Full=Cell division control protein 2 homolog
    4::202     3e-10  28%  346 aa  CCRK_RAT RecName: Full=Cell cycle-related kinase;       
    4::202     3e-10  28%  346 aa  CCRK_MOUSE RecName: Full=Cell cycle-related kinase;       
   11::251     3e-10  29%  830 aa  ATG1_SCHPO RecName: Full=Serine/threonine-protein kinase atg1;     
   19::311     3e-10  25%  875 aa  ATG1_DEBHA RecName: Full=Serine/threonine-protein kinase ATG1;     
   20::198     4e-10  28%  346 aa  YMX8_CAEEL RecName: Full=Putative serine/threonine-protein kinase
    4::200     4e-10  28%  339 aa  SRK2J_ARATH RecName: Full=Serine/threonine-protein kinase SRK2J;   
  356::625     4e-10  27%  638 aa  SPKA_DICDI RecName: Full=Stress-activated protein kinase alpha;    
  227::485     4e-10  26%  497 aa  SPK1_DUGTI RecName: Full=Tyrosine-protein kinase SPK-1;       
    9::255     4e-10  23%  940 aa  PLK4_DANRE RecName: Full=Serine/threonine-protein kinase PLK4;     
  126::334     4e-10  30%  451 aa  PCTK3_RAT RecName: Full=Serine/threonine-protein kinase PCTAIRE-3; 
   38::320     4e-10  28%  657 aa  P2C04_ORYSJ RecName: Full=Protein kinase and PP2C-like
  497::688     4e-10  27%  795 aa  MYLK3_MOUSE RecName: Full=Putative myosin light chain kinase 3;    
  182::295     4e-10  29% 1551 aa  MRCKG_MOUSE RecName: Full=Serine/threonine-protein kinase MRCK
  228::429     4e-10  35%  535 aa  MP2K7_MOUSE RecName: Full=Dual specificity mitogen-activated
   19::219     4e-10  33%  360 aa  MK14_RAT RecName: Full=Mitogen-activated protein kinase 14;        
   19::219     4e-10  33%  360 aa  MK14_MOUSE RecName: Full=Mitogen-activated protein kinase 14;      
   26::246     4e-10  33%  583 aa  MK04_MOUSE RecName: Full=Mitogen-activated protein kinase 4;       
   26::235     4e-10  33%  587 aa  MK04_HUMAN RecName: Full=Mitogen-activated protein kinase 4;       
  122::324     4e-10  27%  386 aa  MAPK2_MOUSE RecName: Full=MAP kinase-activated protein kinase 2;   
  136::338     4e-10  27%  400 aa  MAPK2_HUMAN RecName: Full=MAP kinase-activated protein kinase 2;   
   65::267     4e-10  27%  329 aa  MAPK2_CRILO RecName: Full=MAP kinase-activated protein kinase 2;   
  338::533     4e-10  27%  638 aa  LIMK2_HUMAN RecName: Full=LIM domain kinase 2;       
   44::244     4e-10  23%  800 aa  KIN4_YEAST RecName: Full=Serine/threonine-protein kinase KIN4;     
   28::263     4e-10  30%  372 aa  JNK_DROME RecName: Full=Stress-activated protein kinase JNK;       
   29::215     4e-10  31%  427 aa  HOG1_TORDE RecName: Full=Mitogen-activated protein kinase HOG1;    
  379::659     4e-10  28%  747 aa  FGFR_CIOIN RecName: Full=Fibroblast growth factor receptor;        
  556::845     4e-10  28%  855 aa  DDR2_HUMAN RecName: Full=Discoidin domain-containing receptor 2;   
  312::563     4e-10  30%  744 aa  DAF4_CAEEL RecName: Full=Cell surface receptor daf-4;       
    9::294     4e-10  24%  442 aa  CIPKE_ARATH RecName: Full=CBL-interacting serine/threonine-protein
    9::200     4e-10  26%  352 aa  CDKL1_RAT RecName: Full=Cyclin-dependent kinase-like 1;       
   19::208     4e-10  29%  424 aa  CDKD1_ORYSI RecName: Full=Cyclin-dependent kinase D-1;       
   44::252     4e-10  29%  380 aa  CDK8_DICDI RecName: Full=Probable cyclin-dependent kinase 8;       
    4::199     4e-10  31%  294 aa  CDC2_VIGAC RecName: Full=Cell division control protein 2 homolog;  
   21::239     4e-10  30%  326 aa  CDC2_CAEBR RecName: Full=Cell division control protein 2 homolog;  
  531::721     5e-10  33%  880 aa  Y5389_ARATH RecName: Full=Probable receptor-like protein kinase
  495::680     5e-10  27%  824 aa  Y5241_ARATH RecName: Full=Probable receptor-like protein kinase
  523::669     5e-10  37%  756 aa  TLK1B_DANRE RecName: Full=Serine/threonine-protein kinase
   34::289     5e-10  27%  586 aa  STK11_DICDI RecName: Full=Serine/threonine-protein kinase 11
  241::491     5e-10  26%  505 aa  SRK1_SPOLA RecName: Full=Tyrosine-protein kinase isoform SRK1;     
  271::520     5e-10  24%  536 aa  SRC_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase Src;
  188::431     5e-10  25%  640 aa  SAMKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  613::836     5e-10  28%  946 aa  PKN1_RAT RecName: Full=Serine/threonine-protein kinase N1;       
  609::832     5e-10  32%  942 aa  PKN1_HUMAN RecName: Full=Serine/threonine-protein kinase N1;       
  126::334     5e-10  30%  451 aa  PCTK3_MOUSE RecName: Full=Serine/threonine-protein kinase
  346::611     5e-10  28%  647 aa  LIMK1_RAT RecName: Full=LIM domain kinase 1;         Short=LIMK-1; 
  117::209     5e-10  37%  209 aa  KAPCG_MACMU RecName: Full=cAMP-dependent protein kinase catalytic
  217::420     5e-10  28%  718 aa  IRAK1_BOVIN RecName: Full=Interleukin-1 receptor-associated kinase
  364::577     5e-10  33% 1358 aa  IFKB_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1264::1477    5e-10  33% 2258 aa  IFKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  617::857     5e-10  25%  873 aa  FPS_FUJSV RecName: Full=Tyrosine-protein kinase transforming
  127::377     5e-10  26% 1038 aa  ACK1_HUMAN RecName: Full=Activated CDC42 kinase 1;       
  131::377     5e-10  27% 1039 aa  ACK1_BOVIN RecName: Full=Activated CDC42 kinase 1;       
   38::273     7e-10  25%  418 aa  Y9865_DICDI RecName: Full=Probable serine/threonine-protein kinase
  669::797     7e-10  31% 1347 aa  Y1197_DICDI RecName: Full=Probable serine/threonine-protein kinase
   31::298     7e-10  24%  372 aa  TSSK5_MOUSE RecName: Full=Testis-specific serine/threonine-protein
   36::241     7e-10  30%  388 aa  SMK1_YEAST RecName: Full=Sporulation-specific mitogen-activated
    1::218     7e-10  29%  361 aa  SAPK9_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK9;   
  167::403     7e-10  27%  624 aa  PPK35_SCHPO RecName: Full=Serine/threonine-protein kinase ppk35;   
  638::806     7e-10  32%  889 aa  PKN3_HUMAN RecName: Full=Serine/threonine-protein kinase N3;       
   57::239     7e-10  27%  384 aa  PFTK2_HUMAN RecName: Full=Serine/threonine-protein kinase
  147::355     7e-10  30%  472 aa  PCTK3_PONAB RecName: Full=Serine/threonine-protein kinase
  147::355     7e-10  30%  472 aa  PCTK3_HUMAN RecName: Full=Serine/threonine-protein kinase
 6468::6681    7e-10  23% 7968 aa  OBSCN_HUMAN RecName: Full=Obscurin;         EC=2.7.11.1;AltName:
   11::290     7e-10  24%  699 aa  NIMA_EMENI RecName: Full=G2-specific protein kinase nimA;       
  157::285     7e-10  31%  858 aa  NIM1_NEUCR RecName: Full=G2-specific protein kinase nim-1;       
   73::324     7e-10  28%  398 aa  MPK1_ORYSJ RecName: Full=Mitogen-activated protein kinase 1;       
  831::1089    7e-10  27% 1116 aa  MKH1_SCHPO RecName: Full=MAP kinase kinase kinase mkh1;       
   31::245     7e-10  31%  361 aa  MK14_XENLA RecName: Full=Mitogen-activated protein kinase 14;      
 1878::2128    7e-10  29% 2527 aa  LRRK2_HUMAN RecName: Full=Leucine-rich repeat
  372::573     7e-10  25%  686 aa  KGP1B_MOUSE RecName: Full=cGMP-dependent protein kinase 1, beta
  372::573     7e-10  25%  686 aa  KGP1B_HUMAN RecName: Full=cGMP-dependent protein kinase 1, beta
  372::573     7e-10  25%  686 aa  KGP1B_BOVIN RecName: Full=cGMP-dependent protein kinase 1, beta
  357::558     7e-10  25%  671 aa  KGP1A_RABIT RecName: Full=cGMP-dependent protein kinase 1, alpha
  357::558     7e-10  25%  671 aa  KGP1A_MOUSE RecName: Full=cGMP-dependent protein kinase 1, alpha
  357::558     7e-10  25%  671 aa  KGP1A_HUMAN RecName: Full=cGMP-dependent protein kinase 1, alpha
  357::558     7e-10  25%  671 aa  KGP1A_BOVIN RecName: Full=cGMP-dependent protein kinase 1, alpha
   15::269     7e-10  29%  357 aa  HOG1_MAGGR RecName: Full=Mitogen-activated protein kinase HOG1;    
   15::269     7e-10  29%  360 aa  HOG1_CHAGB RecName: Full=Mitogen-activated protein kinase HOG1;    
   13::214     7e-10  27%  353 aa  FUS3_YEAST RecName: Full=Mitogen-activated protein kinase FUS3;    
    9::301     7e-10  29%  475 aa  CDKE1_ORYSJ RecName: Full=Cyclin-dependent kinase E-1;       
   44::223     7e-10  30%  360 aa  CDK10_MOUSE RecName: Full=Cell division protein kinase 10;       
    9::263     7e-10  28%  297 aa  CDC2_PONAB RecName: Full=Cell division control protein 2 homolog;  
  125::344     7e-10  30%  897 aa  ATG1_YEAST RecName: Full=Serine/threonine-protein kinase ATG1;     
  125::344     7e-10  30%  897 aa  ATG1_YEAS7 RecName: Full=Serine/threonine-protein kinase ATG1;     
  150::391     7e-10  27%  480 aa  AKT1_HUMAN RecName: Full=RAC-alpha serine/threonine-protein kinase;
  127::377     7e-10  26% 1055 aa  ACK1_MOUSE RecName: Full=Activated CDC42 kinase 1;       
  517::723     9e-10  26%  871 aa  Y2214_ARATH RecName: Full=Probable receptor-like protein kinase
   91::317     9e-10  30%  572 aa  Y1461_ARATH RecName: Full=Probable serine/threonine-protein kinase
   30::242     9e-10  28%  700 aa  WNK1_ARATH RecName: Full=Serine/threonine-protein kinase WNK1;     
   12::216     9e-10  26%  357 aa  TSSK2_MOUSE RecName: Full=Testis-specific serine/threonine-protein
   95::312     9e-10  24%  570 aa  TESK2_RAT RecName: Full=Dual specificity testis-specific protein
  268::515     9e-10  23%  526 aa  SRC_RSVP RecName: Full=Tyrosine-protein kinase transforming protein
  276::525     9e-10  24%  541 aa  SRC_MOUSE RecName: Full=Neuronal proto-oncogene tyrosine-protein
   24::226     9e-10  32%  470 aa  RAN1_SCHPO RecName: Full=Negative regulator of sexual conjugation
    7::253     9e-10  22%  925 aa  PLK4_MOUSE RecName: Full=Serine/threonine-protein kinase PLK4;     
  662::873     9e-10  27%  983 aa  PKN2_MOUSE RecName: Full=Serine/threonine-protein kinase N2;       
  663::874     9e-10  27%  984 aa  PKN2_HUMAN RecName: Full=Serine/threonine-protein kinase N2;       
   92::308     9e-10  28%  456 aa  PBS1_ARATH RecName: Full=Serine/threonine-protein kinase PBS1;     
  113::303     9e-10  25%  386 aa  MYLK4_MOUSE RecName: Full=Myosin light chain kinase family member
   61::243     9e-10  30%  387 aa  MMK1_MEDSA RecName: Full=Mitogen-activated protein kinase homolog
  338::533     9e-10  26%  638 aa  LIMK2_MOUSE RecName: Full=LIM domain kinase 2;       
   23::284     9e-10  33%  773 aa  KS6A4_MOUSE RecName: Full=Ribosomal protein S6 kinase alpha-4;     
  246::445     9e-10  26%  588 aa  KPCI_DANRE RecName: Full=Protein kinase C iota type;       
  855::1112    9e-10  26% 1174 aa  KPC1_COCHE RecName: Full=Protein kinase C-like;         EC=2.7.11.13;
    4::203     9e-10  28%  308 aa  KIN28_ENCCU RecName: Full=Probable serine/threonine-protein kinase
   34::254     9e-10  22%  626 aa  HUNKB_XENLA RecName: Full=Hormonally up-regulated neu
   29::255     9e-10  30%  407 aa  HOG1_ZYGRO RecName: Full=Mitogen-activated protein kinase HOG1;    
   29::237     9e-10  34%  431 aa  HOG1_ZYGRC RecName: Full=Mitogen-activated protein kinase HOG1;    
   29::238     9e-10  30%  385 aa  HOG1_PICST RecName: Full=Mitogen-activated protein kinase HOG1;    
  718::942     9e-10  28% 1052 aa  FGFR2_DROME RecName: Full=Fibroblast growth factor receptor homolog
  636::894     9e-10  27% 1004 aa  EPHA8_MOUSE RecName: Full=Ephrin type-A receptor 8;       
  904::1075    9e-10  34% 1108 aa  E2AK3_RAT RecName: Full=Eukaryotic translation initiation factor
  836::1070    9e-10  35% 1077 aa  E2AK3_CAEEL RecName: Full=Eukaryotic translation initiation factor
    6::231     9e-10  29%  376 aa  CDK9A_XENLA RecName: Full=Cell division protein kinase 9-A;        
   13::276     9e-10  27%  326 aa  CDK6_MOUSE RecName: Full=Cell division protein kinase 6;       
   13::276     9e-10  27%  326 aa  CDK6_HUMAN RecName: Full=Cell division protein kinase 6;       
    4::199     9e-10  29%  294 aa  CDC2_MAIZE RecName: Full=Cell division control protein 2 homolog;  
  894::1096    9e-10  26% 1207 aa  BRI1_SOLLC RecName: Full=Brassinosteroid LRR receptor kinase;        
  242::486     9e-10  27%  505 aa  BLK_HUMAN RecName: Full=Tyrosine-protein kinase BLK;       
    9::305     9e-10  28%  942 aa  ATG1_CANGA RecName: Full=Serine/threonine-protein kinase ATG1;     
  268::489     9e-10  25% 1130 aa  ABL1_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase
  607::870     1e-09  29%  986 aa  Y9848_DICDI RecName: Full=Probable serine/threonine-protein kinase
   35::280     1e-09  25%  563 aa  WNK8_ARATH RecName: Full=Serine/threonine-protein kinase WNK8;     
  347::490     1e-09  31%  500 aa  WEE1_ARATH RecName: Full=Wee1-like protein kinase;       
  401::607     1e-09  31%  697 aa  TLK2_XENTR RecName: Full=Serine/threonine-protein kinase
  422::628     1e-09  31%  718 aa  TLK2_MOUSE RecName: Full=Serine/threonine-protein kinase
  476::682     1e-09  31%  772 aa  TLK2_HUMAN RecName: Full=Serine/threonine-protein kinase
  271::520     1e-09  24%  536 aa  SRC_RAT RecName: Full=Proto-oncogene tyrosine-protein kinase Src;  
    4::200     1e-09  28%  365 aa  SAPK6_ORYSJ RecName: Full=Serine/threonine-protein kinase SAPK6;   
  371::638     1e-09  29%  647 aa  RLK90_ARATH RecName: Full=Probable inactive receptor kinase
  305::464     1e-09  31%  564 aa  RK_RAT RecName: Full=Rhodopsin kinase;         Short=RK;       
  305::464     1e-09  31%  564 aa  RK_MOUSE RecName: Full=Rhodopsin kinase;         Short=RK;       
  791::942     1e-09  30% 1770 aa  RIM15_YEAST RecName: Full=Serine/threonine-protein kinase RIM15;   
  664::875     1e-09  27%  985 aa  PKN2_RAT RecName: Full=Serine/threonine-protein kinase N2;       
   36::239     1e-09  30%  650 aa  PIT1_SCHPO RecName: Full=Sporulation protein kinase pit1;       
  670::906     1e-09  27%  988 aa  PCK1_SCHPO RecName: Full=Protein kinase C-like 1;       
 1102::1306    1e-09  26% 1383 aa  PASK_MOUSE RecName: Full=PAS domain-containing
   35::243     1e-09  29%  379 aa  MK03_HUMAN RecName: Full=Mitogen-activated protein kinase 3;       
   68::250     1e-09  30%  394 aa  MAPK_PEA RecName: Full=Mitogen-activated protein kinase homolog D5;
   92::277     1e-09  27%  359 aa  MAPK2_DROME RecName: Full=MAP kinase-activated protein kinase 2;   
  246::490     1e-09  26%  509 aa  LCK_SAISC RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
  245::487     1e-09  26%  508 aa  LCK_CHICK RecName: Full=Proto-oncogene tyrosine-protein kinase LCK;
    7::196     1e-09  29%  306 aa  KIN28_YEAST RecName: Full=Serine/threonine-protein kinase KIN28;   
  217::420     1e-09  30%  712 aa  IRAK1_HUMAN RecName: Full=Interleukin-1 receptor-associated kinase
   29::237     1e-09  34%  420 aa  HOG2_ZYGRO RecName: Full=Mitogen-activated protein kinase HOG2;    
  861::1076    1e-09  24% 1173 aa  FLS2_ARATH RecName: Full=LRR receptor-like serine/threonine-protein
  634::893     1e-09  26%  998 aa  EPHA7_MOUSE RecName: Full=Ephrin type-A receptor 7;       
  198::396     1e-09  28%  722 aa  DYRK2_DROME RecName: Full=Dual specificity
  581::915     1e-09  35% 1338 aa  CEK1_SCHPO RecName: Full=Serine/threonine-protein kinase cek1;     
    6::231     1e-09  29%  376 aa  CDK9_XENTR RecName: Full=Cell division protein kinase 9;       
    9::195     1e-09  28%  302 aa  CDC2_RANDY RecName: Full=Cell division control protein 2 homolog;  
    9::230     1e-09  31%  303 aa  CDC2_ORYLU RecName: Full=Cell division control protein 2 homolog;  
    9::230     1e-09  31%  303 aa  CDC2_ORYLA RecName: Full=Cell division control protein 2 homolog;  
    9::230     1e-09  31%  303 aa  CDC2_ORYJA RecName: Full=Cell division control protein 2 homolog;  
    9::216     1e-09  30%  302 aa  CDC2_CARAU RecName: Full=Cell division control protein 2 homolog;  
   13::197     1e-09  25%  314 aa  CDC2C_DROME RecName: Full=Cell division control protein 2 cognate; 
    4::199     1e-09  29%  294 aa  CDC2A_ANTMA RecName: Full=Cell division control protein 2 homolog
  894::1096    1e-09  26% 1207 aa  BRI1_SOLPE RecName: Full=Systemin receptor SR160;       
  151::392     1e-09  27%  481 aa  AKT1_XENLA RecName: Full=RAC-alpha serine/threonine-protein kinase;
  154::375     1e-09  25%  746 aa  ABL_MLVAB RecName: Full=Tyrosine-protein kinase transforming
  217::438     1e-09  25%  439 aa  ABL_FSVHY RecName: Full=Tyrosine-protein kinase transforming
  268::489     1e-09  25% 1123 aa  ABL1_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase
  283::521     2e-09  24%  544 aa  YES_XIPHE RecName: Full=Tyrosine-protein kinase Yes;       
  518::724     2e-09  26%  878 aa  Y4391_ARATH RecName: Full=Probable receptor-like protein kinase
  256::505     2e-09  24%  520 aa  WEE1_ORYSJ RecName: Full=Wee1-like protein kinase;       
   95::322     2e-09  24%  570 aa  TESK2_MOUSE RecName: Full=Dual specificity testis-specific protein
  300::497     2e-09  28%  620 aa  SERK4_ARATH RecName: Full=Somatic embryogenesis receptor kinase 4; 
  363::605     2e-09  24%  714 aa  PKD1_DICDI RecName: Full=Developmentally-regulated protein kinase
  119::383     2e-09  29%  404 aa  PIM1_HUMAN RecName: Full=Proto-oncogene serine/threonine-protein
   13::205     2e-09  28%  330 aa  PHO85_DEBHA RecName: Full=Negative regulator of the PHO system;    
   86::288     2e-09  26%  433 aa  PFTK2_MOUSE RecName: Full=Serine/threonine-protein kinase
   38::239     2e-09  31%  369 aa  MPK11_ARATH RecName: Full=Mitogen-activated protein kinase 11;     
   19::224     2e-09  28%  358 aa  MK01_RAT RecName: Full=Mitogen-activated protein kinase 1;       
   19::224     2e-09  28%  358 aa  MK01_MOUSE RecName: Full=Mitogen-activated protein kinase 1;       
   21::226     2e-09  28%  360 aa  MK01_HUMAN RecName: Full=Mitogen-activated protein kinase 1;       
   21::226     2e-09  28%  360 aa  MK01_BOVIN RecName: Full=Mitogen-activated protein kinase 1;       
   23::284     2e-09  31%  772 aa  KS6A4_HUMAN RecName: Full=Ribosomal protein S6 kinase alpha-4;     
  250::452     2e-09  26%  597 aa  KPC3_CAEEL RecName: Full=Protein kinase C-like 3;       
  777::1013    2e-09  26% 1096 aa  KPC1_ASPNG RecName: Full=Protein kinase C-like;         EC=2.7.11.13;
    4::277     2e-09  28%  632 aa  ICK_HUMAN RecName: Full=Serine/threonine-protein kinase ICK;       
   15::212     2e-09  30%  357 aa  HOG1_MYCGR RecName: Full=Mitogen-activated protein kinase Hog1;    
  489::676     2e-09  29%  830 aa  HERK_ARATH RecName: Full=Receptor-like protein kinase HERK 1;      
  263::505     2e-09  28%  526 aa  HCK_HUMAN RecName: Full=Tyrosine-protein kinase HCK;       
  205::319     2e-09  30% 1637 aa  GEK_DROME RecName: Full=Serine/threonine-protein kinase Genghis
  637::895     2e-09  26% 1005 aa  EPHA8_HUMAN RecName: Full=Ephrin type-A receptor 8;       
  171::269     2e-09  31% 2027 aa  CTRO_HUMAN RecName: Full=Citron Rho-interacting kinase;       
   34::292     2e-09  26%  319 aa  CSK2A_ENCCU RecName: Full=Probable casein kinase II subunit alpha
    4::198     2e-09  26%  292 aa  CDKA2_ORYSJ RecName: Full=Cyclin-dependent kinase A-2;       
    4::212     2e-09  27%  360 aa  CDK7_DICDI RecName: Full=Cell division protein kinase 7;       
    3::186     2e-09  33%  280 aa  CDC2B_ANTMA RecName: Full=Cell division control protein 2 homolog
  236::480     2e-09  28%  499 aa  BLK_MOUSE RecName: Full=Tyrosine-protein kinase BLK;       
   23::329     2e-09  29%  638 aa  ARK1_YEAST RecName: Full=Actin-regulating kinase 1;       
  171::412     2e-09  27%  501 aa  AKT_MLVAT RecName: Full=AKT kinase-transforming protein;       
  150::391     2e-09  27%  480 aa  AKT1_RAT RecName: Full=RAC-alpha serine/threonine-protein kinase;  
  271::515     2e-09  24%  536 aa  YRK_CHICK RecName: Full=Proto-oncogene tyrosine-protein kinase Yrk;
  276::518     2e-09  25%  541 aa  YES_CHICK RecName: Full=Tyrosine-protein kinase Yes;       
  268::510     2e-09  25%  528 aa  YES_AVISY RecName: Full=Tyrosine-protein kinase transforming
   31::262     2e-09  27%  492 aa  WNK9_ARATH RecName: Full=Probable serine/threonine-protein kinase
   95::243     2e-09  26%  571 aa  TESK2_HUMAN RecName: Full=Dual specificity testis-specific protein
  268::515     2e-09  26%  526 aa  SRC_RSVH1 RecName: Full=Tyrosine-protein kinase transforming
   25::272     2e-09  20%  576 aa  POLO_DROME RecName: Full=Serine/threonine-protein kinase polo;     
  450::708     2e-09  26%  981 aa  NEKL4_CAEEL RecName: Full=Serine/threonine-protein kinase D1044.8; 
   59::273     2e-09  28%  339 aa  MOS_RAT RecName: Full=Proto-oncogene serine/threonine-protein
   36::244     2e-09  29%  380 aa  MK03_RAT RecName: Full=Mitogen-activated protein kinase 3;       
   36::244     2e-09  29%  380 aa  MK03_MOUSE RecName: Full=Mitogen-activated protein kinase 3;       
  431::568     2e-09  30%  697 aa  KPCG_RABIT RecName: Full=Protein kinase C gamma type;       
  431::568     2e-09  30%  697 aa  KPCG_HUMAN RecName: Full=Protein kinase C gamma type;       
  962::1093    2e-09  37% 1101 aa  KOE5_YEAST RecName: Full=Probable serine/threonine-protein kinase
  242::490     2e-09  26%  512 aa  FRK_MOUSE RecName: Full=Tyrosine-protein kinase FRK;       
  526::801     2e-09  31%  926 aa  ERN2_HUMAN RecName: Full=Serine/threonine-protein
  629::888     2e-09  26%  993 aa  EPHA7_CHICK RecName: Full=Ephrin type-A receptor 7;       
  919::1081    2e-09  36% 1114 aa  E2AK3_MOUSE RecName: Full=Eukaryotic translation initiation factor
  155::325     2e-09  28%  639 aa  DMPK_HUMAN RecName: Full=Myotonin-protein kinase;       
   13::276     2e-09  21% 1430 aa  DAPK1_HUMAN RecName: Full=Death-associated protein kinase 1;       
   17::220     2e-09  24%  512 aa  CHK1_DROME RecName: Full=Serine/threonine-protein kinase grp;      
  614::764     2e-09  32% 1061 aa  CDC7_DICDI RecName: Full=Probable serine/threonine-protein kinase
    4::202     2e-09  27%  346 aa  CCRK_HUMAN RecName: Full=Cell cycle-related kinase;       
  314::534     2e-09  24% 1182 aa  ABL2_HUMAN RecName: Full=Tyrosine-protein kinase ABL2;       
  411::565     2e-09  30%  691 aa  7TMK1_DICDI RecName: Full=Seven transmembrane domain-containing
  192::324     2e-09  33%  335 aa  044L_IIV3 RecName: Full=Putative serine/threonine-protein kinase
  710::972     3e-09  30% 1167 aa  XMRK_XIPMA RecName: Full=Melanoma receptor tyrosine-protein kinase;
   34::229     3e-09  26%  557 aa  WNK7_ARATH RecName: Full=Probable serine/threonine-protein kinase
  516::701     3e-09  28%  855 aa  THE1_ARATH RecName: Full=Receptor-like protein kinase THESEUS 1;   
  243::476     3e-09  29%  567 aa  TGFR2_HUMAN RecName: Full=TGF-beta receptor type-2;       
    4::200     3e-09  29%  353 aa  SRK2G_ARATH RecName: Full=Serine/threonine-protein kinase SRK2G;   
  249::501     3e-09  25%  517 aa  SRC42_DROME RecName: Full=Tyrosine-protein kinase Src42A;       
   51::298     3e-09  28%  527 aa  SHKA_DICDI RecName: Full=Dual specificity protein kinase shkA;     
   45::263     3e-09  31%  419 aa  PMK2_CAEEL RecName: Full=Mitogen-activated protein kinase pmk-2;   
   74::294     3e-09  30%  387 aa  PKNS_MYCGE RecName: Full=Putative serine/threonine-protein kinase; 
   28::292     3e-09  29%  313 aa  PIM1_BOVIN RecName: Full=Proto-oncogene serine/threonine-protein
    9::195     3e-09  30%  303 aa  PHO85_ASHGO RecName: Full=Negative regulator of the PHO system;    
  498::767     3e-09  27% 1798 aa  MAST2_HUMAN RecName: Full=Microtubule-associated
  431::568     3e-09  30%  697 aa  KPCG_MACFA RecName: Full=Protein kinase C gamma type;       
  250::452     3e-09  25%  597 aa  KPC3_CAEBR RecName: Full=Protein kinase C-like 3;       
  275::521     3e-09  25%  537 aa  FYN_XIPHE RecName: Full=Proto-oncogene tyrosine-protein kinase FYN;
  275::516     3e-09  24%  537 aa  FYN_RAT RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;  
  275::516     3e-09  24%  537 aa  FYN_PIG RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;  
  275::516     3e-09  24%  537 aa  FYN_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
  275::516     3e-09  24%  537 aa  FYN_BOVIN RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
    4::198     3e-09  25%  414 aa  CHK1_ENCCU RecName: Full=Probable serine/threonine-protein kinase
   52::329     3e-09  25%  534 aa  CDPKI_ARATH RecName: Full=Calcium-dependent protein kinase 18;     
   13::202     3e-09  29%  348 aa  CDKD2_ARATH RecName: Full=Cyclin-dependent kinase D-2;       
    9::230     3e-09  31%  303 aa  CDC2_ORYCU RecName: Full=Cell division control protein 2 homolog;  
    9::246     3e-09  32%  303 aa  CDC2_CHICK RecName: Full=Cell division control protein 2 homolog;  
   60::274     3e-09  30%  657 aa  BUR1_YEAST RecName: Full=Serine/threonine-protein kinase BUR1;     
   50::287     3e-09  34%  645 aa  BUR1_KLULA RecName: Full=Serine/threonine-protein kinase BUR1;     
   19::315     3e-09  27%  960 aa  ATG1_PENCW RecName: Full=Serine/threonine-protein kinase ATG1;     
  150::391     3e-09  27%  480 aa  AKT1_MOUSE RecName: Full=RAC-alpha serine/threonine-protein kinase;
  434::655     3e-09  26%  751 aa  ACCR4_ARATH RecName: Full=Serine/threonine-protein kinase-like
  276::514     4e-09  26%  537 aa  YES_XENLA RecName: Full=Tyrosine-protein kinase Yes;       
  276::518     4e-09  26%  541 aa  YES_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase Yes;
  278::520     4e-09  26%  543 aa  YES_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase Yes;
  274::516     4e-09  26%  539 aa  YES_CANFA RecName: Full=Proto-oncogene tyrosine-protein kinase Yes;
   38::233     4e-09  27%  417 aa  WNK9_ORYSJ RecName: Full=Probable serine/threonine-protein kinase
   31::226     4e-09  28%  612 aa  WNK4_ORYSJ RecName: Full=Probable serine/threonine-protein kinase
   30::225     4e-09  29%  568 aa  WNK2_ARATH RecName: Full=Serine/threonine-protein kinase WNK2;     
 2957::3214    4e-09  21% 3259 aa  SPEG_RAT RecName: Full=Striated muscle-specific
 2960::3217    4e-09  21% 3262 aa  SPEG_MOUSE RecName: Full=Striated muscle-specific
  613::836     4e-09  27%  946 aa  PKN1_MOUSE RecName: Full=Serine/threonine-protein kinase N1;       
   28::303     4e-09  28%  313 aa  PIM1_RAT RecName: Full=Proto-oncogene serine/threonine-protein
  874::980     4e-09  31% 1094 aa  P2C19_ARATH RecName: Full=Protein phosphatase 2C and cyclic
  718::978     4e-09  27% 1335 aa  NDRC_DICDI RecName: Full=Probable serine/threonine-protein kinase
  188::296     4e-09  29% 1732 aa  MRCKA_RAT RecName: Full=Serine/threonine-protein kinase MRCK alpha;
  188::296     4e-09  29% 1719 aa  MRCKA_MOUSE RecName: Full=Serine/threonine-protein kinase MRCK
  188::296     4e-09  29% 1732 aa  MRCKA_HUMAN RecName: Full=Serine/threonine-protein kinase MRCK
   15::185     4e-09  32%  378 aa  MPKC_ASPFU RecName: Full=Mitogen-activated protein kinase mpkC;    
   19::222     4e-09  32%  365 aa  MK14B_DROME RecName: Full=Mitogen-activated protein kinase 14B;    
  431::568     4e-09  31%  697 aa  KPCG_RAT RecName: Full=Protein kinase C gamma type;       
  431::568     4e-09  31%  697 aa  KPCG_MOUSE RecName: Full=Protein kinase C gamma type;       
  416::553     4e-09  31%  682 aa  KPCG_BOVIN RecName: Full=Protein kinase C gamma type;       
  424::588     4e-09  28%  674 aa  KPCD_CANFA RecName: Full=Protein kinase C delta type;       
  491::761     4e-09  27%  893 aa  KN8R_YEAST RecName: Full=Probable serine/threonine-protein kinase
  328::586     4e-09  28%  720 aa  KIN82_YEAST RecName: Full=Probable serine/threonine-protein kinase
    6::227     4e-09  30%  372 aa  CDK9_RAT RecName: Full=Cell division protein kinase 9;       
    6::227     4e-09  30%  372 aa  CDK9_MOUSE RecName: Full=Cell division protein kinase 9;       
    6::231     4e-09  29%  376 aa  CDK9B_XENLA RecName: Full=Cell division protein kinase 9-B;        
    6::205     4e-09  30%  303 aa  CDK4_HUMAN RecName: Full=Cell division protein kinase 4;       
   27::245     4e-09  28%  332 aa  CDC2_CAEEL RecName: Full=Cell division control protein 2 homolog;  
   51::280     4e-09  31%  753 aa  BUR1_ASHGO RecName: Full=Serine/threonine-protein kinase BUR1;     
  397::645     4e-09  23%  651 aa  BMX_MOUSE RecName: Full=Cytoplasmic tyrosine-protein kinase BMX;   
  152::399     5e-09  24% 1789 aa  WNK3_MOUSE RecName: Full=Serine/threonine-protein kinase WNK3;     
  227::474     5e-09  25% 2126 aa  WNK1_RAT RecName: Full=Serine/threonine-protein kinase WNK1;       
  227::474     5e-09  25% 2377 aa  WNK1_MOUSE RecName: Full=Serine/threonine-protein kinase WNK1;     
  227::474     5e-09  25% 2382 aa  WNK1_HUMAN RecName: Full=Serine/threonine-protein kinase WNK1;     
   10::275     5e-09  26% 1275 aa  ULK4_HUMAN RecName: Full=Serine/threonine-protein kinase ULK4;     
   15::241     5e-09  29%  725 aa  TBK1_XENLA RecName: Full=Serine/threonine-protein kinase TBK1;     
  128::298     5e-09  31%  305 aa  STK16_MOUSE RecName: Full=Serine/threonine-protein kinase 16;      
  130::438     5e-09  28% 1142 aa  PAK1_YEAST RecName: Full=Serine/threonine-protein kinase PAK1;     
   25::183     5e-09  26%  438 aa  MYLK_SHEEP RecName: Full=Myosin light chain kinase, smooth muscle; 
   59::260     5e-09  27%  394 aa  MPK2_ORYSJ RecName: Full=Mitogen-activated protein kinase 2;       
 1038::1301    5e-09  24% 1607 aa  MIPR_LYMST RecName: Full=Putative molluscan insulin-related
   29::215     5e-09  29%  377 aa  HOG1_CANAL RecName: Full=Mitogen-activated protein kinase HOG1;    
  241::483     5e-09  28%  504 aa  HCK_MACFA RecName: Full=Tyrosine-protein kinase HCK;       
  275::516     5e-09  24%  537 aa  FYN_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
  634::893     5e-09  25%  998 aa  EPHA7_RAT RecName: Full=Ephrin type-A receptor 7;       
  634::893     5e-09  25%  998 aa  EPHA7_HUMAN RecName: Full=Ephrin type-A receptor 7;       
  538::799     5e-09  24%  902 aa  EPB1B_XENLA RecName: Full=Ephrin type-B receptor 1-B;       
   16::265     5e-09  23%  454 aa  DAPK3_HUMAN RecName: Full=Death-associated protein kinase 3;       
    6::205     5e-09  31%  303 aa  CDK4_PIG RecName: Full=Cell division protein kinase 4;       
    6::205     5e-09  31%  303 aa  CDK4_BOVIN RecName: Full=Cell division protein kinase 4;       
  353::539     6e-09  25%  640 aa  Y5516_ARATH RecName: Full=Probable receptor kinase At5g05160;      
 2805::3043    6e-09  24% 3102 aa  TRIO_MOUSE RecName: Full=Triple functional domain protein;       
  243::476     6e-09  28%  567 aa  TGFR2_RAT RecName: Full=TGF-beta receptor type-2;       
  268::501     6e-09  28%  592 aa  TGFR2_MOUSE RecName: Full=TGF-beta receptor type-2;       
  419::616     6e-09  25%  687 aa  SRF4_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY
 1030::1292    6e-09  24% 1726 aa  ROCO4_DICDI RecName: Full=Probable serine/threonine-protein kinase
  471::682     6e-09  28%  835 aa  PUB35_ARATH RecName: Full=U-box domain-containing protein
   28::292     6e-09  28%  313 aa  PIM1_FELCA RecName: Full=Proto-oncogene serine/threonine-protein
  250::392     6e-09  31%  836 aa  PDPK1_DROME RecName: Full=3-phosphoinositide-dependent protein
  209::422     6e-09  30%  542 aa  NDRB_DICDI RecName: Full=Probable serine/threonine-protein kinase
   41::242     6e-09  30%  376 aa  MPK4_ARATH RecName: Full=Mitogen-activated protein kinase 4;       
  382::634     6e-09  26% 1570 aa  MAST1_RAT RecName: Full=Microtubule-associated
  382::634     6e-09  26% 1570 aa  MAST1_MOUSE RecName: Full=Microtubule-associated
  380::632     6e-09  26% 1570 aa  MAST1_HUMAN RecName: Full=Microtubule-associated
  424::588     6e-09  27%  673 aa  KPCD_RAT RecName: Full=Protein kinase C delta type;       
  558::752     6e-09  30%  952 aa  KP58_DROME RecName: Full=Serine/threonine-protein kinase PITSLRE;  
  701::846     6e-09  29%  984 aa  IREA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  612::740     6e-09  34%  967 aa  IRE1_CAEEL RecName: Full=Serine/threonine-protein
   15::221     6e-09  29%  717 aa  IKKE_MOUSE RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   15::221     6e-09  31%  716 aa  IKKE_HUMAN RecName: Full=Inhibitor of nuclear factor kappa-B kinase
   15::205     6e-09  31%  354 aa  HOG1_BOTFB RecName: Full=Mitogen-activated protein kinase hog1;    
  189::387     6e-09  29%  568 aa  DYRK3_MACFA RecName: Full=Dual specificity
  209::407     6e-09  29%  588 aa  DYRK3_HUMAN RecName: Full=Dual specificity
    4::205     6e-09  30%  319 aa  CDK4_XENLA RecName: Full=Cell division protein kinase 4;       
    4::191     6e-09  28%  291 aa  CDK2_ENTHI RecName: Full=Cell division protein kinase 2 homolog;   
   43::250     6e-09  30%  470 aa  CCR12_ARATH RecName: Full=Serine/threonine-protein kinase-like
   23::319     6e-09  27%  941 aa  ATG1_PODAN RecName: Full=Serine/threonine-protein kinase atg1;     
  153::400     8e-09  24% 1743 aa  WNK3_HUMAN RecName: Full=Serine/threonine-protein kinase WNK3;     
    8::267     8e-09  31%  704 aa  WNK1_ORYSJ RecName: Full=Probable serine/threonine-protein kinase
    8::267     8e-09  31%  704 aa  WNK1_ORYSI RecName: Full=Probable serine/threonine-protein kinase
   98::359     8e-09  28%  458 aa  ST38L_DROPS RecName: Full=Serine/threonine-protein kinase 38-like; 
  451::661     8e-09  28%  819 aa  PUB53_ARATH RecName: Full=Putative U-box domain-containing protein
    7::253     8e-09  21%  924 aa  PLK4_RAT RecName: Full=Serine/threonine-protein kinase PLK4;       
  112::387     8e-09  27%  397 aa  PIM1_MOUSE RecName: Full=Proto-oncogene serine/threonine-protein
  138::273     8e-09  26%  431 aa  NRKA_TRYBB RecName: Full=Putative serine/threonine-protein kinase
   63::266     8e-09  26%  802 aa  MLTK_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
   43::203     8e-09  30%  417 aa  MKNK1_XENTR RecName: Full=MAP kinase-interacting
   11::191     8e-09  28%  356 aa  MK14C_DROME RecName: Full=Putative mitogen-activated protein kinase
   24::229     8e-09  27%  361 aa  MK01_XENLA RecName: Full=Mitogen-activated protein kinase 1;       
  459::708     8e-09  26% 1734 aa  MAST2_MOUSE RecName: Full=Microtubule-associated
  776::1012    8e-09  26% 1097 aa  KPC1_CANAL RecName: Full=Protein kinase C-like 1;         Short=PKC
  620::881     8e-09  25%  984 aa  EPHB1_RAT RecName: Full=Ephrin type-B receptor 1;       
  620::881     8e-09  25%  984 aa  EPHB1_MOUSE RecName: Full=Ephrin type-B receptor 1;       
  631::887     8e-09  27%  977 aa  EPHA1_MOUSE RecName: Full=Ephrin type-A receptor 1;       
  356::495     8e-09  35%  513 aa  E2AK2_RAT RecName: Full=Interferon-induced, double-stranded
    6::227     8e-09  30%  372 aa  CDK9_HUMAN RecName: Full=Cell division protein kinase 9;       
    6::205     8e-09  31%  303 aa  CDK4_RAT RecName: Full=Cell division protein kinase 4;       
    6::205     8e-09  31%  303 aa  CDK4_MOUSE RecName: Full=Cell division protein kinase 4;       
   44::264     8e-09  28%  746 aa  BUR1_CANAL RecName: Full=Serine/threonine-protein kinase BUR1;     
   21::323     8e-09  29%  932 aa  ATG1_NEUCR RecName: Full=Serine/threonine-protein kinase atg-1;    
   28::267     1e-08  28%  516 aa  WNK3_ARATH RecName: Full=Probable serine/threonine-protein kinase
  496::768     1e-08  26%  880 aa  TYRO3_MOUSE RecName: Full=Tyrosine-protein kinase receptor TYRO3;  
  506::778     1e-08  26%  890 aa  TYRO3_HUMAN RecName: Full=Tyrosine-protein kinase receptor TYRO3;  
   12::216     1e-08  24%  358 aa  TSSK2_HUMAN RecName: Full=Testis-specific serine/threonine-protein
 2802::3040    1e-08  24% 3097 aa  TRIO_HUMAN RecName: Full=Triple functional domain protein;       
  278::478     1e-08  27%  601 aa  SERK5_ARATH RecName: Full=Somatic embryogenesis receptor kinase 5; 
  660::930     1e-08  30% 1072 aa  PPK4_SCHPO RecName: Full=Serine/threonine-protein kinase ppk4;     
   78::214     1e-08  32%  274 aa  PK1_NPVOP RecName: Full=Serine/threonine-protein kinase 1;       
   32::287     1e-08  31%  311 aa  PIM2_HUMAN RecName: Full=Serine/threonine-protein kinase Pim-2;    
  690::848     1e-08  30%  915 aa  PHOT2_ARATH RecName: Full=Phototropin-2;       
    8::247     1e-08  34%  341 aa  PDK1L_MOUSE RecName: Full=Serine/threonine-protein kinase PDIK1L;  
  142::225     1e-08  41%  372 aa  NTF3_TOBAC RecName: Full=Mitogen-activated protein kinase homolog
  142::225     1e-08  41%  370 aa  MPK3_ORYSJ RecName: Full=Mitogen-activated protein kinase 3;       
  142::225     1e-08  41%  384 aa  MAPK_PETHY RecName: Full=Mitogen-activated protein kinase homolog
  102::229     1e-08  28%  330 aa  MAPK2_RABIT RecName: Full=MAP kinase-activated protein kinase 2;   
 1886::2128    1e-08  30% 2527 aa  LRRK2_MOUSE RecName: Full=Leucine-rich repeat
  424::588     1e-08  27%  674 aa  KPCD_MOUSE RecName: Full=Protein kinase C delta type;       
    4::277     1e-08  27%  629 aa  ICK_MOUSE RecName: Full=Serine/threonine-protein kinase ICK;       
    3::146     1e-08  30%  278 aa  HOG1_WALIC RecName: Full=Mitogen-activated protein kinase HOG1;    
   15::212     1e-08  30%  366 aa  HOG1_EURHE RecName: Full=Mitogen-activated protein kinase hog1;    
  235::483     1e-08  25%  505 aa  FRK_HUMAN RecName: Full=Tyrosine-protein kinase FRK;       
  514::764     1e-08  29%  911 aa  ERN2_MOUSE RecName: Full=Serine/threonine-protein
  638::899     1e-08  25% 1002 aa  EPHB5_CHICK RecName: Full=Ephrin type-B receptor 5;       
  620::881     1e-08  25%  984 aa  EPHB1_HUMAN RecName: Full=Ephrin type-B receptor 1;       
  620::881     1e-08  25%  984 aa  EPHB1_CHICK RecName: Full=Ephrin type-B receptor 1;       
  630::883     1e-08  26%  976 aa  EPHA1_HUMAN RecName: Full=Ephrin type-A receptor 1;       
    6::227     1e-08  30%  372 aa  CDK9_BOVIN RecName: Full=Cell division protein kinase 9;       
   19::312     1e-08  25%  951 aa  ATG1_SCLS1 RecName: Full=Serine/threonine-protein kinase ATG1;     
  530::808     1e-08  28%  908 aa  Y0019_DICDI RecName: Full=Probable serine/threonine-protein kinase
  102::297     1e-08  27%  444 aa  SUR1_CAEEL RecName: Full=Mitogen-activated protein kinase mpk-1;   
   40::243     1e-08  29%  405 aa  SSN3_YARLI RecName: Full=Serine/threonine-protein kinase SSN3;     
    5::206     1e-08  31%  352 aa  SSN3_SCHPO RecName: Full=Serine/threonine-protein kinase prk1;     
   61::263     1e-08  28%  499 aa  SSN3_MAGGR RecName: Full=Serine/threonine-protein kinase SSN3;     
    7::253     1e-08  21%  970 aa  PLK4_HUMAN RecName: Full=Serine/threonine-protein kinase PLK4;     
   63::266     1e-08  26%  800 aa  MLTK_HUMAN RecName: Full=Mitogen-activated protein kinase kinase
  514::783     1e-08  25%  864 aa  LTK_HUMAN RecName: Full=Leukocyte tyrosine kinase receptor;        
 1100::1348    1e-08  30% 1356 aa  KAB7_YEAST RecName: Full=Probable serine/threonine-protein kinase
    4::277     1e-08  27%  629 aa  ICK_RAT RecName: Full=Serine/threonine-protein kinase ICK;       
    5::147     1e-08  30%  278 aa  HOG1_WALSE RecName: Full=Mitogen-activated protein kinase HOG1;    
    5::147     1e-08  30%  278 aa  HOG1_WALMU RecName: Full=Mitogen-activated protein kinase HOG1;    
  608::898     1e-08  28%  910 aa  DDR1_RAT RecName: Full=Epithelial discoidin domain-containing
    9::220     1e-08  29%  297 aa  CDC2_DROME RecName: Full=Cell division control protein 2 homolog;  
   58::286     1e-08  30%  667 aa  BUR1_CANGA RecName: Full=Serine/threonine-protein kinase BUR1;     
  421::669     1e-08  23%  675 aa  BMX_HUMAN RecName: Full=Cytoplasmic tyrosine-protein kinase BMX;   
  266::506     1e-08  25%  611 aa  AKT1_DROME RecName: Full=RAC serine/threonine-protein kinase;      
  314::559     1e-08  23% 1182 aa  ABL2_MOUSE RecName: Full=Tyrosine-protein kinase ABL2;       
  116::328     2e-08  29%  343 aa  TRIB2_HUMAN RecName: Full=Tribbles homolog 2;         Short=TRB-2;
  233::421     2e-08  29%  557 aa  TGFR2_CHICK RecName: Full=TGF-beta receptor type-2;       
   54::241     2e-08  27%  729 aa  TBK1_MOUSE RecName: Full=Serine/threonine-protein kinase TBK1;     
   54::241     2e-08  27%  729 aa  TBK1_HUMAN RecName: Full=Serine/threonine-protein kinase TBK1;     
  128::298     2e-08  30%  305 aa  STK16_RAT RecName: Full=Serine/threonine-protein kinase 16;        
   40::243     2e-08  29%  450 aa  SSN3_GIBMO RecName: Full=Serine/threonine-protein kinase SSN3;     
  275::549     2e-08  27%  552 aa  SRC64_DROME RecName: Full=Tyrosine-protein kinase Src64B;       
  809::1071    2e-08  25% 1095 aa  PSYR1_ARATH RecName: Full=Tyrosine-sulfated glycopeptide receptor 1; 
    7::253     2e-08  21%  970 aa  PLK4_PONAB RecName: Full=Serine/threonine-protein kinase PLK4;     
    8::247     2e-08  34%  341 aa  PDK1L_HUMAN RecName: Full=Serine/threonine-protein kinase PDIK1L;  
   56::241     2e-08  25%  334 aa  MRK1_ENCCU RecName: Full=Probable serine/threonine-protein kinase
  142::225     2e-08  43%  370 aa  MPK1_ARATH RecName: Full=Mitogen-activated protein kinase 1;       
  197::291     2e-08  41%  580 aa  MPK12_ORYSJ RecName: Full=Mitogen-activated protein kinase 12;     
  322::598     2e-08  30%  678 aa  MPH1_SCHPO RecName: Full=Serine/threonine-protein kinase mph1;     
   59::309     2e-08  27%  334 aa  MP2K6_BOVIN RecName: Full=Dual specificity mitogen-activated
   82::294     2e-08  28%  466 aa  MKNK2_XENTR RecName: Full=MAP kinase-interacting
   82::294     2e-08  28%  467 aa  MKNK2_XENLA RecName: Full=MAP kinase-interacting
  426::590     2e-08  26%  676 aa  KPCD_HUMAN RecName: Full=Protein kinase C delta type;       
 1002::1276    2e-08  24% 1362 aa  INSR_XENLA RecName: Full=Insulin receptor;         Short=IR;       
 1031::1292    2e-08  22% 1393 aa  INSR_AEDAE RecName: Full=Insulin-like receptor;         Short=MIR;   
  186::471     2e-08  26% 1178 aa  HEP_DROME RecName: Full=Dual specificity mitogen-activated protein
  484::776     2e-08  28%  822 aa  FGFR1_RAT RecName: Full=Basic fibroblast growth factor receptor 1; 
   70::248     2e-08  22%  323 aa  FER_RAT RecName: Full=Proto-oncogene tyrosine-protein kinase FER;  
  669::827     2e-08  33%  977 aa  ERN1_HUMAN RecName: Full=Serine/threonine-protein
  920::1082    2e-08  34% 1115 aa  E2AK3_HUMAN RecName: Full=Eukaryotic translation initiation factor
  171::316     2e-08  29% 2055 aa  CTRO_MOUSE RecName: Full=Citron Rho-interacting kinase;       
    4::204     2e-08  30%  303 aa  CKB11_ORYSJ RecName: Full=Cyclin-dependent kinase B1-1;       
  370::581     2e-08  28%  710 aa  CDKG2_ORYSJ RecName: Full=Cyclin-dependent kinase G-2;       
  370::581     2e-08  28%  710 aa  CDKG2_ORYSI RecName: Full=Cyclin-dependent kinase G-2;       
  186::442     2e-08  30%  528 aa  AKT2_CAEEL RecName: Full=Serine/threonine-protein kinase akt-2;    
  116::315     2e-08  29%  343 aa  TRIB2_PONAB RecName: Full=Tribbles homolog 2;         Short=TRB-2;
  116::315     2e-08  29%  343 aa  TRIB2_CANFA RecName: Full=Tribbles homolog 2;         Short=TRB-2;
  116::315     2e-08  29%  343 aa  TRIB2_BOVIN RecName: Full=Tribbles homolog 2;         Short=TRB-2;
   99::364     2e-08  28%  463 aa  ST38L_DROME RecName: Full=Serine/threonine-protein kinase 38-like; 
   39::241     2e-08  29%  426 aa  SSN3_EMENI RecName: Full=Serine/threonine-protein kinase ssn3;     
   23::231     2e-08  27%  484 aa  SLT2_YEAST RecName: Full=Mitogen-activated protein kinase
  596::781     2e-08  26%  899 aa  RLK6_ARATH RecName: Full=Receptor-like protein kinase At3g21340;   
  138::272     2e-08  26%  431 aa  NRKB_TRYBB RecName: Full=Putative serine/threonine-protein kinase
  123::300     2e-08  40%  569 aa  MPK8_ORYSJ RecName: Full=Mitogen-activated protein kinase 8;       
   25::216     2e-08  27%  544 aa  MK15_HUMAN RecName: Full=Mitogen-activated protein kinase 15;      
   29::840     2e-08  32%  879 aa  MASTL_HUMAN RecName: Full=Microtubule-associated
   10::207     2e-08  25%  272 aa  IPL1_ENCCU RecName: Full=Probable spindle assembly checkpoint
  309::509     2e-08  24%  714 aa  GPRK2_DROME RecName: Full=G protein-coupled receptor kinase 2;     
  191::392     2e-08  27%  700 aa  GPRK1_DROME RecName: Full=G protein-coupled receptor kinase 1;     
  385::671     2e-08  28%  713 aa  FGFR4_COTCO RecName: Full=Fibroblast growth factor receptor 4;     
  484::779     2e-08  28%  822 aa  FGFR1_HUMAN RecName: Full=Basic fibroblast growth factor receptor
  621::876     2e-08  24%  985 aa  EPB1A_XENLA RecName: Full=Ephrin type-B receptor 1-A;       
  799::996     2e-08  30% 1649 aa  E2AK4_HUMAN RecName: Full=Eukaryotic translation initiation factor
  893::1097    2e-08  25% 1288 aa  DRKD_DICDI RecName: Full=Probable serine/threonine-protein kinase
  609::899     2e-08  28%  911 aa  DDR1_MOUSE RecName: Full=Epithelial discoidin domain-containing
   58::243     2e-08  28%  358 aa  CDK11_DICDI RecName: Full=PITSVRE serine/threonine protein-kinase
   79::319     2e-08  24%  994 aa  ATG1_VANPO RecName: Full=Serine/threonine-protein kinase atg1;     
   19::271     2e-08  28%  943 aa  ATG1_CHAGB RecName: Full=Serine/threonine-protein kinase ATG1;     
  377::620     3e-08  28%  655 aa  Y1848_ARATH RecName: Full=Probable inactive receptor kinase
  177::413     3e-08  24%  641 aa  Y0670_DICDI RecName: Full=Probable serine/threonine-protein kinase
  147::315     3e-08  29%  343 aa  TRIB2_MOUSE RecName: Full=Tribbles homolog 2;         Short=TRB-2;
  128::298     3e-08  30%  305 aa  STK16_HUMAN RecName: Full=Serine/threonine-protein kinase 16;      
 2121::2330    3e-08  27% 2410 aa  PYK1_DICDI RecName: Full=Dual specificity protein kinase pyk1;       
  160::241     3e-08  36%  984 aa  NEK9_MOUSE RecName: Full=Serine/threonine-protein kinase Nek9;     
  217::311     3e-08  42%  700 aa  MPK9_ORYSJ RecName: Full=Mitogen-activated protein kinase 9;       
   31::221     3e-08  30%  363 aa  MPK13_ARATH RecName: Full=Mitogen-activated protein kinase 13;     
    8::195     3e-08  34%  200 aa  MOS_APTAU RecName: Full=Serine/threonine-protein kinase mos;       
   55::233     3e-08  31%  806 aa  MK07_MOUSE RecName: Full=Mitogen-activated protein kinase 7;       
   55::233     3e-08  31%  816 aa  MK07_HUMAN RecName: Full=Mitogen-activated protein kinase 7;       
   55::233     3e-08  31%  781 aa  MK07_BOVIN RecName: Full=Mitogen-activated protein kinase 7;       
   28::815     3e-08  31%  865 aa  MASTL_MOUSE RecName: Full=Microtubule-associated
  118::319     3e-08  27%  384 aa  MAPK3_RAT RecName: Full=MAP kinase-activated protein kinase 3;     
  420::556     3e-08  28%  671 aa  KPC4_DROME RecName: Full=Putative protein kinase C delta type
 1003::1268    3e-08  22% 1367 aa  IGF1R_HUMAN RecName: Full=Insulin-like growth factor 1 receptor;     
  480::780     3e-08  26%  816 aa  FGFR_HYDAT RecName: Full=Fibroblast growth factor receptor;        
  492::778     3e-08  27%  822 aa  FGFR4_PLEWA RecName: Full=Fibroblast growth factor receptor 4;     
  484::779     3e-08  28%  822 aa  FGFR1_MOUSE RecName: Full=Basic fibroblast growth factor receptor
  616::877     3e-08  24%  987 aa  EPHB4_MOUSE RecName: Full=Ephrin type-B receptor 4;       
  248::442     3e-08  32%  515 aa  E2AK2_MOUSE RecName: Full=Interferon-induced, double-stranded
  208::406     3e-08  29%  586 aa  DYRK3_RAT RecName: Full=Dual specificity
  208::406     3e-08  29%  586 aa  DYRK3_MOUSE RecName: Full=Dual specificity
  196::443     3e-08  26%  450 aa  CSK_RAT RecName: Full=Tyrosine-protein kinase CSK;       
  196::443     3e-08  26%  450 aa  CSK_MOUSE RecName: Full=Tyrosine-protein kinase CSK;       
   10::275     4e-08  25% 1275 aa  ULK4_PONAB RecName: Full=Serine/threonine-protein kinase ULK4;     
  496::768     4e-08  26%  880 aa  TYRO3_RAT RecName: Full=Tyrosine-protein kinase receptor TYRO3;    
   23::223     4e-08  26%  396 aa  ST32A_HUMAN RecName: Full=Serine/threonine-protein kinase 32A;     
   18::256     4e-08  22%  691 aa  PXI_DICDI RecName: Full=Probable serine/threonine-protein kinase
   41::230     4e-08  30%  377 aa  PMK1_CAEEL RecName: Full=Mitogen-activated protein kinase pmk-1;   
    7::253     4e-08  21%  893 aa  PLK4_BOVIN RecName: Full=Serine/threonine-protein kinase PLK4;     
  811::1066    4e-08  25% 1387 aa  PHG2_DICDI RecName: Full=Serine/threonine-protein kinase phg2;       
  248::486     4e-08  29%  623 aa  NRC2_NEUCR RecName: Full=Serine/threonine-protein kinase nrc-2;    
  135::229     4e-08  42%  611 aa  MPK10_ORYSJ RecName: Full=Mitogen-activated protein kinase 10;     
    8::195     4e-08  34%  200 aa  MOS_VULGR RecName: Full=Serine/threonine-protein kinase mos;       
   55::233     4e-08  31%  806 aa  MK07_RAT RecName: Full=Mitogen-activated protein kinase 7;       
  118::296     4e-08  27%  384 aa  MAPK3_MOUSE RecName: Full=MAP kinase-activated protein kinase 3;   
  985::1260    4e-08  23% 1358 aa  IGF1R_XENLA RecName: Full=Insulin-like growth factor 1 receptor;     
  276::537     4e-08  23%  640 aa  IGF1R_BOVIN RecName: Full=Insulin-like growth factor 1 receptor;   
  177::385     4e-08  26%  576 aa  GRK6_HUMAN RecName: Full=G protein-coupled receptor kinase 6;      
  570::748     4e-08  21%  823 aa  FER_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase FER;
  569::747     4e-08  21%  823 aa  FER_CANFA RecName: Full=Proto-oncogene tyrosine-protein kinase FER;
  669::827     4e-08  31%  977 aa  ERN1_MOUSE RecName: Full=Serine/threonine-protein
  610::871     4e-08  24%  974 aa  EPHB3_XENLA RecName: Full=Ephrin type-B receptor 3;       
  196::436     4e-08  26%  450 aa  CSK_CHICK RecName: Full=Tyrosine-protein kinase CSK;       
    5::200     4e-08  23%  474 aa  CHK1_XENLA RecName: Full=Serine/threonine-protein kinase Chk1;     
   24::210     4e-08  30%  352 aa  CDK7_XENLA RecName: Full=Cell division protein kinase 7;       
  209::391     4e-08  34% 1038 aa  BMPR2_HUMAN RecName: Full=Bone morphogenetic protein receptor
   73::356     4e-08  27%  395 aa  BIK1_ARATH RecName: Full=Serine/threonine-protein kinase BIK1;     
   22::272     4e-08  30%  675 aa  ATG1_COLLN RecName: Full=Serine/threonine-protein kinase ATG1;     
    3::303     4e-08  26%  928 aa  ATG1_ASPCL RecName: Full=Serine/threonine-protein kinase atg1;     
  191::436     4e-08  25%  688 aa  ARBK2_BOVIN RecName: Full=Beta-adrenergic receptor kinase 2;       
    1::278     4e-08  27%  332 aa  AAIP_WHEAT RecName: Full=Abscisic acid-inducible protein kinase;   
  250::374     5e-08  25% 1186 aa  Y3184_DICDI RecName: Full=Probable inactive
    5::218     5e-08  28%  341 aa  STPKL_ARATH RecName: Full=Serine/threonine-protein kinase-like
   23::225     5e-08  26%  414 aa  ST32B_MOUSE RecName: Full=Serine/threonine-protein kinase 32B;     
  241::491     5e-08  24%  506 aa  SRK4_SPOLA RecName: Full=Tyrosine-protein kinase isoform SRK4;     
    7::207     5e-08  26%  304 aa  PHO85_KLULA RecName: Full=Negative regulator of the PHO system;    
  341::428     5e-08  32%  686 aa  PDPKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  142::225     5e-08  42%  376 aa  MPK2_ARATH RecName: Full=Mitogen-activated protein kinase 2;       
  116::317     5e-08  27%  382 aa  MAPK3_HUMAN RecName: Full=MAP kinase-activated protein kinase 3;   
  886::1143    5e-08  25% 1323 aa  LET23_CAEEL RecName: Full=Receptor tyrosine-protein kinase let-23;   
  244::512     5e-08  24%  530 aa  IPL1_CANAL RecName: Full=Spindle assembly checkpoint kinase;       
 1002::1264    5e-08  23% 1370 aa  IGF1R_RAT RecName: Full=Insulin-like growth factor 1 receptor;       
  261::503     5e-08  27%  524 aa  HCK_RAT RecName: Full=Tyrosine-protein kinase HCK;       
  177::385     5e-08  26%  576 aa  GRK6_MOUSE RecName: Full=G protein-coupled receptor kinase 6;      
  253::496     5e-08  26%  517 aa  FGR_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase FGR;
  650::881     5e-08  25%  983 aa  EPHA3_CHICK RecName: Full=Ephrin type-A receptor 3;       
  420::578     5e-08  35%  630 aa  E2AK1_HUMAN RecName: Full=Eukaryotic translation initiation factor
  111::366     5e-08  31%  629 aa  DYR1B_MOUSE RecName: Full=Dual specificity
  111::366     5e-08  28%  629 aa  DYR1B_HUMAN RecName: Full=Dual specificity
  145::244     5e-08  29%  631 aa  DMPK_MOUSE RecName: Full=Myotonin-protein kinase;       
  196::443     5e-08  25%  450 aa  CSK_BOVIN RecName: Full=Tyrosine-protein kinase CSK;       
    5::208     5e-08  22%  476 aa  CHK1_CHICK RecName: Full=Serine/threonine-protein kinase Chk1;     
  311::546     5e-08  27%  730 aa  CD2L7_CAEEL RecName: Full=Putative cell division cycle 2-related
  209::391     5e-08  34% 1038 aa  BMPR2_MOUSE RecName: Full=Bone morphogenetic protein receptor
  526::687     7e-08  27%  815 aa  Y2393_ARATH RecName: Full=Probable receptor-like protein kinase
  180::398     7e-08  32%  402 aa  STK35_MOUSE RecName: Full=Serine/threonine-protein kinase 35;      
   54::255     7e-08  29%  443 aa  SSN3_PHANO RecName: Full=Serine/threonine-protein kinase SSN3;     
   79::205     7e-08  29%  267 aa  PK1_NPVHZ RecName: Full=Serine/threonine-protein kinase 1;       
   12::282     7e-08  24% 1613 aa  MYO3A_MOUSE RecName: Full=Myosin IIIA;         EC=2.7.11.1;
   12::282     7e-08  24% 1616 aa  MYO3A_HUMAN RecName: Full=Myosin IIIA;         EC=2.7.11.1;
  111::295     7e-08  30%  459 aa  MKNK2_RAT RecName: Full=MAP kinase-interacting
  111::295     7e-08  30%  459 aa  MKNK2_MOUSE RecName: Full=MAP kinase-interacting
  261::503     7e-08  27%  524 aa  HCK_MOUSE RecName: Full=Tyrosine-protein kinase HCK;       
  177::385     7e-08  26%  590 aa  GRK5_BOVIN RecName: Full=G protein-coupled receptor kinase 5;      
  270::513     7e-08  23%  534 aa  FYN_CHICK RecName: Full=Proto-oncogene tyrosine-protein kinase Fyn;
  484::757     7e-08  25%  824 aa  FGFR2_PLEWA RecName: Full=Fibroblast growth factor receptor 2;     
  353::534     7e-08  25%  609 aa  FES_FSVGA RecName: Full=Tyrosine-protein kinase transforming
   84::289     7e-08  28%  426 aa  ERKA_DROME RecName: Full=Mitogen-activated protein kinase ERK-A;   
  726::923     7e-08  28% 1255 aa  ERBB2_HUMAN RecName: Full=Receptor tyrosine-protein kinase erbB-2; 
  725::981     7e-08  27% 1259 aa  ERBB2_CANFA RecName: Full=Receptor tyrosine-protein kinase erbB-2; 
  516::774     7e-08  24%  877 aa  EPHA5_MOUSE RecName: Full=Ephrin type-A receptor 5;       
  797::995     7e-08  29% 1648 aa  E2AK4_MOUSE RecName: Full=Eukaryotic translation initiation factor
   30::239     7e-08  29%  513 aa  CDKC2_ORYSJ RecName: Full=Cyclin-dependent kinase C-2;       
    9::216     7e-08  29%  302 aa  CDC2A_XENLA RecName: Full=Cell division control protein 2-A;       
  357::620     9e-08  25%  658 aa  Y2267_ARATH RecName: Full=Probable inactive receptor kinase
  526::711     9e-08  29%  849 aa  Y1357_ARATH RecName: Full=Probable receptor-like protein kinase
    9::230     9e-08  31%  461 aa  VHS1_YEAST RecName: Full=Serine/threonine-protein kinase VHS1;     
  409::623     9e-08  32%  688 aa  TSL_ARATH RecName: Full=Serine/threonine-protein kinase TOUSLED;   
   23::225     9e-08  26%  414 aa  ST32B_HUMAN RecName: Full=Serine/threonine-protein kinase 32B;     
  121::414     9e-08  27%  512 aa  RCK1_YEAST RecName: Full=Serine/threonine-protein kinase RCK1;     
  494::710     9e-08  28%  775 aa  PPK6_SCHPO RecName: Full=Serine/threonine-protein kinase ppk6;     
  112::317     9e-08  27%  530 aa  NDRA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  123::217     9e-08  41%  569 aa  MPK7_ORYSJ RecName: Full=Mitogen-activated protein kinase 7;       
   20::198     9e-08  31%  366 aa  MK14A_DROME RecName: Full=Mitogen-activated protein kinase 14A;    
  118::319     9e-08  26%  384 aa  MAPK3_BOVIN RecName: Full=MAP kinase-activated protein kinase 3;   
  492::591     9e-08  31%  707 aa  KPCT_MOUSE RecName: Full=Protein kinase C theta type;       
    1::167     9e-08  31%  200 aa  HOG1_GIBIN RecName: Full=Mitogen-activated protein kinase HOG1;    
    1::167     9e-08  31%  207 aa  HOG1_FUSCU RecName: Full=Mitogen-activated protein kinase HOG1;    
  293::419     9e-08  33% 1191 aa  HIPK3_RAT RecName: Full=Homeodomain-interacting protein kinase 3;  
  293::419     9e-08  33% 1192 aa  HIPK3_MOUSE RecName: Full=Homeodomain-interacting protein kinase 3;
  653::911     9e-08  25% 1013 aa  EPHA5_CHICK RecName: Full=Ephrin type-A receptor 5;       
  644::882     9e-08  23%  984 aa  EPHA3_RAT RecName: Full=Ephrin type-A receptor 3;       
  196::443     9e-08  25%  450 aa  CSK_HUMAN RecName: Full=Tyrosine-protein kinase CSK;       
    4::210     9e-08  30%  309 aa  CKB11_ARATH RecName: Full=Cyclin-dependent kinase B1-1;       
    3::201     9e-08  25%  391 aa  CDKD3_ARATH RecName: Full=Cyclin-dependent kinase D-3;       
   25::188     9e-08  32%  507 aa  CDC7_YEAST RecName: Full=Cell division control protein 7;       
  461::744     9e-08  26%  773 aa  CAD96_DROME RecName: Full=Tyrosine kinase receptor Cad96Ca;        
  200::374     9e-08  31%  513 aa  AVR2A_SHEEP RecName: Full=Activin receptor type-2A;       
  191::436     9e-08  24%  688 aa  ARBK2_HUMAN RecName: Full=Beta-adrenergic receptor kinase 2;       
  469::721     1e-07  23%  835 aa  TNI3K_RAT RecName: Full=Serine/threonine-protein kinase TNNI3K;    
  191::437     1e-07  22%  451 aa  PTK6_MOUSE RecName: Full=Tyrosine-protein kinase 6;       
  177::390     1e-07  27%  617 aa  PAR4_CAEEL RecName: Full=Serine/threonine-protein kinase par-4;    
  596::797     1e-07  26%  924 aa  NORK_PEA RecName: Full=Nodulation receptor kinase;       
  135::312     1e-07  39%  606 aa  MPK20_ARATH RecName: Full=Mitogen-activated protein kinase 20;     
    8::195     1e-07  34%  200 aa  MOS_GYMCA RecName: Full=Serine/threonine-protein kinase mos;       
    8::195     1e-07  35%  200 aa  MOS_CICNG RecName: Full=Serine/threonine-protein kinase mos;       
   28::252     1e-07  28%  501 aa  MKC1_CANAL RecName: Full=Mitogen-activated protein kinase MKC1;    
  401::485     1e-07  33%  581 aa  MIK1_SCHPO RecName: Full=Mitosis inhibitor protein kinase mik1;    
  100::196     1e-07  34%  473 aa  MAPK5_HUMAN RecName: Full=MAP kinase-activated protein kinase 5;   
  143::255     1e-07  29% 1029 aa  KSP1_YEAST RecName: Full=Serine/threonine-protein kinase KSP1;     
  765::915     1e-07  26%  984 aa  KIT_TAKRU RecName: Full=Mast/stem cell growth factor receptor;     
  969::1243    1e-07  23% 1300 aa  INSRR_CAVPO RecName: Full=Insulin receptor-related protein;       
  293::419     1e-07  32% 1215 aa  HIPK3_HUMAN RecName: Full=Homeodomain-interacting protein kinase 3;
  177::385     1e-07  26%  576 aa  GRK6_RAT RecName: Full=G protein-coupled receptor kinase 6;        
  221::402     1e-07  25%  477 aa  FES_FSVST RecName: Full=Tyrosine-protein kinase transforming
  616::877     1e-07  24%  987 aa  EPHB4_HUMAN RecName: Full=Ephrin type-B receptor 4;       
  643::881     1e-07  22%  983 aa  EPHA3_MOUSE RecName: Full=Ephrin type-A receptor 3;       
  643::881     1e-07  23%  983 aa  EPHA3_HUMAN RecName: Full=Ephrin type-A receptor 3;       
  353::569     1e-07  27%  719 aa  YP62_CAEEL RecName: Full=Putative serine/threonine-protein kinase
 1632::1872    1e-07  23% 1895 aa  WRK19_ARATH RecName: Full=Probable WRKY transcription factor
  501::768     1e-07  24%  874 aa  TYRO3_DANRE RecName: Full=Tyrosine-protein kinase receptor TYRO3;  
   12::216     1e-07  22%  367 aa  TSSK1_HUMAN RecName: Full=Testis-specific serine/threonine-protein
  547::822     1e-07  23%  936 aa  TNI3K_HUMAN RecName: Full=Serine/threonine-protein kinase TNNI3K;  
  179::397     1e-07  32%  401 aa  STK35_HUMAN RecName: Full=Serine/threonine-protein kinase 35;      
   96::360     1e-07  24%  464 aa  ST38L_HUMAN RecName: Full=Serine/threonine-protein kinase 38-like; 
  490::705     1e-07  26% 1023 aa  PPK1_SCHPO RecName: Full=Serine/threonine-protein kinase ppk1;     
  699::897     1e-07  25% 1087 aa  POM1_SCHPO RecName: Full=Dual specificity protein kinase pom1;     
  142::225     1e-07  39%  369 aa  MPK4_ORYSJ RecName: Full=Mitogen-activated protein kinase 4;       
   59::257     1e-07  30%  334 aa  MP2K6_MOUSE RecName: Full=Dual specificity mitogen-activated
  123::295     1e-07  31%  465 aa  MKNK2_HUMAN RecName: Full=MAP kinase-interacting
  199::437     1e-07  26%  467 aa  MATK_RAT RecName: Full=Megakaryocyte-associated tyrosine-protein
  123::247     1e-07  33%  375 aa  KOM8_YEAST RecName: Full=Probable serine/threonine-protein kinase
   11::215     1e-07  28%  616 aa  HIPK4_RAT RecName: Full=Homeodomain-interacting protein kinase 4;  
   11::215     1e-07  28%  616 aa  HIPK4_MOUSE RecName: Full=Homeodomain-interacting protein kinase 4;
  387::671     1e-07  28%  763 aa  FGFR_HALRO RecName: Full=Fibroblast growth factor receptor;        
  496::781     1e-07  26%  828 aa  FGFR4_XENLA RecName: Full=Fibroblast growth factor receptor 4;     
  477::750     1e-07  29%  813 aa  FGFR2_XENLA RecName: Full=Fibroblast growth factor receptor 2;     
  489::762     1e-07  26%  823 aa  FGFR2_CHICK RecName: Full=Fibroblast growth factor receptor 2;     
  507::772     1e-07  27%  816 aa  FGFR1_PLEWA RecName: Full=Fibroblast growth factor receptor 1;     
  422::634     1e-07  26%  729 aa  FGFR1_DROME RecName: Full=Fibroblast growth factor receptor homolog
  727::924     1e-07  28% 1256 aa  ERBB2_MOUSE RecName: Full=Receptor tyrosine-protein kinase erbB-2; 
  647::896     1e-07  24% 1008 aa  EPHAA_HUMAN RecName: Full=Ephrin type-A receptor 10;       
  219::417     1e-07  28%  632 aa  DYRK4_MOUSE RecName: Full=Dual specificity
   30::239     1e-07  29%  519 aa  CDKC1_ORYSJ RecName: Full=Cyclin-dependent kinase C-1;       
    9::216     1e-07  29%  302 aa  CDC2B_XENLA RecName: Full=Cell division control protein 2-B;       
  456::639     2e-07  28%  781 aa  ZAKA_DICDI RecName: Full=Dual specificity protein kinase zakA;     
  475::609     2e-07  30%  942 aa  Y9719_DICDI RecName: Full=Probable serine/threonine-protein kinase
  804::1018    2e-07  25% 1157 aa  Y7597_DROME RecName: Full=Cell division cycle 2-like protein kinase
  486::673     2e-07  28%  829 aa  Y5597_ARATH RecName: Full=Probable receptor-like protein kinase
 1524::1836    2e-07  30% 2102 aa  Y0701_DICDI RecName: Full=Probable serine/threonine-protein kinase
  201::396     2e-07  24% 2149 aa  WNK2_MOUSE RecName: Full=Serine/threonine-protein kinase WNK2;     
  201::396     2e-07  24% 2297 aa  WNK2_HUMAN RecName: Full=Serine/threonine-protein kinase WNK2;     
    7::234     2e-07  22%  346 aa  STLK_DROME RecName: Full=Putative serine/threonine-protein kinase
   23::223     2e-07  24%  398 aa  ST32A_MOUSE RecName: Full=Serine/threonine-protein kinase 32A;     
  112::288     2e-07  30%  466 aa  SSN3_CRYNE RecName: Full=Serine/threonine-protein kinase SSN3;     
    1::258     2e-07  23%  484 aa  SMKTR_MOUSE RecName: Full=Sperm motility kinase Tcr mutant form;   
  108::232     2e-07  32%  385 aa  SBK1_DANRE RecName: Full=Serine/threonine-protein kinase SBK1;     
   59::257     2e-07  30%  334 aa  MP2K6_HUMAN RecName: Full=Dual specificity mitogen-activated
   43::165     2e-07  30%  418 aa  MKNK1_XENLA RecName: Full=MAP kinase-interacting
  238::475     2e-07  26%  505 aa  MATK_MOUSE RecName: Full=Megakaryocyte-associated tyrosine-protein
  248::493     2e-07  24%  512 aa  LYN_HUMAN RecName: Full=Tyrosine-protein kinase Lyn;       
  492::591     2e-07  30%  707 aa  KPCT_RAT RecName: Full=Protein kinase C theta type;       
  357::557     2e-07  31%  636 aa  HAL4_SCHPO RecName: Full=Serine/threonine-protein kinase hal4;     
  482::755     2e-07  27%  819 aa  FGFR1_CHICK RecName: Full=Basic fibroblast growth factor receptor
  178::269     2e-07  36%  417 aa  ERK1_CANAL RecName: Full=Extracellular signal-regulated kinase 1;  
  728::925     2e-07  28% 1257 aa  ERBB2_RAT RecName: Full=Receptor tyrosine-protein kinase erbB-2;   
  646::895     2e-07  24% 1007 aa  EPHAA_MOUSE RecName: Full=Ephrin type-A receptor 10;       
  104::302     2e-07  28%  520 aa  DYRK4_HUMAN RecName: Full=Dual specificity
  131::279     2e-07  31%  454 aa  CIPK4_ORYSJ RecName: Full=CBL-interacting protein kinase 4;        
  355::547     2e-07  27%  693 aa  CDKG1_ORYSJ RecName: Full=Cyclin-dependent kinase G-1;       
  355::547     2e-07  27%  693 aa  CDKG1_ORYSI RecName: Full=Cyclin-dependent kinase G-1;       
    4::159     2e-07  28%  243 aa  CCRK_MACMU RecName: Full=Cell cycle-related kinase;       
   38::244     2e-07  30%  706 aa  BUR1_YARLI RecName: Full=Serine/threonine-protein kinase BUR1;     
  119::273     2e-07  29%  972 aa  ATG1_ASHGO RecName: Full=Serine/threonine-protein kinase ATG1;     
   25::170     3e-07  25%  256 aa  YBDM_BACSU RecName: Full=Probable serine/threonine-protein kinase
  534::804     3e-07  27%  848 aa  Y9849_DICDI RecName: Full=Probable serine/threonine-protein kinase
  364::631     3e-07  27%  654 aa  Y5830_ARATH RecName: Full=Probable inactive receptor kinase
   70::284     3e-07  26%  462 aa  Y0700_DICDI RecName: Full=Probable serine/threonine-protein kinase
   22::268     3e-07  23%  524 aa  WNK10_ARATH RecName: Full=Probable serine/threonine-protein kinase
   95::359     3e-07  24%  465 aa  STK38_PONAB RecName: Full=Serine/threonine-protein kinase 38;      
   95::359     3e-07  24%  465 aa  STK38_HUMAN RecName: Full=Serine/threonine-protein kinase 38;      
   95::359     3e-07  24%  465 aa  STK38_BOVIN RecName: Full=Serine/threonine-protein kinase 38;      
   85::204     3e-07  31%  274 aa  PK1_NPVLD RecName: Full=Serine/threonine-protein kinase 1;       
  136::230     3e-07  38%  570 aa  MPK11_ORYSJ RecName: Full=Mitogen-activated protein kinase 11;     
  162::313     3e-07  28%  545 aa  MOM4_CAEBR RecName: Full=Mitogen-activated protein kinase kinase
   72::269     3e-07  31%  363 aa  MKK4_CAEEL RecName: Full=MAP kinase kinase mkk-4;       
  100::196     3e-07  33%  473 aa  MAPK5_MOUSE RecName: Full=MAP kinase-activated protein kinase 5;   
  211::409     3e-07  23%  621 aa  IRAK2_BOVIN RecName: Full=Interleukin-1 receptor-associated
 1014::1288    3e-07  24% 1383 aa  INSR_RAT RecName: Full=Insulin receptor;         Short=IR;       
 1003::1277    3e-07  24% 1372 aa  INSR_MOUSE RecName: Full=Insulin receptor;         Short=IR;       
  879::1156    3e-07  28% 2631 aa  GBPC_DICDI RecName: Full=Cyclic GMP-binding protein C;       
  265::508     3e-07  25%  529 aa  FGR_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase FGR;
  483::756     3e-07  27%  817 aa  FGFR2_DANRE RecName: Full=Fibroblast growth factor receptor 2;     
  566::747     3e-07  25%  822 aa  FES_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase
  564::745     3e-07  25%  820 aa  FES_FELCA RecName: Full=Proto-oncogene tyrosine-protein kinase
  420::578     3e-07  35%  631 aa  E2AK1_MACFA RecName: Full=Eukaryotic translation initiation factor
  188::366     3e-07  26%  528 aa  CTK1_YEAST RecName: Full=CTD kinase subunit alpha;       
  214::472     3e-07  26%  598 aa  COT1_NEUCR RecName: Full=Serine/threonine-protein kinase cot-1;    
  733::938     3e-07  25% 1490 aa  CD2L7_HUMAN RecName: Full=Cell division cycle 2-related protein
  512::666     3e-07  30%  775 aa  ACCR1_ARATH RecName: Full=Serine/threonine-protein kinase-like
   27::251     3e-07  29%  820 aa  YNH4_CAEEL RecName: Full=Putative serine/threonine-protein kinase
  347::614     3e-07  25%  640 aa  Y3868_ARATH RecName: Full=Probable inactive receptor kinase
   41::286     3e-07  26%  619 aa  WNK8_ORYSJ RecName: Full=Probable serine/threonine-protein kinase
   49::251     3e-07  28%  435 aa  SSN3_ASPTN RecName: Full=Serine/threonine-protein kinase ssn3;     
   32::226     3e-07  29%  371 aa  NTF6_TOBAC RecName: Full=Mitogen-activated protein kinase homolog
  659::926     3e-07  26%  947 aa  MUSK_CHICK RecName: Full=Muscle, skeletal receptor tyrosine protein
  488::736     3e-07  27%  757 aa  HTK16_HYDAT RecName: Full=Tyrosine-protein kinase HTK16;       
  203::402     3e-07  23%  642 aa  GRK1_CAEEL RecName: Full=G protein-coupled receptor kinase 1;      
  288::531     3e-07  25%  545 aa  FGR_FSVGR RecName: Full=Tyrosine-protein kinase transforming
  641::915     3e-07  25%  972 aa  FGFR_STRPU RecName: Full=Fibroblast growth factor receptor;        
  499::777     3e-07  27%  806 aa  FGFR3_CHICK RecName: Full=Fibroblast growth factor receptor 3;     
  395::668     3e-07  26%  729 aa  FGFR2_NOTVI RecName: Full=Fibroblast growth factor receptor 2;     
  630::891     3e-07  25%  994 aa  EPHB2_MOUSE RecName: Full=Ephrin type-B receptor 2;       
  622::883     3e-07  25% 1055 aa  EPHB2_HUMAN RecName: Full=Ephrin type-B receptor 2;       
  640::901     3e-07  25% 1004 aa  EPHB2_CHICK RecName: Full=Ephrin type-B receptor 2;       
  679::937     3e-07  24% 1005 aa  EPHA5_RAT RecName: Full=Ephrin type-A receptor 5;       
  418::591     3e-07  36%  620 aa  E2AK1_RAT RecName: Full=Eukaryotic translation initiation factor
  283::426     3e-07  33%  763 aa  DYR1A_RAT RecName: Full=Dual specificity
  283::426     3e-07  33%  763 aa  DYR1A_MOUSE RecName: Full=Dual specificity
  283::426     3e-07  33%  763 aa  DYR1A_HUMAN RecName: Full=Dual specificity
    5::200     3e-07  22%  476 aa  CHK1_RAT RecName: Full=Serine/threonine-protein kinase Chk1;       
   13::206     3e-07  25%  366 aa  CDK10_DICDI RecName: Full=Probable cyclin-dependent kinase 10;     
  191::436     3e-07  23%  688 aa  ARBK2_RAT RecName: Full=Beta-adrenergic receptor kinase 2;       
  313::537     3e-07  24% 1224 aa  ABL1_CAEEL RecName: Full=Tyrosine-protein kinase abl-1;       
 1945::2204    4e-07  28% 2230 aa  Y9847_DICDI RecName: Full=Probable serine/threonine-protein kinase
  193::406     4e-07  26%  695 aa  Y0010_DICDI RecName: Full=Probable serine/threonine-protein kinase
   41::286     4e-07  29%  622 aa  WNK7_ORYSJ RecName: Full=Probable serine/threonine-protein kinase
   81::282     4e-07  27%  402 aa  U1206_GAHVG RecName: Full=Probable 44.7 kDa protein kinase;        
  468::720     4e-07  23%  834 aa  TNI3K_MOUSE RecName: Full=Serine/threonine-protein kinase TNNI3K;  
   41::243     4e-07  28%  426 aa  SSN3_ASPCL RecName: Full=Serine/threonine-protein kinase ssn3;     
  230::427     4e-07  23%  488 aa  SRMS_HUMAN RecName: Full=Tyrosine-protein kinase Srms;       
   89::205     4e-07  29%  272 aa  PK1_NPVAC RecName: Full=Serine/threonine-protein kinase 1;       
  602::798     4e-07  30%  925 aa  NORK_MEDTR RecName: Full=Nodulation receptor kinase;       
   67::272     4e-07  31%  409 aa  MSK1_TOBAC RecName: Full=Shaggy-related protein kinase NtK-1;      
  133::227     4e-07  38%  510 aa  MPK9_ARATH RecName: Full=Mitogen-activated protein kinase 9;       
    4::210     4e-07  25%  622 aa  MAK_RAT RecName: Full=Serine/threonine-protein kinase MAK;       
  248::493     4e-07  23%  512 aa  LYN_RAT RecName: Full=Tyrosine-protein kinase Lyn;       
 1121::1266    4e-07  27% 1431 aa  IRLA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  261::386     4e-07  32%  548 aa  GRK7_SPETR RecName: Full=G protein-coupled receptor kinase 7;      
  286::391     4e-07  34%  553 aa  GRK7_PIG RecName: Full=G protein-coupled receptor kinase 7;        
  111::316     4e-07  28% 1311 aa  GAK_HUMAN RecName: Full=Cyclin G-associated kinase;       
  726::923     4e-07  27% 1254 aa  ERBB2_MESAU RecName: Full=Receptor tyrosine-protein kinase erbB-2; 
  634::895     4e-07  25%  998 aa  EPHB3_HUMAN RecName: Full=Ephrin type-B receptor 3;       
  621::880     4e-07  24%  985 aa  EPA4B_XENLA RecName: Full=Ephrin type-A receptor 4-B;       
  382::533     4e-07  29%  551 aa  E2AK2_HUMAN RecName: Full=Interferon-induced, double-stranded
    5::200     4e-07  22%  476 aa  CHK1_MOUSE RecName: Full=Serine/threonine-protein kinase Chk1;     
   10::196     4e-07  27%  329 aa  CDK7_RAT RecName: Full=Cell division protein kinase 7;       
   18::204     4e-07  27%  346 aa  CDK7_MOUSE RecName: Full=Cell division protein kinase 7;       
   18::204     4e-07  27%  346 aa  CDK7_HUMAN RecName: Full=Cell division protein kinase 7;       
   26::160     4e-07  31%  351 aa  CDC72_ENCCU RecName: Full=Probable cell division control protein 7
   26::160     4e-07  31%  351 aa  CDC71_ENCCU RecName: Full=Probable cell division control protein 7
   34::246     4e-07  29%  473 aa  BUR1_GIBZE RecName: Full=Serine/threonine-protein kinase BUR1;     
  745::982     6e-07  27% 1122 aa  VAB1_CAEEL RecName: Full=Ephrin receptor 1;       
   41::243     6e-07  28%  426 aa  SSN3_NEOFI RecName: Full=Serine/threonine-protein kinase ssn3;     
   41::243     6e-07  28%  426 aa  SSN3_ASPFU RecName: Full=Serine/threonine-protein kinase ssn3;     
   43::172     6e-07  30%  362 aa  SG110_MOUSE RecName: Full=Putative uncharacterized
  263::511     6e-07  24%  646 aa  SCK2_SCHPO RecName: Full=Serine/threonine-protein kinase sck2;     
  221::388     6e-07  26%  553 aa  SAMKD_DICDI RecName: Full=Probable inactive
    8::246     6e-07  33%  340 aa  PDK1L_PONAB RecName: Full=Serine/threonine-protein kinase PDIK1L;  
   99::346     6e-07  26%  469 aa  ORB6_SCHPO RecName: Full=Serine/threonine-protein kinase orb6;     
  135::229     6e-07  38%  567 aa  MPK16_ARATH RecName: Full=Mitogen-activated protein kinase 16;     
  123::217     6e-07  38%  498 aa  MPK15_ORYSJ RecName: Full=Mitogen-activated protein kinase 15;     
   55::301     6e-07  31%  465 aa  MKNK1_HUMAN RecName: Full=MAP kinase-interacting
  240::477     6e-07  26%  507 aa  MATK_HUMAN RecName: Full=Megakaryocyte-associated tyrosine-protein
    9::205     6e-07  30%  474 aa  KSP1_SCHPO RecName: Full=Serine/threonine-protein kinase ksp1;     
  177::385     6e-07  25%  590 aa  GRK5_RAT RecName: Full=G protein-coupled receptor kinase 5;        
  177::385     6e-07  25%  590 aa  GRK5_MOUSE RecName: Full=G protein-coupled receptor kinase 5;      
  177::385     6e-07  25%  590 aa  GRK5_HUMAN RecName: Full=G protein-coupled receptor kinase 5;      
  478::745     6e-07  29%  806 aa  FGFR3_HUMAN RecName: Full=Fibroblast growth factor receptor 3;     
  487::760     6e-07  26%  821 aa  FGFR2_MOUSE RecName: Full=Fibroblast growth factor receptor 2;     
  487::760     6e-07  26%  821 aa  FGFR2_HUMAN RecName: Full=Fibroblast growth factor receptor 2;     
  540::736     6e-07  26%  895 aa  FERON_ARATH RecName: Full=Receptor-like protein kinase FERONIA;    
  677::935     6e-07  23% 1037 aa  EPHA5_HUMAN RecName: Full=Ephrin type-A receptor 5;       
  418::590     6e-07  36%  619 aa  E2AK1_MOUSE RecName: Full=Eukaryotic translation initiation factor
  311::392     6e-07  40%  514 aa  AVR2A_XENLA RecName: Full=Activin receptor type-2A;       
  179::442     7e-07  22%  918 aa  YTYK2_DICDI RecName: Full=Probable tyrosine-protein kinase
  205::404     7e-07  31% 1458 aa  YAKA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   82::326     7e-07  25%  352 aa  Y6398_DICDI RecName: Full=Probable serine/threonine-protein kinase
  750::902     7e-07  24% 1350 aa  Y1558_DICDI RecName: Full=Probable serine/threonine-protein kinase
  205::385     7e-07  33%  501 aa  TGFR1_RAT RecName: Full=TGF-beta receptor type-1;       
  207::387     7e-07  33%  503 aa  TGFR1_PIG RecName: Full=TGF-beta receptor type-1;       
  207::387     7e-07  33%  503 aa  TGFR1_MOUSE RecName: Full=TGF-beta receptor type-1;       
  207::387     7e-07  33%  503 aa  TGFR1_HUMAN RecName: Full=TGF-beta receptor type-1;       
  203::383     7e-07  33%  499 aa  TGFR1_BOVIN RecName: Full=TGF-beta receptor type-1;       
   95::346     7e-07  24%  465 aa  STK38_MOUSE RecName: Full=Serine/threonine-protein kinase 38;      
  106::308     7e-07  27%  512 aa  SSN3_CHAGB RecName: Full=Serine/threonine-protein kinase SSN3;     
  824::1067    7e-07  22% 1070 aa  PTK7_HUMAN RecName: Full=Tyrosine-protein kinase-like 7;AltName:
  375::459     7e-07  38%  657 aa  NLK_CAEBR RecName: Full=Serine/threonine kinase NLK;       
  215::309     7e-07  37%  582 aa  MPK17_ORYSJ RecName: Full=Mitogen-activated protein kinase 17;     
  123::217     7e-07  37%  542 aa  MPK14_ORYSJ RecName: Full=Mitogen-activated protein kinase 14;     
   70::268     7e-07  30%  347 aa  MP2K3_HUMAN RecName: Full=Dual specificity mitogen-activated
    4::210     7e-07  25%  622 aa  MAK_MOUSE RecName: Full=Serine/threonine-protein kinase MAK;       
  709::985     7e-07  27% 1130 aa  LATS1_HUMAN RecName: Full=Serine/threonine-protein kinase LATS1;   
  128::309     7e-07  28%  437 aa  KIN31_CAEEL RecName: Full=Probable tyrosine-protein kinase kin-31; 
 1377::1651    7e-07  25% 2144 aa  INSR_DROME RecName: Full=Insulin-like receptor;         Short=dInr;  
  190::401     7e-07  29% 1211 aa  HIPK1_RAT RecName: Full=Homeodomain-interacting protein kinase 1;  
  190::401     7e-07  29% 1210 aa  HIPK1_MOUSE RecName: Full=Homeodomain-interacting protein kinase 1;
  190::401     7e-07  29% 1210 aa  HIPK1_HUMAN RecName: Full=Homeodomain-interacting protein kinase 1;
  177::385     7e-07  25%  574 aa  GRK4_MOUSE RecName: Full=G protein-coupled receptor kinase 4;      
  472::746     7e-07  27%  801 aa  FGFR3_MOUSE RecName: Full=Fibroblast growth factor receptor 3;     
  505::751     7e-07  26%  812 aa  FGFR1_XENLA RecName: Full=Fibroblast growth factor receptor 1;     
  566::747     7e-07  25%  822 aa  FES_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase
  188::393     7e-07  27%  500 aa  EPHB3_DANRE RecName: Full=Ephrin type-B receptor 3;       
  623::884     7e-07  25%  987 aa  EPHB2_COTJA RecName: Full=Ephrin type-B receptor 2;       
  621::880     7e-07  23%  986 aa  EPA4A_XENLA RecName: Full=Ephrin type-A receptor 4-A;       
  415::588     7e-07  33%  626 aa  E2AK1_RABIT RecName: Full=Eukaryotic translation initiation factor
  275::359     7e-07  39%  750 aa  DYR1A_XENLA RecName: Full=Dual specificity
  200::374     7e-07  31%  513 aa  AVR2A_MOUSE RecName: Full=Activin receptor type-2A;       
  200::374     7e-07  31%  513 aa  AVR2A_HUMAN RecName: Full=Activin receptor type-2A;       
  200::374     7e-07  31%  513 aa  AVR2A_BOVIN RecName: Full=Activin receptor type-2A;       
   21::183     1e-06  29%  374 aa  YOO3_CAEEL RecName: Full=Putative serine/threonine-protein kinase
   53::186     1e-06  29%  331 aa  YOO1_CAEEL RecName: Full=Putative serine/threonine-protein kinase
  333::487     1e-06  32%  737 aa  Y9628_DICDI RecName: Full=Probable serine/threonine-protein kinase
  582::786     1e-06  24%  844 aa  Y7566_DICDI RecName: Full=Probable serine/threonine-protein kinase
   40::271     1e-06  28%  601 aa  WNK3_ORYSJ RecName: Full=Probable serine/threonine-protein kinase
   26::228     1e-06  28%  413 aa  SSN3_ASPOR RecName: Full=Serine/threonine-protein kinase SSN3;     
   40::242     1e-06  28%  427 aa  SSN3_ASPNC RecName: Full=Serine/threonine-protein kinase ssn3;     
  234::495     1e-06  24%  496 aa  SRMS_MOUSE RecName: Full=Tyrosine-protein kinase Srms;       
  471::682     1e-06  23%  775 aa  SRF1_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY
  203::455     1e-06  24%  649 aa  PAR4_CAEBR RecName: Full=Serine/threonine-protein kinase par-4;    
  248::493     1e-06  24%  512 aa  LYN_MOUSE RecName: Full=Tyrosine-protein kinase Lyn;       
  164::292     1e-06  39%  586 aa  KM8S_YEAST RecName: Full=Probable serine/threonine-protein kinase
  306::500     1e-06  25%  620 aa  KD025_YEAST RecName: Full=Probable serine/threonine-protein kinase
  104::215     1e-06  30%  616 aa  HIPK4_MACFA RecName: Full=Homeodomain-interacting protein kinase 4;
  266::391     1e-06  32%  553 aa  GRK7_HUMAN RecName: Full=G protein-coupled receptor kinase 7;      
  177::385     1e-06  23%  575 aa  GRK4_RAT RecName: Full=G protein-coupled receptor kinase 4;        
  490::730     1e-06  27%  796 aa  FGFR3_PLEWA RecName: Full=Fibroblast growth factor receptor 3;     
  569::747     1e-06  21%  822 aa  FER_HUMAN RecName: Full=Proto-oncogene tyrosine-protein kinase FER;
   24::264     1e-06  25%  292 aa  EPA4A_DANRE RecName: Full=Ephrin type-A receptor 4a;       
  905::1130    1e-06  27% 1426 aa  EGFR_DROME RecName: Full=Epidermal growth factor receptor;       
    5::200     1e-06  22%  476 aa  CHK1_HUMAN RecName: Full=Serine/threonine-protein kinase Chk1;     
   82::339     1e-06  29%  478 aa  CDK9_CAEEL RecName: Full=Probable cell division protein kinase 9;  
  729::934     1e-06  25% 1484 aa  CD2L7_RAT RecName: Full=Cell division cycle 2-related protein
  729::934     1e-06  25% 1484 aa  CD2L7_MOUSE RecName: Full=Cell division cycle 2-related protein
  310::374     1e-06  43%  513 aa  AVR2A_CHICK RecName: Full=Activin receptor type-2A;       
   25::221     1e-06  25%  571 aa  WNK4_ARATH RecName: Full=Probable serine/threonine-protein kinase
  816::1051    1e-06  23% 1062 aa  PTK7_MOUSE RecName: Full=Tyrosine-protein kinase-like 7;Flags:
   25::203     1e-06  26%  338 aa  PPK33_SCHPO RecName: Full=Serine/threonine-protein kinase ppk33;   
  548::917     1e-06  29% 1316 aa  PPK18_SCHPO RecName: Full=Serine/threonine-protein kinase ppk18;   
  159::372     1e-06  29%  908 aa  MNB_DROME RecName: Full=Serine/threonine-protein kinase minibrain; 
  102::301     1e-06  30%  431 aa  KSG2_ARATH RecName: Full=Shaggy-related protein kinase beta;       
  192::278     1e-06  39%  393 aa  KR1_VZVD RecName: Full=Serine/threonine-protein kinase ORF66;      
  228::379     1e-06  27%  481 aa  KR1_HHV11 RecName: Full=Serine/threonine-protein kinase;       
    8::192     1e-06  25%  318 aa  KC12_ENCCU RecName: Full=Probable casein kinase I homolog
   69::275     1e-06  26%  538 aa  KC11_YEAST RecName: Full=Casein kinase I homolog 1;       
  969::1247    1e-06  23% 1300 aa  INSRR_MOUSE RecName: Full=Insulin receptor-related protein;       
  295::410     1e-06  33% 1196 aa  HIPK2_MOUSE RecName: Full=Homeodomain-interacting protein kinase 2;
  295::410     1e-06  33% 1168 aa  HIPK2_MESAU RecName: Full=Homeodomain-interacting protein kinase 2;
  295::410     1e-06  33% 1198 aa  HIPK2_HUMAN RecName: Full=Homeodomain-interacting protein kinase 2;
  307::391     1e-06  34%  552 aa  GRK7_BOVIN RecName: Full=G protein-coupled receptor kinase 7;      
  767::976     1e-06  29% 1659 aa  GCN2_YEAST RecName: Full=Serine/threonine-protein kinase GCN2;     
  629::890     1e-06  25%  993 aa  EPHB3_MOUSE RecName: Full=Ephrin type-B receptor 3;       
  275::359     1e-06  39%  751 aa  DYR1A_XENTR RecName: Full=Dual specificity
  739::897     1e-06  25%  969 aa  DUSTY_APIME RecName: Full=Dual serine/threonine and tyrosine
  711::916     1e-06  24% 1511 aa  CD2L5_MOUSE RecName: Full=Cell division cycle 2-like protein kinase
  711::916     1e-06  24% 1512 aa  CD2L5_HUMAN RecName: Full=Cell division cycle 2-like protein kinase
  200::374     1e-06  31%  513 aa  AVR2A_RAT RecName: Full=Activin receptor type-2A;       
  191::436     1e-06  23%  688 aa  ARBK2_MOUSE RecName: Full=Beta-adrenergic receptor kinase 2;       
  191::436     1e-06  23%  689 aa  ARBK1_MESAU RecName: Full=Beta-adrenergic receptor kinase 1;       
  214::464     1e-06  28%  509 aa  ACVR1_RAT RecName: Full=Activin receptor type-1;       
  214::464     1e-06  28%  509 aa  ACVR1_MOUSE RecName: Full=Activin receptor type-1;       
  488::694     1e-06  25%  814 aa  ACCR3_ARATH RecName: Full=Putative serine/threonine-protein
  490::694     2e-06  25%  768 aa  SUB_ARATH RecName: Full=Protein STRUBBELIG;AltName:
  104::244     2e-06  29%  635 aa  PYK4_DICDI RecName: Full=Dual specificity protein kinase pyk4;     
   12::228     2e-06  25%  485 aa  NEK1_DICDI RecName: Full=Probable serine/threonine-protein kinase
  214::308     2e-06  37%  589 aa  MPK8_ARATH RecName: Full=Mitogen-activated protein kinase 8;       
  200::294     2e-06  37%  576 aa  MPK15_ARATH RecName: Full=Mitogen-activated protein kinase 15;     
   86::284     2e-06  30%  361 aa  MP2K6_DANRE RecName: Full=Dual specificity mitogen-activated
   70::268     2e-06  29%  347 aa  MP2K3_MOUSE RecName: Full=Dual specificity mitogen-activated
    4::191     2e-06  25%  623 aa  MAK_HUMAN RecName: Full=Serine/threonine-protein kinase MAK;       
  672::932     2e-06  26% 1088 aa  LATS2_HUMAN RecName: Full=Serine/threonine-protein kinase LATS2;   
  708::949     2e-06  28% 1129 aa  LATS1_MOUSE RecName: Full=Serine/threonine-protein kinase LATS1;   
   63::268     2e-06  30%  405 aa  KSG1_ARATH RecName: Full=Shaggy-related protein kinase alpha;      
 1027::1287    2e-06  23% 1382 aa  INSR_HUMAN RecName: Full=Insulin receptor;         Short=IR;       
  141::231     2e-06  36%  387 aa  GSK3_SCHPO RecName: Full=Protein kinase gsk3;       
   18::235     2e-06  29%  359 aa  GSK3_CAEBR RecName: Full=Glycogen synthase kinase-3;       
  111::316     2e-06  28% 1305 aa  GAK_RAT RecName: Full=Cyclin G-associated kinase;       
   18::203     2e-06  30%  344 aa  CDK7_CARAU RecName: Full=Cell division protein kinase 7;       
  528::725     2e-06  23%  786 aa  BTKL_DROME RecName: Full=Tyrosine-protein kinase Btk29A;       
  197::372     2e-06  30%  511 aa  AVR2B_XENLA RecName: Full=Activin receptor type-2B;       
 6730::6805    2e-06  33% 8081 aa  UNC89_CAEEL RecName: Full=Muscle M-line assembly protein
  518::721     2e-06  25%  836 aa  PPK5_SCHPO RecName: Full=Serine/threonine-protein kinase ppk5;     
  132::226     2e-06  37%  501 aa  MPK16_ORYSJ RecName: Full=Mitogen-activated protein kinase 16;     
  630::897     2e-06  26% 1042 aa  LATS2_MOUSE RecName: Full=Serine/threonine-protein kinase LATS2;   
    7::213     2e-06  26%  324 aa  KC1_TOXGO RecName: Full=Casein kinase I;         EC=2.7.11.1;
   15::221     2e-06  29%  336 aa  KC1B_BOVIN RecName: Full=Casein kinase I isoform beta;       
   76::282     2e-06  28%  546 aa  KC12_YEAST RecName: Full=Casein kinase I homolog 2;       
  748::932     2e-06  25% 1035 aa  EPHA6_RAT RecName: Full=Ephrin type-A receptor 6;       
  620::875     2e-06  23%  977 aa  EPHA2_MOUSE RecName: Full=Ephrin type-A receptor 2;       
  663::924     2e-06  26%  953 aa  DUSTY_STRPU RecName: Full=Dual serine/threonine and tyrosine
  132::390     2e-06  26%  507 aa  CBK1_PNECA RecName: Full=Serine/threonine-protein kinase CBK1;     
  191::436     2e-06  23%  689 aa  ARBK1_RAT RecName: Full=Beta-adrenergic receptor kinase 1;       
  191::436     2e-06  23%  689 aa  ARBK1_MOUSE RecName: Full=Beta-adrenergic receptor kinase 1;       
  191::436     2e-06  23%  689 aa  ARBK1_HUMAN RecName: Full=Beta-adrenergic receptor kinase 1;       
  191::436     2e-06  23%  689 aa  ARBK1_BOVIN RecName: Full=Beta-adrenergic receptor kinase 1;       
  214::464     2e-06  28%  509 aa  ACVR1_HUMAN RecName: Full=Activin receptor type-1;       
  214::464     2e-06  28%  509 aa  ACVR1_BOVIN RecName: Full=Activin receptor type-1;       
   15::284     3e-06  23%  450 aa  YR517_MIMIV RecName: Full=Putative serine/threonine-protein kinase
  181::325     3e-06  28%  443 aa  STK40_XENLA RecName: Full=Serine/threonine-protein kinase 40;      
   24::210     3e-06  28%  539 aa  RIPK2_MOUSE RecName: Full=Receptor-interacting
  518::833     3e-06  27% 1032 aa  PPK31_SCHPO RecName: Full=Serine/threonine-protein kinase ppk31;   
  802::967     3e-06  26% 1087 aa  PGFRA_XENLA RecName: Full=Alpha-type platelet-derived growth factor
  126::220     3e-06  34%  486 aa  MPK17_ARATH RecName: Full=Mitogen-activated protein kinase 17;     
  252::409     3e-06  31%  446 aa  MP2K2_XENLA RecName: Full=Dual specificity mitogen-activated
    8::195     3e-06  34%  200 aa  MOS_NYCNY RecName: Full=Serine/threonine-protein kinase mos;       
   67::272     3e-06  30%  409 aa  KSG3_ARATH RecName: Full=Shaggy-related protein kinase gamma;      
  148::311     3e-06  27%  390 aa  KR1_SUHVN RecName: Full=Serine/threonine-protein kinase;       
 1093::1241    3e-06  27% 1444 aa  IRLC_DICDI RecName: Full=Probable serine/threonine-protein kinase
  125::318     3e-06  30%  490 aa  GSK3A_MOUSE RecName: Full=Glycogen synthase kinase-3 alpha;        
  191::392     3e-06  25%  707 aa  GRK2_CAEEL RecName: Full=G protein-coupled receptor kinase 2;      
  468::735     3e-06  26%  802 aa  FGFR3_XENLA RecName: Full=Fibroblast growth factor receptor 3;     
  624::885     3e-06  24%  988 aa  EPHB3_CHICK RecName: Full=Ephrin type-B receptor 3;       
  622::881     3e-06  23%  986 aa  EPHA4_MOUSE RecName: Full=Ephrin type-A receptor 4;       
  622::881     3e-06  23%  986 aa  EPHA4_HUMAN RecName: Full=Ephrin type-A receptor 4;       
  622::881     3e-06  23%  986 aa  EPHA4_CHICK RecName: Full=Ephrin type-A receptor 4;       
    1::181     3e-06  29%  580 aa  BUR1_ASPFU RecName: Full=Serine/threonine-protein kinase bur1;     
  238::416     3e-06  31%  532 aa  BMR1A_HUMAN RecName: Full=Bone morphogenetic protein receptor
  191::391     3e-06  24%  689 aa  ARBK1_DIDMA RecName: Full=Beta-adrenergic receptor kinase 1;       
   60::333     4e-06  25%  798 aa  Y6461_DICDI RecName: Full=Probable serine/threonine-protein kinase
 1077::1228    4e-06  28% 1936 aa  Y0124_DICDI RecName: Full=Probable inactive serine/threonine-protein
  303::570     4e-06  27%  646 aa  WEE1_MOUSE RecName: Full=Wee1-like protein kinase;       
  245::367     4e-06  29%  609 aa  WEE1_DROME RecName: Full=Wee1-like protein kinase;       
  894::1084    4e-06  28% 1180 aa  TYK2_MOUSE RecName: Full=Non-receptor tyrosine-protein kinase TYK2;  
  190::439     4e-06  30%  566 aa  PPK14_SCHPO RecName: Full=Serine/threonine-protein kinase ppk14;   
   40::212     4e-06  28%  323 aa  PIM3_XENLA RecName: Full=Serine/threonine-protein kinase Pim-3;    
  495::776     4e-06  24%  778 aa  NTRK1_CHICK RecName: Full=High affinity nerve growth factor
  579::820     4e-06  27%  869 aa  MUSK_HUMAN RecName: Full=Muscle, skeletal receptor tyrosine protein
   68::273     4e-06  30%  411 aa  MSK3_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-3; 
   69::274     4e-06  29%  411 aa  MSK1_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-1; 
  139::314     4e-06  25%  715 aa  MRKB_DICDI RecName: Full=Probable serine/threonine-protein kinase
  774::924     4e-06  23%  975 aa  KIT_MOUSE RecName: Full=Mast/stem cell growth factor receptor;     
   62::253     4e-06  29%  467 aa  GSK3_DICDI RecName: Full=Glycogen synthase kinase-3;       
  202::401     4e-06  22%  640 aa  GRK1_CAEBR RecName: Full=G protein-coupled receptor kinase 1;      
  111::316     4e-06  28% 1305 aa  GAK_MOUSE RecName: Full=Cyclin G-associated kinase;       
  132::396     4e-06  24%  634 aa  ERBB_ALV RecName: Full=Tyrosine-protein kinase transforming protein
  724::921     4e-06  25% 1308 aa  ERBB4_RAT RecName: Full=Receptor tyrosine-protein kinase erbB-4;   
  724::921     4e-06  24% 1292 aa  ERBB4_MOUSE RecName: Full=Receptor tyrosine-protein kinase erbB-4; 
  627::886     4e-06  22%  981 aa  EPHA3_DANRE RecName: Full=Ephrin type-A receptor 3;       
  619::874     4e-06  23%  976 aa  EPHA2_HUMAN RecName: Full=Ephrin type-A receptor 2;       
  496::707     4e-06  26%  901 aa  CRI4_MAIZE RecName: Full=Putative receptor protein kinase CRINKLY4;
  238::416     4e-06  31%  532 aa  BMR1A_MOUSE RecName: Full=Bone morphogenetic protein receptor
  209::459     4e-06  27%  504 aa  ACVR1_CHICK RecName: Full=Activin receptor type-1;       
  901::1091    5e-06  27% 1187 aa  TYK2_HUMAN RecName: Full=Non-receptor tyrosine-protein kinase TYK2;  
  181::325     5e-06  27%  436 aa  STK40_BOVIN RecName: Full=Serine/threonine-protein kinase 40;      
   43::171     5e-06  31%  359 aa  SG110_HUMAN RecName: Full=Putative uncharacterized
  801::952     5e-06  24% 1088 aa  PGFRA_RAT RecName: Full=Alpha-type platelet-derived growth factor
  492::784     5e-06  26%  796 aa  NTRK1_HUMAN RecName: Full=High affinity nerve growth factor
 1550::1909    5e-06  25% 2112 aa  NDRD_DICDI RecName: Full=Probable serine/threonine-protein kinase
  578::819     5e-06  27%  868 aa  MUSK_MOUSE RecName: Full=Muscle, skeletal receptor tyrosine protein
  225::372     5e-06  26%  481 aa  KR1_HHV2H RecName: Full=Serine/threonine-protein kinase;       
  760::910     5e-06  24%  954 aa  KIT_XENLA RecName: Full=Mast/stem cell growth factor
  119::213     5e-06  34%  323 aa  KC1_PLAYO RecName: Full=Casein kinase I;         EC=2.7.11.1;
  119::213     5e-06  34%  323 aa  KC1_PLAF7 RecName: Full=Casein kinase I;         EC=2.7.11.1;
  119::213     5e-06  34%  324 aa  KC1_PLAF4 RecName: Full=Casein kinase I;         EC=2.7.11.1;
 1171::1319    5e-06  27% 1505 aa  IRLD_DICDI RecName: Full=Probable serine/threonine-protein kinase
  104::215     5e-06  29%  616 aa  HIPK4_HUMAN RecName: Full=Homeodomain-interacting protein kinase 4;
  555::767     5e-06  25%  854 aa  FGFR1_DUGJA RecName: Full=Fibroblast growth factor receptor 1;     
  132::396     5e-06  24%  540 aa  ERBB_AVIEU RecName: Full=Tyrosine-protein kinase transforming
  132::396     5e-06  23%  604 aa  ERBB_AVIER RecName: Full=Tyrosine-protein kinase transforming
  748::932     5e-06  25% 1035 aa  EPHA6_MOUSE RecName: Full=Ephrin type-A receptor 6;       
    4::139     5e-06  30%  474 aa  CDC2H_CRIFA RecName: Full=Cell division control protein 2 homolog; 
   19::213     5e-06  29%  312 aa  CDC2D_ANTMA RecName: Full=Cell division control protein 2 homolog
  238::416     5e-06  31%  532 aa  BMR1A_RAT RecName: Full=Bone morphogenetic protein receptor
  450::643     6e-06  26%  819 aa  SWE1_YEAST RecName: Full=Mitosis inhibitor protein kinase SWE1;    
  181::325     6e-06  28%  435 aa  STK40_RAT RecName: Full=Serine/threonine-protein kinase 40;        
  181::325     6e-06  28%  435 aa  STK40_MOUSE RecName: Full=Serine/threonine-protein kinase 40;      
  181::325     6e-06  28%  435 aa  STK40_HUMAN RecName: Full=Serine/threonine-protein kinase 40;      
  181::323     6e-06  29%  435 aa  STK40_CHICK RecName: Full=Serine/threonine-protein kinase 40;      
   96::360     6e-06  23%  464 aa  ST38L_MOUSE RecName: Full=Serine/threonine-protein kinase 38-like; 
   95::231     6e-06  28%  502 aa  SKS1_YEAST RecName: Full=Serine/threonine-protein kinase SKS1;     
  606::689     6e-06  32%  811 aa  PRP4B_DICDI RecName: Full=Serine/threonine-protein kinase prpf4B;  
   12::253     6e-06  19%  946 aa  PLK4_XENTR RecName: Full=Serine/threonine-protein kinase PLK4;     
  802::953     6e-06  24% 1089 aa  PGFRA_MOUSE RecName: Full=Alpha-type platelet-derived growth factor
  578::819     6e-06  27%  868 aa  MUSK_RAT RecName: Full=Muscle, skeletal receptor tyrosine protein
  148::233     6e-06  37%  345 aa  KR1_CHV9D RecName: Full=Serine/threonine-protein kinase;       
  772::922     6e-06  23%  972 aa  KIT_PIG RecName: Full=Mast/stem cell growth factor receptor;       
  776::926     6e-06  23%  976 aa  KIT_HUMAN RecName: Full=Mast/stem cell growth factor receptor;     
  214::364     6e-06  23%  370 aa  KIT_FSVHZ RecName: Full=Tyrosine-protein kinase transforming
  777::927     6e-06  23%  978 aa  KIT_FELCA RecName: Full=Mast/stem cell growth factor receptor;     
  778::928     6e-06  23%  978 aa  KIT_CAPHI RecName: Full=Mast/stem cell growth factor receptor;     
  779::929     6e-06  23%  979 aa  KIT_CANFA RecName: Full=Mast/stem cell growth factor receptor;     
  772::922     6e-06  23%  972 aa  KIT_CALJA RecName: Full=Mast/stem cell growth factor receptor;     
  777::927     6e-06  23%  977 aa  KIT_BOVIN RecName: Full=Mast/stem cell growth factor receptor;     
  761::911     6e-06  24%  976 aa  KITA_DANRE RecName: Full=Mast/stem cell growth factor receptor;    
  421::700     6e-06  31% 1241 aa  GCN2_ARATH RecName: Full=Probable serine/threonine-protein kinase
  684::865     6e-06  28%  922 aa  FGFR4_DANRE RecName: Full=Fibroblast growth factor receptor 4;     
  748::932     6e-06  25% 1035 aa  EPHA6_HUMAN RecName: Full=Ephrin type-A receptor 6;       
  412::532     6e-06  29%  884 aa  CBK1_EMENI RecName: Full=Serine/threonine-protein kinase cbk1;     
  208::433     6e-06  29%  503 aa  ACVL1_PONAB RecName: Full=Serine/threonine-protein kinase receptor
  208::433     6e-06  29%  503 aa  ACVL1_HUMAN RecName: Full=Serine/threonine-protein kinase receptor
 2228::2499    6e-06  26% 2594 aa  7LESS_DROVI RecName: Full=Protein sevenless;         EC=2.7.10.1;
 1006::1157    8e-06  28% 1338 aa  VGFR1_HUMAN RecName: Full=Vascular endothelial growth factor receptor
   94::262     8e-06  24%  488 aa  ST32C_MOUSE RecName: Full=Serine/threonine-protein kinase 32C;     
  419::620     8e-06  23%  717 aa  SRF7_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY
  191::440     8e-06  21%  451 aa  PTK6_HUMAN RecName: Full=Tyrosine-protein kinase 6;       
   12::253     8e-06  19%  944 aa  PLK4_XENLA RecName: Full=Serine/threonine-protein kinase PLK4;     
  802::953     8e-06  24% 1089 aa  PGFRA_HUMAN RecName: Full=Alpha-type platelet-derived growth factor
  106::305     8e-06  30%  397 aa  MP2K4_MOUSE RecName: Full=Dual specificity mitogen-activated
  108::307     8e-06  30%  399 aa  MP2K4_HUMAN RecName: Full=Dual specificity mitogen-activated
   68::273     8e-06  29%  410 aa  KSG5_ARATH RecName: Full=Shaggy-related protein kinase epsilon;    
  305::418     8e-06  30%  518 aa  KKL6_YEAST RecName: Full=Probable serine/threonine-protein kinase
  847::1123    8e-06  23% 1129 aa  JAK2_CHICK RecName: Full=Tyrosine-protein kinase JAK2;       
  969::1238    8e-06  23% 1297 aa  INSRR_HUMAN RecName: Full=Insulin receptor-related protein;       
   18::235     8e-06  28%  362 aa  GSK3_CAEEL RecName: Full=Glycogen synthase kinase-3;       
   47::255     8e-06  28%  420 aa  GSK3B_MOUSE RecName: Full=Glycogen synthase kinase-3 beta;       
   47::255     8e-06  28%  420 aa  GSK3B_HUMAN RecName: Full=Glycogen synthase kinase-3 beta;       
  498::738     8e-06  26%  810 aa  FGR1A_DANRE RecName: Full=Basic fibroblast growth factor receptor
  724::921     8e-06  25% 1308 aa  ERBB4_HUMAN RecName: Full=Receptor tyrosine-protein kinase erbB-4; 
   31::239     8e-06  28%  513 aa  CDKC2_ARATH RecName: Full=Cyclin-dependent kinase C-2;       
  135::203     1e-05  31%  328 aa  YX05_CAEEL RecName: Full=Putative tyrosine-protein kinase C03B1.5; 
   68::280     1e-05  22%  363 aa  YKL2_CAEEL RecName: Full=Putative casein kinase I C03C10.2;        
  418::582     1e-05  26%  663 aa  Y3301_DICDI RecName: Full=Probable serine/threonine-protein kinase
   21::167     1e-05  29% 1243 aa  TTBK2_MOUSE RecName: Full=Tau-tubulin kinase 2;
   93::261     1e-05  24%  486 aa  ST32C_HUMAN RecName: Full=Serine/threonine-protein kinase 32C;     
 1696::1787    1e-05  31% 1867 aa  ROCO8_DICDI RecName: Full=Probable serine/threonine-protein kinase
  239::434     1e-05  25%  513 aa  PPK8_SCHPO RecName: Full=Serine/threonine-protein kinase ppk8;     
  807::973     1e-05  26% 1367 aa  PKGA_DICDI RecName: Full=Probable serine/threonine-protein kinase
   40::214     1e-05  29%  323 aa  PIM3_COTJA RecName: Full=Serine/threonine-protein kinase Pim-3;    
  783::904     1e-05  29% 1106 aa  PGFRB_HUMAN RecName: Full=Beta-type platelet-derived growth factor
  783::904     1e-05  28% 1103 aa  PGFRB_CANFA RecName: Full=Beta-type platelet-derived growth factor
   68::285     1e-05  28%  411 aa  MSK2_MEDSA RecName: Full=Glycogen synthase kinase-3 homolog MsK-2; 
   39::225     1e-05  29%  375 aa  MCK1_YEAST RecName: Full=Protein kinase MCK1;       
  465::581     1e-05  34%  942 aa  M3K14_MOUSE RecName: Full=Mitogen-activated protein kinase kinase
  761::911     1e-05  23%  960 aa  KIT_CHICK RecName: Full=Mast/stem cell growth factor receptor;     
  454::676     1e-05  23% 1009 aa  FAK2_MOUSE RecName: Full=Protein tyrosine kinase 2 beta;       
  220::418     1e-05  27%  599 aa  DYRK2_MOUSE RecName: Full=Dual specificity
   24::228     1e-05  25%  503 aa  CHK1_CAEEL RecName: Full=Serine/threonine-protein kinase chk-1;    
  198::373     1e-05  30%  512 aa  AVR2B_CHICK RecName: Full=Activin receptor type-2B;       
  209::434     1e-05  29%  504 aa  ACVL1_RAT RecName: Full=Serine/threonine-protein kinase receptor
  503::714     1e-05  28%  895 aa  ACR4_ARATH RecName: Full=Serine/threonine-protein kinase-like
  287::484     1e-05  27%  567 aa  WEE2_HUMAN RecName: Full=Wee1-like protein kinase 2;       
 1006::1157    1e-05  28% 1336 aa  VGFR1_RAT RecName: Full=Vascular endothelial growth factor receptor
 1006::1157    1e-05  28% 1333 aa  VGFR1_MOUSE RecName: Full=Vascular endothelial growth factor receptor
   21::167     1e-05  29% 1244 aa  TTBK2_HUMAN RecName: Full=Tau-tubulin kinase 2;       
  607::799     1e-05  28% 1067 aa  SGG_DROME RecName: Full=Protein kinase shaggy;       
   94::286     1e-05  27%  786 aa  RIPK4_MOUSE RecName: Full=Receptor-interacting
   60::259     1e-05  28%  671 aa  RIPK1_HUMAN RecName: Full=Receptor-interacting
  782::903     1e-05  28% 1097 aa  PGFRB_RAT RecName: Full=Beta-type platelet-derived growth factor
  693::862     1e-05  22%  994 aa  MERTK_RAT RecName: Full=Proto-oncogene tyrosine-protein kinase MER;
    7::213     1e-05  28%  335 aa  KC1_EIMTE RecName: Full=Casein kinase I;         EC=2.7.11.1;
  322::525     1e-05  27%  603 aa  HAL4_YEAST RecName: Full=Serine/threonine-protein kinase HAL4/SAT4;
   47::255     1e-05  27%  420 aa  GSK3B_SPECI RecName: Full=Glycogen synthase kinase-3 beta;       
   47::255     1e-05  28%  420 aa  GSK3B_RAT RecName: Full=Glycogen synthase kinase-3 beta;       
  125::318     1e-05  29%  483 aa  GSK3A_RAT RecName: Full=Glycogen synthase kinase-3 alpha;       
  454::676     1e-05  23% 1009 aa  FAK2_RAT RecName: Full=Protein tyrosine kinase 2 beta;       
  619::874     1e-05  22%  976 aa  EPHA2_MACFA RecName: Full=Ephrin type-A receptor 2;       
  276::473     1e-05  26%  828 aa  DYRK3_DROME RecName: Full=Putative dual specificity
  147::345     1e-05  27%  526 aa  DYRK2_CHICK RecName: Full=Dual specificity
  731::820     1e-05  27%  903 aa  DUSTY_PIMPR RecName: Full=Dual serine/threonine and tyrosine
  651::846     1e-05  25%  930 aa  DUSTY_CHICK RecName: Full=Dual serine/threonine and tyrosine
   18::242     1e-05  29%  326 aa  CKB21_ORYSJ RecName: Full=Cyclin-dependent kinase B2-1;       
    4::212     1e-05  32%  311 aa  CKB12_ARATH RecName: Full=Cyclin-dependent kinase B1-2;       
  147::217     1e-05  42%  368 aa  CAK1_YEAST RecName: Full=Serine/threonine-protein kinase CAK1;     
   57::183     1e-05  26%  260 aa  BUD32_DEBHA RecName: Full=Serine/threonine-protein kinase BUD32;   
  561::708     1e-05  26%  850 aa  ANX1_ARATH RecName: Full=Receptor-like protein kinase ANXUR1;      
  207::432     1e-05  29%  502 aa  ACVL1_MOUSE RecName: Full=Serine/threonine-protein kinase receptor
  343::539     2e-05  25%  618 aa  ZAP70_MOUSE RecName: Full=Tyrosine-protein kinase ZAP-70;       
  344::540     2e-05  25%  619 aa  ZAP70_HUMAN RecName: Full=Tyrosine-protein kinase ZAP-70;       
   39::307     2e-05  23%  865 aa  YP141_YEAST RecName: Full=Putative serine/threonine-protein kinase
  532::721     2e-05  27%  842 aa  Y5613_ARATH RecName: Full=Probable receptor-like protein kinase
  527::700     2e-05  26% 1192 aa  Y0038_DICDI RecName: Full=Probable inactive
  157::307     2e-05  26%  472 aa  SSN3_DEBHA RecName: Full=Serine/threonine-protein kinase SSN3;     
  100::302     2e-05  26%  488 aa  SSN3_COCIM RecName: Full=Serine/threonine-protein kinase SSN3;     
  777::917     2e-05  22% 1062 aa  PGFRA_TAKRU RecName: Full=Alpha-type platelet-derived growth factor
   24::161     2e-05  28% 1311 aa  KXCA_DICDI RecName: Full=Kinase and exchange factor for Rac A;     
  892::1084    2e-05  26% 1177 aa  JAK_DROME RecName: Full=Tyrosine-protein kinase hopscotch;       
  412::475     2e-05  31%  534 aa  GCP_METST RecName: Full=Putative O-sialoglycoprotein endopeptidase;
  222::420     2e-05  27%  601 aa  DYRK2_HUMAN RecName: Full=Dual specificity
   91::273     2e-05  24%  476 aa  CIPKU_ORYSJ RecName: Full=CBL-interacting protein kinase 30;       
   17::232     2e-05  27%  464 aa  CDK8_MOUSE RecName: Full=Cell division protein kinase 8;       
  478::568     2e-05  33%  807 aa  YAK1_YEAST RecName: Full=Dual specificity protein kinase YAK1;     
  413::538     2e-05  26%  625 aa  Y5659_ARATH RecName: Full=Probable inactive receptor kinase
  303::570     2e-05  26%  646 aa  WEE1_RAT RecName: Full=Wee1-like protein kinase;       
  506::714     2e-05  25%  794 aa  TRK1_LYMST RecName: Full=Putative neurotrophin receptor LTRK 1;    
  227::377     2e-05  25%  608 aa  SSN3_CANAL RecName: Full=Serine/threonine-protein kinase SSN3;     
  421::621     2e-05  24%  735 aa  SRF2_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY
 1086::1344    2e-05  25% 1400 aa  RON_HUMAN RecName: Full=Macrophage-stimulating protein receptor;     
  114::278     2e-05  30%  656 aa  RIPK1_MOUSE RecName: Full=Receptor-interacting
  133::298     2e-05  28%  310 aa  PIM1_DANRE RecName: Full=Serine/threonine-protein kinase Pim-1;    
  303::495     2e-05  29%  650 aa  OCA2_SCHPO RecName: Full=Serine/threonine-protein kinase oca2;     
  478::638     2e-05  31%  781 aa  KJ45_SCHPO RecName: Full=Probable serine/threonine-protein kinase
  850::1126    2e-05  23% 1132 aa  JAK2_PONAB RecName: Full=Tyrosine-protein kinase JAK2;       
  125::318     2e-05  29%  483 aa  GSK3A_HUMAN RecName: Full=Glycogen synthase kinase-3 alpha;        
   25::217     2e-05  28%  381 aa  GSK31_SCHPO RecName: Full=Protein kinase gsk31;       
  712::923     2e-05  24% 1210 aa  EGFR_HUMAN RecName: Full=Epidermal growth factor receptor;       
  754::843     2e-05  26%  927 aa  DUSTY_RAT RecName: Full=Dual serine/threonine and tyrosine protein
  757::846     2e-05  26%  930 aa  DUSTY_PANTR RecName: Full=Dual serine/threonine and tyrosine
  754::843     2e-05  26%  927 aa  DUSTY_MOUSE RecName: Full=Dual serine/threonine and tyrosine
  734::823     2e-05  26%  907 aa  DUSTY_MACMU RecName: Full=Dual serine/threonine and tyrosine
  756::845     2e-05  26%  929 aa  DUSTY_HUMAN RecName: Full=Dual serine/threonine and tyrosine
  758::847     2e-05  26%  931 aa  DUSTY_CANFA RecName: Full=Dual serine/threonine and tyrosine
  198::373     2e-05  28%  512 aa  AVR2B_BOVIN RecName: Full=Activin receptor type-2B;       
  565::712     2e-05  25%  858 aa  ANX2_ARATH RecName: Full=Receptor-like protein kinase ANXUR2;      
  219::302     3e-05  41%  442 aa  Y9841_DICDI RecName: Full=Probable serine/threonine-protein kinase
  304::571     3e-05  25%  646 aa  WEE1_HUMAN RecName: Full=Wee1-like protein kinase;       
 1021::1213    3e-05  26% 1363 aa  VGFR3_RAT RecName: Full=Vascular endothelial growth factor receptor
 1021::1213    3e-05  26% 1363 aa  VGFR3_MOUSE RecName: Full=Vascular endothelial growth factor receptor
   34::239     3e-05  25% 1308 aa  TTBK1_MOUSE RecName: Full=Tau-tubulin kinase 1;       
   34::239     3e-05  25% 1321 aa  TTBK1_HUMAN RecName: Full=Tau-tubulin kinase 1;       
  414::617     3e-05  22%  719 aa  SRF6_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY
   77::283     3e-05  25%  536 aa  RAG8_KLULA RecName: Full=Casein kinase I homolog RAG8;       
  774::918     3e-05  25% 1059 aa  PGFRA_DANRE RecName: Full=Alpha-type platelet-derived growth factor
  850::1126    3e-05  23% 1131 aa  JAK2_PIG RecName: Full=Tyrosine-protein kinase JAK2;       
  795::941     3e-05  23%  993 aa  FLT3_HUMAN RecName: Full=FL cytokine receptor;       
  454::676     3e-05  23% 1009 aa  FAK2_HUMAN RecName: Full=Protein tyrosine kinase 2 beta;       
  714::917     3e-05  23% 1210 aa  EGFR_MOUSE RecName: Full=Epidermal growth factor receptor;       
  755::844     3e-05  26%  928 aa  DUSTY_BOVIN RecName: Full=Dual serine/threonine and tyrosine
    1::232     3e-05  29%  505 aa  CDKC1_ARATH RecName: Full=Cyclin-dependent kinase C-1;       
  208::386     3e-05  31%  502 aa  BMR1B_CHICK RecName: Full=Bone morphogenetic protein receptor
  198::373     3e-05  28%  512 aa  AVR2B_PIG RecName: Full=Activin receptor type-2B;       
  222::397     3e-05  28%  536 aa  AVR2B_MOUSE RecName: Full=Activin receptor type-2B;       
  198::373     3e-05  28%  512 aa  AVR2B_HUMAN RecName: Full=Activin receptor type-2B;       
  373::621     4e-05  21%  630 aa  TEC_MOUSE RecName: Full=Tyrosine-protein kinase Tec;       
  374::622     4e-05  22%  631 aa  TEC_HUMAN RecName: Full=Tyrosine-protein kinase Tec;       
  181::325     4e-05  27%  435 aa  STK40_PONAB RecName: Full=Serine/threonine-protein kinase 40;      
   94::244     4e-05  25%  431 aa  SSN3_PICST RecName: Full=Serine/threonine-protein kinase SSN3;     
  158::320     4e-05  22%  442 aa  RYK_AVIR3 RecName: Full=Tyrosine-protein kinase transforming
 1876::2034    4e-05  23% 2615 aa  ROCO7_DICDI RecName: Full=Probable serine/threonine-protein kinase
  128::297     4e-05  25%  326 aa  PIM3_HUMAN RecName: Full=Serine/threonine-protein kinase Pim-3;    
  371::567     4e-05  23%  629 aa  KSYK_RAT RecName: Full=Tyrosine-protein kinase SYK;       
  375::573     4e-05  23%  635 aa  KSYK_HUMAN RecName: Full=Tyrosine-protein kinase SYK;       
   60::271     4e-05  30%  412 aa  KSG6_ARATH RecName: Full=Shaggy-related protein kinase zeta;       
  301::394     4e-05  34%  497 aa  KIN20_CAEEL RecName: Full=Casein kinase I isoform delta;       
    7::213     4e-05  26%  426 aa  KC1_DICDI RecName: Full=Casein kinase I;         Short=CK1;        
    9::224     4e-05  29%  337 aa  KC1A_DROME RecName: Full=Casein kinase I isoform alpha;       
  367::559     4e-05  25%  620 aa  ITK_HUMAN RecName: Full=Tyrosine-protein kinase ITK/TSK;       
  215::432     4e-05  22%  625 aa  IRAK2_PONAB RecName: Full=Interleukin-1 receptor-associated
  213::430     4e-05  27%  622 aa  IRAK2_MOUSE RecName: Full=Interleukin-1 receptor-associated
  276::411     4e-05  30%  759 aa  HRK1_YEAST RecName: Full=Serine/threonine-protein kinase HRK1;     
  718::803     4e-05  35%  915 aa  DYRK2_DICDI RecName: Full=Probable serine/threonine-protein kinase
  745::834     4e-05  26%  916 aa  DUSTY_XENLA RecName: Full=Dual serine/threonine and tyrosine
  749::838     4e-05  26%  922 aa  DUSTY_TETNG RecName: Full=Dual serine/threonine and tyrosine
  719::807     4e-05  26%  885 aa  DUSTY_DANRE RecName: Full=Dual serine/threonine and tyrosine
   17::232     4e-05  26%  464 aa  CDK8_HUMAN RecName: Full=Cell division protein kinase 8;       
  376::644     4e-05  31%  773 aa  CBK1_CANGA RecName: Full=Serine/threonine-protein kinase CBK1;     
  150::180     4e-05  48%  248 aa  BUD32_YARLI RecName: Full=Serine/threonine-protein kinase BUD32;   
  208::386     4e-05  29%  502 aa  BMR1B_MOUSE RecName: Full=Bone morphogenetic protein receptor
  208::386     4e-05  29%  502 aa  BMR1B_HUMAN RecName: Full=Bone morphogenetic protein receptor
  198::374     4e-05  28%  513 aa  AVR2B_RAT RecName: Full=Activin receptor type-2B;       
  147::210     5e-05  36% 1433 aa  Y7989_DICDI RecName: Full=Probable serine/threonine-protein kinase
  154::267     5e-05  31% 1592 aa  Y3958_DICDI RecName: Full=Probable serine/threonine-protein kinase
  490::534     5e-05  36%  804 aa  Y2675_DICDI RecName: Full=Probable serine/threonine-protein kinase
  478::618     5e-05  30%  776 aa  SRF3_ARATH RecName: Full=Protein STRUBBELIG-RECEPTOR FAMILY
  267::447     5e-05  28%  636 aa  SMA6_CAEEL RecName: Full=Serine/threonine-protein kinase sma-6;    
   22::168     5e-05  28%  540 aa  RIPK2_HUMAN RecName: Full=Receptor-interacting
  196::351     5e-05  28%  468 aa  PMY11_CAEEL RecName: Full=Membrane-associated tyrosine- and
  805::899     5e-05  29% 1048 aa  PGFRB_TAKRU RecName: Full=Beta-type platelet-derived growth factor
  782::903     5e-05  27% 1098 aa  PGFRB_MOUSE RecName: Full=Beta-type platelet-derived growth factor
   21::223     5e-05  26%  559 aa  MDE3_SCHPO RecName: Full=Sporulation protein kinase mde3;       
  368::566     5e-05  23%  628 aa  KSYK_PIG RecName: Full=Tyrosine-protein kinase SYK;       
  371::567     5e-05  23%  629 aa  KSYK_MOUSE RecName: Full=Tyrosine-protein kinase SYK;       
  110::179     5e-05  33%  369 aa  KG1Z_YEAST RecName: Full=Probable serine/threonine-protein kinase
  139::261     5e-05  26%  342 aa  ISR1_ASHGO RecName: Full=Serine/threonine-protein kinase ISR1;     
 1068::1321    5e-05  23% 1325 aa  FPS_DROME RecName: Full=Tyrosine-protein kinase Fps85D;       
  644::895     5e-05  23%  998 aa  EPHB6_RAT RecName: Full=Ephrin type-B receptor 6;AltName:
  747::836     5e-05  26%  918 aa  DUSTY_XENTR RecName: Full=Dual serine/threonine and tyrosine
   17::232     5e-05  27%  501 aa  CD2L6_MOUSE RecName: Full=Cell division cycle 2-like protein kinase
   17::232     5e-05  27%  502 aa  CD2L6_HUMAN RecName: Full=Cell division cycle 2-like protein kinase
   66::317     7e-05  24%  487 aa  Y5126_ARATH RecName: Full=Probable serine/threonine-protein kinase
    4::207     7e-05  25%  680 aa  Y4007_DICDI RecName: Full=Putative cyclin-dependent
  128::293     7e-05  26%  326 aa  PIM3_RAT RecName: Full=Serine/threonine-protein kinase Pim-3;      
  128::293     7e-05  26%  326 aa  PIM3_MOUSE RecName: Full=Serine/threonine-protein kinase Pim-3;    
  684::862     7e-05  23%  994 aa  MERTK_MOUSE RecName: Full=Proto-oncogene tyrosine-protein kinase
  357::575     7e-05  25%  690 aa  LKH1_SCHPO RecName: Full=Dual specificity protein kinase lkh1;     
  126::337     7e-05  30%  472 aa  KSG8_ARATH RecName: Full=Shaggy-related protein kinase theta;      
   28::239     7e-05  31%  380 aa  KSG7_ARATH RecName: Full=Shaggy-related protein kinase eta;        
   16::220     7e-05  26%  341 aa  KC1A_CAEEL RecName: Full=Casein kinase I isoform alpha;       
 1126::1297    7e-05  22% 1448 aa  IRLB_DICDI RecName: Full=Probable serine/threonine-protein kinase
  266::498     7e-05  29%  979 aa  IKSA_DICDI RecName: Full=Probable serine/threonine-protein kinase
  178::386     7e-05  24%  578 aa  GRK4_HUMAN RecName: Full=G protein-coupled receptor kinase 4;      
  177::270     7e-05  30%  662 aa  CHK1_USTMA RecName: Full=Serine/threonine-protein kinase CHK1;     
   30::241     7e-05  26%  588 aa  CDK8_CAEEL RecName: Full=Cell division protein kinase 8;       
    1::136     7e-05  31%  148 aa  CDC21_PEA RecName: Full=Cell division control protein 2 homolog 1; 
   75::277     7e-05  23%  412 aa  APK1B_ARATH RecName: Full=Protein kinase APK1B, chloroplastic;     
  236::292     9e-05  39%  732 aa  YPKA_YERPS RecName: Full=Protein kinase ypkA;         Short=Protein
  236::292     9e-05  39%  732 aa  YPKA_YERPE RecName: Full=Protein kinase ypkA;         Short=Protein
   33::229     9e-05  26%  671 aa  Y6627_DICDI RecName: Full=Probable serine/threonine-protein kinase
   22::169     9e-05  27%  369 aa  Y6373_DICDI RecName: Full=Probable serine/threonine-protein kinase
  131::292     9e-05  30% 1454 aa  VPS15_YEAST RecName: Full=Serine/threonine-protein kinase VPS15;   
   22::168     9e-05  28%  540 aa  RIPK2_BOVIN RecName: Full=Receptor-interacting
  336::510     9e-05  34%  580 aa  PINK1_MOUSE RecName: Full=Serine/threonine-protein kinase PINK1,
 1107::1299    9e-05  26% 1307 aa  PHY1_CERPU RecName: Full=Light-sensor Protein kinase;Includes:
  552::632     9e-05  34%  790 aa  NPR1_YEAST RecName: Full=Nitrogen permease reactivator protein;    
   93::189     9e-05  30%  189 aa  MOS_ATHNI RecName: Full=Serine/threonine-protein kinase mos;       
   15::208     9e-05  26%  337 aa  KC1AL_HUMAN RecName: Full=Casein kinase I isoform alpha-like;      
  850::1126    9e-05  23% 1132 aa  JAK2_HUMAN RecName: Full=Tyrosine-protein kinase JAK2;       
 1014::1161    9e-05  25% 1350 aa  IRLE_DICDI RecName: Full=Probable serine/threonine-protein kinase
  587::862     9e-05  25%  887 aa  FGFR2_DUGJA RecName: Full=Fibroblast growth factor receptor 2;     
  749::838     9e-05  26%  921 aa  DUSTY_TAKRU RecName: Full=Dual serine/threonine and tyrosine
   11::129     1e-04  25%  195 aa  Y665_ARCFU RecName: Full=Uncharacterized protein AF_0665;
  275::523     1e-04  22%  527 aa  TXK_HUMAN RecName: Full=Tyrosine-protein kinase TXK;       
  841::1050    1e-04  28% 1134 aa  TIE1_MOUSE RecName: Full=Tyrosine-protein kinase receptor Tie-1;     
  845::1054    1e-04  28% 1138 aa  TIE1_HUMAN RecName: Full=Tyrosine-protein kinase receptor Tie-1;     
  843::1052    1e-04  28% 1136 aa  TIE1_BOVIN RecName: Full=Tyrosine-protein kinase receptor Tie-1;     
  807::1040    1e-04  22% 1051 aa  PTK7_CHICK RecName: Full=Tyrosine-protein kinase-like 7;       
  802::885     1e-04  30% 1007 aa  PRP4B_RAT RecName: Full=Serine/threonine-protein kinase PRP4
  802::885     1e-04  30% 1007 aa  PRP4B_PONAB RecName: Full=Serine/threonine-protein kinase PRP4
  802::885     1e-04  30% 1007 aa  PRP4B_MOUSE RecName: Full=Serine/threonine-protein kinase PRP4
  802::885     1e-04  30% 1007 aa  PRP4B_HUMAN RecName: Full=Serine/threonine-protein kinase PRP4
  803::886     1e-04  30% 1008 aa  PRP4B_BOVIN RecName: Full=Serine/threonine-protein kinase PRP4
  135::327     1e-04  26% 1337 aa  PR2_DROME RecName: Full=Tyrosine-protein kinase PR2;       
  802::961     1e-04  24% 1087 aa  PGFRA_CHICK RecName: Full=Alpha-type platelet-derived growth factor
  122::333     1e-04  30%  468 aa  KSGT_BRANA RecName: Full=Shaggy-related protein kinase theta;      
  850::1126    1e-04  23% 1132 aa  JAK2_RAT RecName: Full=Tyrosine-protein kinase JAK2;       
  315::432     1e-04  27%  624 aa  IRAK2_RAT RecName: Full=Interleukin-1 receptor-associated
  214::413     1e-04  22%  625 aa  IRAK2_HUMAN RecName: Full=Interleukin-1 receptor-associated
  948::1057    1e-04  34% 1162 aa  E2AK3_DROME RecName: Full=Eukaryotic translation initiation factor
   17::232     1e-04  25%  464 aa  CDK8_XENTR RecName: Full=Cell division protein kinase 8;       
 1005::1150    2e-04  25% 1348 aa  VGFR2_COTJA RecName: Full=Vascular endothelial growth factor receptor
   76::226     2e-04  29%  565 aa  SRPK3_MOUSE RecName: Full=Serine/threonine-protein kinase SRPK3;   
   77::227     2e-04  29%  533 aa  SRPK3_HUMAN RecName: Full=Serine/threonine-protein kinase SRPK3;   
 1272::1346    2e-04  40% 1887 aa  SPKUL_DICDI RecName: Full=Bifunctional serine/threonine-protein
  339::409     2e-04  39%  777 aa  PTK2_CANGA RecName: Full=Serine/threonine-protein kinase PTK2;     
  468::554     2e-04  30%  699 aa  PRR2_YEAST RecName: Full=Serine/threonine-protein kinase PRR2;     
   92::255     2e-04  26%  334 aa  KR1_SUHVK RecName: Full=Serine/threonine-protein kinase;       
  850::1126    2e-04  22% 1129 aa  JAK2_MOUSE RecName: Full=Tyrosine-protein kinase JAK2;       
  781::865     2e-04  37% 1115 aa  IRE1_YEAST RecName: Full=Serine/threonine-protein
  725::832     2e-04  32% 1576 aa  GCN2_SCHPO RecName: Full=Serine/threonine-protein kinase gcn2;     
  161::366     2e-04  27%  484 aa  CLK1_HUMAN RecName: Full=Dual specificity protein kinase CLK1;     
   17::232     2e-04  26%  501 aa  CDK8_AEDAE RecName: Full=Cell division protein kinase 8;       
  358::497     2e-04  32%  756 aa  CBK1_YEAST RecName: Full=Serine/threonine-protein kinase CBK1;     
  557::777     2e-04  26% 1047 aa  ANPRB_BOVIN RecName: Full=Atrial natriuretic peptide receptor B;   
  312::508     2e-04  24%  605 aa  Y6481_DICDI RecName: Full=Probable serine/threonine-protein kinase
  774::960     2e-04  23% 1048 aa  Y5020_ARATH RecName: Full=Probable inactive receptor kinase
   13::183     2e-04  26%  669 aa  Y1918_DICDI RecName: Full=Probable serine/threonine-protein kinase
  282::475     2e-04  28%  555 aa  WEE2_MOUSE RecName: Full=Wee1-like protein kinase 2;       
  159::193     2e-04  49%  348 aa  SBK2_HUMAN RecName: Full=Serine/threonine-protein kinase SBK2;     
   27::286     2e-04  25%  518 aa  RIPK3_HUMAN RecName: Full=Receptor-interacting
   23::224     2e-04  22%  433 aa  KKQ1_YEAST RecName: Full=Probable serine/threonine-protein kinase
   11::215     2e-04  24%  365 aa  HHP1_SCHPO RecName: Full=Casein kinase I homolog hhp1;       
  365::458     2e-04  30%  520 aa  GCP_METHJ RecName: Full=Putative O-sialoglycoprotein endopeptidase;
  798::944     2e-04  22%  992 aa  FLT3_MOUSE RecName: Full=FL cytokine receptor;       
  238::318     2e-04  31%  640 aa  ELM1_YEAST RecName: Full=Serine/threonine-protein kinase ELM1;     
  749::906     2e-04  24%  972 aa  CSF1R_HUMAN RecName: Full=Macrophage colony-stimulating factor 1
  321::460     2e-04  31%  716 aa  CBK1_DEBHA RecName: Full=Serine/threonine-protein kinase CBK1;     
  316::455     2e-04  32%  719 aa  CBK1_ASHGO RecName: Full=Serine/threonine-protein kinase CBK1;     
  745::816     3e-04  36% 1078 aa  Y8642_DICDI RecName: Full=Probable serine/threonine-protein kinase
    4::194     3e-04  26% 1397 aa  Y2550_DICDI RecName: Full=Probable cyclin-dependent
 1021::1166    3e-04  25% 1298 aa  VGFR3_HUMAN RecName: Full=Vascular endothelial growth factor receptor
  999::1150    3e-04  24% 1327 aa  VGFR1_CHICK RecName: Full=Vascular endothelial growth factor receptor
  223::317     3e-04  27%  357 aa  TRIB3_BOVIN RecName: Full=Tribbles homolog 3;         Short=TRB-3;
  159::193     3e-04  46%  362 aa  SBK2_RAT RecName: Full=Serine/threonine-protein kinase SBK2;       
  313::383     3e-04  39%  649 aa  PTK1_YEAST RecName: Full=Serine/threonine-protein kinase PTK1/STK1;
  358::500     3e-04  37%  581 aa  PINK1_HUMAN RecName: Full=Serine/threonine-protein kinase PINK1,
   58::269     3e-04  29%  407 aa  KSG9_ARATH RecName: Full=Shaggy-related protein kinase iota;       
  119::213     3e-04  32%  416 aa  KC1E_MOUSE RecName: Full=Casein kinase I isoform epsilon;       
  119::213     3e-04  32%  416 aa  KC1E_HUMAN RecName: Full=Casein kinase I isoform epsilon;       
  119::213     3e-04  32%  416 aa  KC1E_CHICK RecName: Full=Casein kinase I isoform epsilon;       
  119::213     3e-04  32%  415 aa  KC1D_XENTR RecName: Full=Casein kinase I isoform delta;       
  119::213     3e-04  32%  415 aa  KC1D_XENLA RecName: Full=Casein kinase I isoform delta;       
  119::213     3e-04  32%  415 aa  KC1D_RAT RecName: Full=Casein kinase I isoform delta;       
  119::213     3e-04  32%  415 aa  KC1D_PONAB RecName: Full=Casein kinase I isoform delta;       
  119::213     3e-04  32%  415 aa  KC1D_MOUSE RecName: Full=Casein kinase I isoform delta;       
  119::213     3e-04  32%  415 aa  KC1D_HUMAN RecName: Full=Casein kinase I isoform delta;       
  119::213     3e-04  32%  415 aa  KC1D_BOVIN RecName: Full=Casein kinase I isoform delta;       
  119::213     3e-04  32%  409 aa  KC1DB_DANRE RecName: Full=Casein kinase I isoform delta-B;       
  119::213     3e-04  32%  403 aa  KC1DA_DANRE RecName: Full=Casein kinase I isoform delta-A;       
  429::471     3e-04  40%  534 aa  GCP_METTH RecName: Full=Putative O-sialoglycoprotein endopeptidase;
   74::276     3e-04  22%  410 aa  APK1A_ARATH RecName: Full=Protein kinase APK1A, chloroplastic;     
  206::356     3e-04  27%  555 aa  SSN3_YEAST RecName: Full=Meiotic mRNA stability protein kinase
  232::382     3e-04  27%  593 aa  SSN3_KLULA RecName: Full=Serine/threonine-protein kinase SSN3;     
  474::745     3e-04  24%  943 aa  ROR2_HUMAN RecName: Full=Tyrosine-protein kinase transmembrane
  251::329     3e-04  38%  534 aa  PPK15_SCHPO RecName: Full=Serine/threonine-protein kinase ppk15;   
    4::173     3e-04  26%  419 aa  MOK_HUMAN RecName: Full=MAPK/MAK/MRK overlapping kinase;       
 1271::1542    3e-04  25% 2038 aa  LRRK1_HUMAN RecName: Full=Leucine-rich repeat
  464::549     3e-04  25%  609 aa  KPK1_PHAVU RecName: Full=Protein kinase PVPK-1;       
  781::938     3e-04  23%  978 aa  KFMS_FSVMD RecName: Full=Tyrosine-protein kinase transforming
  372::564     3e-04  24%  625 aa  ITK_MOUSE RecName: Full=Tyrosine-protein kinase ITK/TSK;       
  313::358     3e-04  41%  667 aa  IKS1_YEAST RecName: Full=Probable serine/threonine-protein kinase
  377::465     3e-04  27%  527 aa  GCP_METMJ RecName: Full=Putative O-sialoglycoprotein endopeptidase;
  715::912     3e-04  24% 1342 aa  ERBB3_PONAB RecName: Full=Receptor tyrosine-protein kinase erbB-3; 
  715::912     3e-04  24% 1342 aa  ERBB3_HUMAN RecName: Full=Receptor tyrosine-protein kinase erbB-3; 
  747::904     3e-04  23%  980 aa  CSF1R_FELCA RecName: Full=Macrophage colony-stimulating factor 1
  123::190     3e-04  39%  479 aa  CDKF1_ORYSJ RecName: Full=Cyclin-dependent kinase F-1;       
  123::190     3e-04  39%  479 aa  CDKF1_ORYSI RecName: Full=Cyclin-dependent kinase F-1;       
  142::232     3e-04  35%  464 aa  CDK8_DANRE RecName: Full=Cell division protein kinase 8;       
   30::241     3e-04  24%  613 aa  CDK8_CAEBR RecName: Full=Cell division protein kinase 8;       
  625::789     4e-04  24%  894 aa  YS3J_CAEEL RecName: Full=Putative tyrosine-protein kinase F09A5.2; 
  213::363     4e-04  26%  567 aa  SSN3_CANGA RecName: Full=Serine/threonine-protein kinase SSN3;     
  218::364     4e-04  28%  581 aa  SSN3_ASHGO RecName: Full=Serine/threonine-protein kinase SSN3;     
   94::275     4e-04  27%  832 aa  RIPK4_HUMAN RecName: Full=Receptor-interacting
    2::51      4e-04  43%   62 aa  MP2K3_XENLA RecName: Full=Dual specificity mitogen-activated
  120::213     4e-04  32%  450 aa  KC1D_ARATH RecName: Full=Casein kinase I isoform delta-like;       
  879::1071    4e-04  25% 1156 aa  JAK1_CYPCA RecName: Full=Tyrosine-protein kinase Jak1;       
  122::261     4e-04  31%  570 aa  FLR4_CAEEL RecName: Full=Serine/threonine-protein kinase flr-4;    
  119::213     4e-04  31%  440 aa  DCO_DROME RecName: Full=Discs overgrown protein kinase;       
   22::201     4e-04  28%  329 aa  CTK1_ENCCU RecName: Full=Probable CTD kinase subunit alpha homolog;
  108::236     4e-04  26%  306 aa  CSK1_SCHPO RecName: Full=Serine/threonine-protein kinase csk1;     
  159::364     4e-04  28%  481 aa  CLK4_MOUSE RecName: Full=Dual specificity protein kinase CLK4;     
   19::213     4e-04  26%  313 aa  CKB21_ARATH RecName: Full=Cyclin-dependent kinase B2-1;       
  309::448     4e-04  31%  718 aa  CBK1_KLULA RecName: Full=Serine/threonine-protein kinase CBK1;     
  511::665     4e-04  28%  776 aa  ACCR2_ARATH RecName: Full=Serine/threonine-protein kinase-like
  168::249     6e-04  32%  636 aa  Y8487_DICDI RecName: Full=Probable cyclin-dependent
  251::324     6e-04  31%  875 aa  SAMKC_DICDI RecName: Full=Probable serine/threonine-protein kinase
  535::621     6e-04  24%  706 aa  KPCT_HUMAN RecName: Full=Protein kinase C theta type;       
  214::319     6e-04  26% 1237 aa  KIN25_CAEEL RecName: Full=Probable tyrosine-protein kinase kin-25; 
  348::484     6e-04  23%  545 aa  GCP_METBF RecName: Full=Putative O-sialoglycoprotein endopeptidase;
  432::517     6e-04  24%  589 aa  G11A_ORYSJ RecName: Full=Protein kinase G11A;         EC=2.7.11.1;
  432::517     6e-04  24%  589 aa  G11A_ORYSI RecName: Full=Protein kinase G11A;         EC=2.7.11.1;
  713::910     6e-04  24% 1339 aa  ERBB3_RAT RecName: Full=Receptor tyrosine-protein kinase erbB-3;   
  752::909     6e-04  24%  977 aa  CSF1R_DANRE RecName: Full=Macrophage colony-stimulating factor 1
  142::232     6e-04  34%  454 aa  CDK8_DROME RecName: Full=Cell division protein kinase 8;       
  559::801     6e-04  25% 1057 aa  ANPRA_RAT RecName: Full=Atrial natriuretic peptide receptor A;     
  139::208     8e-04  33% 1371 aa  Y9988_DICDI RecName: Full=Probable serine/threonine-protein kinase
  466::559     8e-04  35%  637 aa  Y0652_DICDI RecName: Full=Probable serine/threonine-protein kinase
  215::346     8e-04  23%  555 aa  WEE1A_XENLA RecName: Full=Wee1-like protein kinase;       
 1029::1174    8e-04  24% 1357 aa  VGFR3_DANRE RecName: Full=Vascular endothelial growth factor receptor
  385::579     8e-04  23%  674 aa  TMKL1_ARATH RecName: Full=Putative kinase-like protein TMKL1;Flags:
  254::326     8e-04  34%  562 aa  STT7_ARATH RecName: Full=Serine/threonine-protein kinase SNT7,
  248::381     8e-04  27%  654 aa  SSN3_USTMA RecName: Full=Serine/threonine-protein kinase SSN3;     
  191::269     8e-04  37%  382 aa  KR1_EHV1V RecName: Full=Serine/threonine-protein kinase;       
  191::269     8e-04  37%  382 aa  KR1_EHV1K RecName: Full=Serine/threonine-protein kinase;       
  191::269     8e-04  37%  382 aa  KR1_EHV1B RecName: Full=Serine/threonine-protein kinase;       
  565::722     8e-04  30%  813 aa  HAL5_CANGA RecName: Full=Serine/threonine-protein kinase HAL5;     
  159::364     8e-04  27%  481 aa  CLK4_HUMAN RecName: Full=Dual specificity protein kinase CLK4;     
  158::251     8e-04  37%  608 aa  BUR1_DEBHA RecName: Full=Serine/threonine-protein kinase BUR1;     
  559::801     8e-04  25% 1057 aa  ANPRA_MOUSE RecName: Full=Atrial natriuretic peptide receptor A;   
    1::603

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MAMAAGFPDGEELPEYIGPYKIRRRIGQGGMGVVYQAVDPQDRLVAVKVLRAEVAGDDIARARLAREVMT
PKWA_THECU      -------------PGRIGPYRLVSRLGAGGMGQVFLARSPGGRPVVVKVILPEYANDDEYRIRFXXXXXX
AFSK_STRCO      -------------PRRIGPFEVLGRLGAGGMGLVYLARSASGRRVAIKTVRTELAEDQLFRVRFTREVEA
AFSK_STRGR      -------------PRRIGPFEVLGRLGAGGMGLVYLARSASGRRVAIKTVRTELAEDQLFRVRFTREVEA
PKNB_LACLA      -------------------YRIIKEIGRGGMANVYQGEDTGDRLVAIKVLRSNFENDDIAIARFQREAFA
PKNK_MYCTU      -------------------------IGRGGFGVVYRCVQPSDRAVAVKVLSTDLDRDNLER--FLREQRA
PKN1_THETN      -------------------YEILEKIGEGGMAKVYKACHLLNRIVAIKILRPEFAADENFVKKFKRESQA
PKNK_MYCBO      -------------------------IGRGGFGVVYRCVQPSDRAVAVKVLSTDLDRDNLER--FLREQRA
PKNB_BIFLO      -----------------GRYQLGQLIGRGGMAEVHVALDTRGRTVAVKIMRADLANDDIFLARFRREAHA
PKNH_MYCTU      -----------------GPYHLKRLLGRGGMGEVYEAEHTKEWTVAVKLMTAEFSKDPVFRERMKREARI
PKNH_MYCBO      -----------------GPYHLKRLLGRGGMGEVYEAEHTKEWTVAVKLMTAEFSKDPVFRERMKREARI
PRKC_BACSU      -----------------GRYQILRVIGGGGMANVYLAEDILDREVAIKILRFDYANDNEFIRRFRREAQS
PKNA_MYCTU      -----------------GRYRLQRLIATGGMGQVWEAVDNRGRRVAVKVLKSEFSSDPEFIERFRAEART
PKNA_MYCBO      -----------------GRYRLQRLIATGGMGQVWEAVDNRGRRVAVKVLKSEFSSDPEFIERFRAEART
PKNB_MYCLE      -------------PHLSDRYELGDILGFGGMSEVHLARDIRHRDVAVKVLRADLARDPSFYLRFRREAQN
PKNA_MYCLE      -----------------GRYRLHRLIATGGMGQVWEAVDSRGRRVAVKVLKGEFSSDPEFIERFRAEART
PK1_STRTO       -----------------GRYRVDARIAVGGMATVYRAVDTRDRVLALKVMHPSLAADASFVERFIREAKS
PKAA_STRCO      -------------------YLLEEPLGRGATGTVWRARQRETETVAIKVLKEELASDADIVMRFLRERSV
PKNB_MYCTU      -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
PKNB_MYCBO      -------------------YELGEILGFGGMSEVHLARDLRHRDVAVKVLRADLARDPSFYLRFRREAQN
PKNX_STRCO      -----------------GRYELGPVLGRGGMAEVYHAHDTRGRQVAVKTLRADLARDPSFQARFRREAQS
PKNF_MYCTU      -------------------FTIVRQLGSGGMGEVYLARHPRPRQDALKVLRADVSADGEYRARFNREADA
PKNF_MYCBO      -------------------FTIVRQLGSGGMGEVYLARHPRPRQDALKVLRADVSADGEYRARFNREADA
PKN2_CLOAB      -------------------YKIEEEIGVGGTAVVYKAMDTLNRHVAVKVLKHEFTEDEEFVFKFKREXXX
PKN2_COREF      ----------QRLQELIGPYTLQWIVGHGGMSTVWLADDNNDREVAVKVLRPEFSDNTEFLSRFRNEARA
PKN1_CORGL      -------------------YELDAVIGSGGMSEVFAATDTLGREVAVKMLRIDLAKDPNFRERFRREAQN
PKN2_CLOPE      -------------------YELLQCVGEGGMSFVYKACRKLNRFVAVKILKDEFKNNEEIVRRFKKEATA
PKN1_COREF      -------------------YELGASIGSGGMSEVFAATDLLGREVAVKMLRTDLAKDVNFRERFRREAQN
PKN2_CORGL      ----------DRLQELIGAYRLQWIIGHGGMSTVWLADDVNDREVAIKVLRPEFSDNQEFLNRFRNEAQA
PKNA2_BIFLO     -----------------GRYRIVRNIAEGGMATVYEAIDERGRTVAIKVMHTQLAKGPHREQRFRREANS
Y4251_DICDI     ------FPSSQIMPDSIGEYTLGEKIGRGAFGQVFKGLNGKTEFVAIKQIDSNKI-DESSLQSVKGEVEI
PKNL_MYCBO      -------------------YLVQAKIASGGTSTVYRGLDVRDRPVALKVMDARYAGDEQFLTRFRLEXXX
PKND_MYCTU      -----------------GPYQXXXXXXXXXXXEVYEAEDTRKRVVALKLISPQYSDNAVFRARMQREADT
PKNL_MYCTU      -------------------YLVQAKIASGGTSTVYRGLDVRDRPVALKVMDSRYAGDEQFLTRFRLEXXX
PKSC_STRCO      -------------------------LGEGGMASVHLAYDSVDRQVAIKTLHTELGXXXXXXXXXXXXXXX
PKN3_MYXXA      --------------EYVGKYRVEALIGEGGMGKVFRARQXXXXXXXXXXXRHTLLSDERTVARFQREAKA
STK6_BOVIN      -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
DCLK2_HUMAN     -------------------YKIGKVIGDGNFAVVKECIDRSTKEFALKIIKAKCCGKEHL---IENEVSI
STK6_PIG        -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
PKN2_MYXXA      -----------------GRFRVLRPLGSGGMGEVYLGEQVSGRKVAIKVLHHDLHAQAGMAERFKREARL
DCLK2_MOUSE     -------------------YRIGKVIGDGNFAVVKECVDRYTKEFALKIIKAKCCGKEHL---IENEVSI
PAK1_RAT        ------------------------KIGQGASGTVYTAMDATGQEVAIKQMNLQ---QQPKKELIINEILV
PAK1_HUMAN      ------------------------KIGQGASGTVYTAMDATGQEVAIKQMNLQ---QQPKKELIINEILV
PAK1_BOVIN      ------------------------KIGQGASGTVYTAMDATGQEVAIKQMNLQ---QQPKKELIINEILV
PAK1_MOUSE      ------------------------KIGQGASGTVYTAMDATGQEVAIKQMNLQ---QQPKKELIINEILV
STK33_MOUSE     --------DGAGIEEF---YTFGRILGQGSFGMVFEAIDKETGAKAIKKVNKEKAGSS-AMKLLEREVSI
FRAY2_DICDI     -------------PNSADQYELKETIGKGGSGLVQRAICPFQENVAIKIIDLEHC-KNVSLEEIRKEIQA
CIPKC_ORYSJ     -------------------YELGRVLGQGSFAKVYQARHLEDECVAIKVLDKEKAVKGGMVHLVKREINV
STK6_HUMAN      -------------------FEIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
STK33_BOVIN     -------------------YTFGRILGQGSFGMVIEAIDKEETKWAIKKVNKEKAGSSAVKL-LEREVDI
STK36_PONAB     -------------------YHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEI
STE20_NEUCR     -------------------YRGFTKIGQGASGGVYTGHERSNRLVAIKQMNLE---QQPKKDLIINEILV
PAK3_RAT        ------------------------KIGQGASGTVYTALDATGQEVAIKQMNLQ---QQPKKELIINEILV
PAK3_PONPY      ------------------------KIGQGASGTVYTALDATGQEVAIKQMNLQ---QQPKKELIINEILV
PAK3_PANTR      ------------------------KIGQGASGTVYTALDATGQEVAIKQMNLQ---QQPKKELIINEILV
PAK3_MOUSE      ------------------------KIGQGASGTVYTALDATGQEVAIKQMNLQ---QQPKKELIINEILV
PAK3_HUMAN      ------------------------KIGQGASGTVYTALDATGQEVAIKQMNLQ---QQPKKELIINEILV
PAK2_RAT        -------------------YTRYEKIGQGASGTVFTATDVAGQEVAIKQINLQ---KQPKKELIINEILV
PAK2_RABIT      -------------------YTRYEKIGQGASGTVFTATDVAGQEVAIKQINLQ---KQPKKELIINEILV
PAK2_MOUSE      -------------------YTRYEKIGQGASGTVFTATDVAGQEVAIKQINLQ---KQPKKELIINEILV
PAK2_HUMAN      -------------------YTRYEKIGQGASGTVFTATDVAGQEVAIKQINLQ---KQPKKELIINEILV
MKCC_DICDI      -------------------YKNLKQIGSGGFGSVFLAKSTVDKCIAIKKI-AHVSAK--AQRTNLNEIGF
STK36_HUMAN     -------------------YHVLEMIGEGSFGRVYKGRRKYSAQVVALKFIPKLGRSEKELRNLQREIEI
STE20_USTMA     -------------------YRSLQKIGQGASGGVFTAYQVGTNVVAIKQMNLE---QQPKKDLIINEILV
PKNJ_MYCTU      -------------------YRIERMLGAGGMGTVYLARNPDPRSEALKVLAAELSRDLDFRARFVREADV
PKNJ_MYCBO      -------------------YRIERMLGAGGMGTVYLARNPDPRSEALKVLAAELSRDLDFRARFVREADV
NAK1_SCHPO      ------------------PYTKLELVGRGSYGAVYRGINLTKETVAIKILNLDTDEDEVSD--IQKEVAV
DCLK1_HUMAN     --------EGFQIPATITEYKVGRTIGDGNFAVVKECVERSTREYALKIIKSKCRGKE---HMIQNEVSI
STK33_HUMAN     -------------------YTFGRILGKGSFGIVIEATDKETETKAIKKVNKEKAGSSAVKL-LEREVNI
SPKC_SYNY3      -------------------YRIIETLGRGGFGETFLAQDPSARKCVIKHLKPVLENPEIPRERFHREAAT
Y8901_DICDI     --------------ESCGDYLLIDIIGKGGFGVVYKGLHKTKGYFSAXXXXXXXXXXXLSQISLMAEINL
PKNE_MYCTU      -----------------GPYXXXXXXXXXXXXDVYEAEDTRERIVALKLMSETLSSDPVFRTRMQREART
PAK4_HUMAN      ------------------------KIGEGSTGIVCIAVRSSGKLVAVKKMDLR---KQQRRELLFNEVVI
MRKA_DICDI      ----------------IGNYLVIKTIGRGQFGKVYHKKIPNEK-VAIKIINKGKLDPETLKM-VQREVRI
DCLK1_RAT       --------EGFQIPATITEYKVGRTIGDGNFAVVKECIERSTREYALKIIKSKCRGKE---HMIQNEVSI
DCLK1_MOUSE     --------EGFQIPATITEYKVGRTIGDGNFAVVKECIERSTREYALKIIKSKCRGKE---HMIQNEVSI
KPSH1_HUMAN     -------------PRVTAKYDIKALIGRGSFSRVVRVEHRATRQYAIKMIETKYRGREVCES----ELRV
KPSH1_BOVIN     -------------PRVTAKYDIKALIGRGSFSRVVRVEHRATRQYAIKMIETKYRGREVCES----ELRV
KCC1B_HUMAN     -------------------YEIRERLGSGAFSEVVLAQERGSHLVALKCIKKALRGKE---ALVENEIAV
ZYG1_CAEBR      -----------------------QQIGQGGFGVVYSAQRENGEKVAIKKI-----GNAASQTRIKEEIKT
STE20_CANGA     -------------------YRDLIKIGQGASGGVYIAHDTESESVAIKQMNLE---KQPKKELILNEILV
PKNE_MYCBO      -----------------GPYXXXXXXXXXXXXDVYEAEDTRERIVALKLMSETLSSDPDFRTRMQREART
STK6_MOUSE      -------------------FDIGRPLGKGKFGNVYLARERQSKFIALKVLFKTQLEKANVEHQLRREVEI
KPSH1_MOUSE     -------------PRVTAKYDIKALIGRGSFSRVVRVEHRATRQYAIKMIETKYRGREVCES----ELRV
KIC1_YEAST      -------------------FKRTEVIGRGKFGVVYKGYNVKTRVYAIKVLNLDSDSDEVEDVQ--REIQF
KCC1B_RAT       -------------------YEIREKLGSGAFSEVMLAQERGSHLVALKCIKKALRGKE---ALVENEIAV
KCC1B_MOUSE     -------------------YEIREKLGSGAFSEVMLAQERGSHLVALKCIKKALRGKE---ALVENEIAV
STK25_HUMAN     ------------------------RIGKGSFGEVYKGIDNHTKEV-VXXXXXXXXXXXXXXXXXXXXXTV
STK25_BOVIN     ------------------------RIGKGSFGEVYKGIDNRTKEV-VXXXXXXXXXXXXXXXXXXXXXTV
STE20_PENMA     ------------------------KIGQGASGGVFTAYETNNKCVAIKQMNLDLQPK---KDLIINEILV
STE20_MAGGR     -------------------YRSFTKIGQGASGGVYTGHERSNRLVAIKQMNLE---QQPKKDLIINEILV
STE20_DEBHA     -------------------YKDLMKIGQGASGGVYIAHDVNHRTVAIKQMNLE---QQPKKELIINEILV
STK24_HUMAN     ----------------------------------------------------------------------
PKND_CHLAB      -------------------YDIIRMIGKGGMGEVYLAYDPISRKVALKRIREDLSDNELLKKRFLREAKI
PKN1_MYXXA      --------------------------------------------VAVKVLHAHLTMYPELVQRFHAEARA
PAK1_CAEEL      -------------------YRKVDKIGSGASGSVYTAIESTEAEVAIKQMNLK---DQPKKELIINEILV
MELK_HUMAN      --------DYDELLKY---YELHETIGTGGFAKVKLACHITGEMVAIKIMDKNTLGSDLPRIKT--EIEA
KPSH1_DANRE     -------------PRVTAKYDIKALIGRGSFSRVVRVEHRSTRQYAIKMIETRYRGREVCES----ELCV
TAO1A_XENLA     -----------------------REIGHGSFGAVYFAHDASTRVVAIKKMSYSGKQSNEKWQDIVKEVKF
STK25_MOUSE     ------------------------RIGKGSFGEVYKGIDNHTKEV-VXXXXXXXXXXXXXXXXXXXXXTV
STE20_YARLI     -------------------YRNLVKIGQGASGGVFTAYEVGSNLVAIKQMNLE---HQPKKELIINEILV
STK6_RAT        -------------------FDIGRPLGKGKFGNVYLAREKQSKFIALKVLQLEKAG---VEHQLRREVEI
STK24_MOUSE     ----------------------------------------------------------------------
STE20_CANAL     ------------------------KIGQGASGGVFLAHDVRDKIVAIKQMNLE---QQPKKELIINEILV
SID1_SCHPO      -------------------YTLLRKLGSGSFGVVWKARENSGDIIAIKQIDLETGIDDITD--IEQEVFM
MYLKG_DICDI     -------------------YVVGKELGRGAFSVVREGTTTSDKVALKYIEKKFVKKKHIEQLR--REIDI
CIPKD_ORYSJ     --------EAKKPPLLLGRFEVGKLLGQGNFAKVYHARNATGEEVAIKVMEKEKIFKSGLTAHIKREIAV
CDPKJ_ARATH     -------------------YSLGRELGRGQFGITYICTESSGKNFACKSILKRKLIRTKDREDVRREIQI
Y9955_DICDI     --------------------KISSKLGEGTFGVVYKGLW-RGSSVAIKQIKINEDVNNQVLEEFRKELTI
TAOK1_RAT       -----------------------REIGHGSFGAVYFARDVRNEVVAIKKMSYSGKQSTEKWQDIIKEVKF
TAOK1_MOUSE     -----------------------REIGHGSFGAVYFARDVRNEVVAIKKMSYSGKQSTEKWQDIIKEVKF
TAOK1_HUMAN     -----------------------REIGHGSFGAVYFARDVRNEVVAIKKMSYSGKQSTEKWQDIIKEVKF
TAO1B_XENLA     -------PDVAELFFRDDPEKLLREIGHGSFGAVYFAHDARSEVVAIKKMSYSGKQSNEKWQDIIKEVKF
CIPKW_ORYSJ     ----------------VGKYELGRTIGEGTFAKVKFARDTETGPVAIKILDKEKVLKHKMVEQIKREIST
STE20_SCHPO     ------------------------KIGQGASGDVYSARQVGTNLVAIKKMNIN---QQPKKEFIVNEILV
STE20_ASPFU     ------------------------KIGQGASGGVYTAYQHTNNCVAIKQMNLDLQPK---KELIINEILV
CIPKX_ORYSJ     ----------------VGKYELGRTIGEGTFAKVKFARDTETGPVAIKILDKEKVLKHKMVEQIKREIST
PAKM_DROME      ------------------------KIGEGSTGTVCIATDKSTRQVAVKKMDLR---KQQRRELLFNEVVI
CDPKK_ARATH     -------------------YSVGRKLGQGQFGTTFLCVDKKTKEFACKTIRKLTTPEDVEDVR--REIQI
CDC15_YEAST     -------------------YHLKQVIGRGSYGVVYKAINKHDQVVAIKEVVYE---NDEELNDIMAEISL
PKND_CHLCV      -------------------YDIIRMIGKGGMGEVYLAYDPVSRKVALKRIREDLSDNELLKKRFLREAKI
PAK6_PONAB      ------------------------KIGEGSTGIVCLAREKHSRQVAVKMMDLR---KQQRRELLFNEVVI
PAK6_HUMAN      ------------------------KIGEGSTGIVCLAREKHSRQVAVKMMDLR---KQQRRELLFNEVVI
DST1_DICDI      -------------------YHIQERLGKGSFGQVFKAVHANGKVVAIKIISLD---DQEAIKDVRKEISI
CIPKC_ARATH     ----------------LGRYEMGKLLGHGTFAKVYLARNVKNESVAIKVIDKEKVLKGGLIAHIKREISI
AUR3_ARATH      ----------------LADFEIGRPLGKGKFGRVYLAREAKSKIVALKVIFKEQIEKYKIHHQLRREMEI
M4K2_HUMAN      -------------------FELLQRVGAGTYGDVYKARDTTSELAAVKIVKLD-PGDDISS--LQQEITI
QSK_HUMAN       ------------MPARIGYYEIDRTIGKGNFAVVKRATHLVTKAVAIKIIDKTQLDEENLK-KIFREVQI
MYLKB_DICDI     -------------------YEFGPEIGRGAFSIVRQGTDTGDQVAIKAISKQHVSEADMKR--FTREIEI
DRKA_DICDI      --------DGKDID--IHQIKIGVRIGKGNYGEVYLGTWRGSQ-VAVKKLPAHNINENILK-EFHREINL
AURKB_RAT       -------------PFTIDNFEIGRPLGKGKFGNVYLAREKKSRIVALKILFKSQIEKEGVEHQLRREIEI
Y9877_DICDI     -------------------YQIGEAVGKGAFGKVFKALNAETGFCAIKQIEKTIISEKQLPS-IIQEIKL
STE20_KLULA     -------------------YKNLIKIGQGASGGVYTAYEGTNASVAIKQMNLE---KQPKKELIVNEILV
M4K2_MOUSE      -------------------FELLQRVGAGTYGDVYKARDTTSELAAVKIVKLD-PGDDISS--LQQEITI
CRK16_ARATH     ------------------------KLGHGGFGEVFKGTFPNGTEVAVKRL-SKISGQ--GEEEFKNEVLL
KPSH2_HUMAN     -------------PRVLARYDIKALIGTGSFSRVVRVEQKTTKKFAIKVMETR---EREGREACVSELSV
TAOK3_HUMAN     --------DPEEL--FIGLHEI----GHGSFGAVYFATNAHSEVVAIKKMSYSGKQTHEKWQDILKEVKF
STE20_EMENI     ------------------------KIGQGASGGVFTAYEQHNNCVAIKQMNLDLQPK---KDLIINEILV
IKKB_BOVIN      -----------------GAWEMKERLGTGGFGNVIRWHNQETEQIAIKQCRQELSPRN--RERWCLEIQI
TAOK2_RAT       -------PDVAELFFKDDPEKLLREIGHGSFGAVYFARDVRNEVVAIKKMSYSGKQSNEKWQDIIKEVRF
TAOK2_MOUSE     -------PDVAELFFKDDPEKLLREIGHGSFGAVYFARDVRNEVVAIKKMSYSGKQSNEKWQDIIKEVRF
STK6_XENLA      --------EGKKKQWCLEDFEIGRPLGKGKFGNVYLARERESKFIALKVLQLEKAG---VEHQLRREVEI
STE20_ASPOR     ------------------------KIGQGASGGVFTAYNGTGSCVAIKQMNLDLQPK---KDLIINEIIV
STE20_ASHGO     ------------------PSKIYRKIGQGASGGVYTAYEGTNASVAIKQMNLE---KQPKKELIINEILV
PKND_CHLFF      -------------------YDIIRMIGKGGMGEVYLAYDPVSRKVALKRIREDLSDNELLKKRFLREAKI
MKKA_DICDI      -------------------------LGRGGYGSVYLGLNKDTELFAVKQLEIVDINSDPKLKNMSKEIEV
CDC5_YEAST      -------------------------LGEGGFARCFQIKDDSGEIFAAKTVAKASIKSEKTRKKLLSEIQI
YSK4_HUMAN      -------------------------LGKGAYGTVYCGLTSQGQLIAVKQVALDTSNKLAAEKKLQEEVDL
TAOK2_HUMAN     -------PDVAELFFKDDPEKLLREIGHGSFGAVYFARDVRNEVVAIKKMSYSGKQSNEKWQDIIKEVRF
QSK_MOUSE       ----------------IGYYEIDRTIGKGNFAVVKRATHLVTKAVAIKIIDKSQLDEENLK-KIFREVQI
PLK3_CAEEL      ------------------PYEKGAFLGEGGFAHCFEKLDCNDRL-A