[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54828.1

[Show Plain Result]


## Summary of Sequence Search
    1::125
    3::125     2e-13  30%  125 aa  Y3922_STRCO RecName: Full=Uncharacterized protein SCO3922;
    1::125

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xSIILRVIVNAIALWAAVLLVDGIEVSADTTVSTIATYLGIGALFGIVNAVIKPIVKTVGCIFYYXXXXX
Y3922_STRCO     -NFLVKTIANAGALAVAVWLLDKITLTGGSTGEKTLTLIVVALVFGLVNMVVKPIVQVLTFPLFILTLGL


                         .         .         *         .         .         .         .:140
query           XXXXXXXXXXXXXXXXXXXXGIPFEIDGFWAAFWGAIIVAIVSWLLSLFVGKDDx
Y3922_STRCO     FTLVVNALMLLLTSWVADKLDLSFHVDGFWTAVLGGLIVSIVSWALNAFLPDGD-