[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ54978.1

[Show Plain Result]


## Summary of Sequence Search
    1::1077
  267::447     2e-09  32%  449 aa  QSEC_ECO57 RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  267::447     5e-09  31%  449 aa  QSEC_ECOLI RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  450::550     5e-08  34%  597 aa  DIVJ_CAUCR RecName: Full=Histidine protein kinase divJ;       
  231::366     2e-07  31%  384 aa  SENX3_MYCS2 RecName: Full=Signal-transduction histidine kinase
  336::465     5e-07  29%  525 aa  Y1002_RHIME RecName: Full=Uncharacterized sensor-like histidine
  276::448     1e-06  32%  449 aa  QSEC_SALTI RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  259::413     2e-06  27%  414 aa  CUTS_STRLI RecName: Full=Sensor protein cutS;         EC=2.7.13.3;
  259::413     2e-06  27%  414 aa  CUTS_STRCO RecName: Full=Sensor protein cutS;         EC=2.7.13.3;
  303::469     4e-06  27%  474 aa  CREC_ECOLI RecName: Full=Sensor protein creC;         EC=2.7.13.3;
  256::377     5e-06  32%  410 aa  SENX3_MYCTU RecName: Full=Sensor-like histidine kinase senX3;      
  256::377     5e-06  32%  410 aa  SENX3_MYCBO RecName: Full=Sensor-like histidine kinase senX3;      
  276::447     5e-06  31%  449 aa  QSEC_SALTY RecName: Full=Sensor protein qseC;         EC=2.7.13.3;
  891::987     1e-05  30% 1055 aa  PDHS_OCHA4 RecName: Full=Cell-division control histidine kinase
  871::967     1e-05  32% 1035 aa  PDHS_BRUO2 RecName: Full=Cell-division control histidine kinase
  871::967     2e-05  32% 1035 aa  PDHS_BRUSU RecName: Full=Cell-division control histidine kinase
  871::967     2e-05  32% 1035 aa  PDHS_BRUSI RecName: Full=Cell-division control histidine kinase
  871::967     2e-05  32% 1035 aa  PDHS_BRUME RecName: Full=Cell-division control histidine kinase
  871::967     2e-05  32% 1035 aa  PDHS_BRUC2 RecName: Full=Cell-division control histidine kinase
  871::967     2e-05  32% 1035 aa  PDHS_BRUAB RecName: Full=Cell-division control histidine kinase
  871::967     2e-05  32% 1035 aa  PDHS_BRUA2 RecName: Full=Cell-division control histidine kinase
  871::967     2e-05  32% 1035 aa  PDHS_BRUA1 RecName: Full=Cell-division control histidine kinase
  632::720     4e-05  31%  859 aa  LUXQ_VIBHA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  479::580     6e-05  25%  583 aa  SRRB_STAAW RecName: Full=Sensor protein srrB;       
  479::580     6e-05  25%  583 aa  SRRB_STAAU RecName: Full=Sensor protein srrB;       
  479::580     6e-05  25%  583 aa  SRRB_STAAS RecName: Full=Sensor protein srrB;       
  479::580     6e-05  25%  583 aa  SRRB_STAAR RecName: Full=Sensor protein srrB;       
  479::580     6e-05  25%  583 aa  SRRB_STAAN RecName: Full=Sensor protein srrB;       
  479::580     6e-05  25%  583 aa  SRRB_STAAM RecName: Full=Sensor protein srrB;       
  479::580     6e-05  25%  583 aa  SRRB_STAAC RecName: Full=Sensor protein srrB;       
  479::580     6e-05  25%  583 aa  SRRB_STAA8 RecName: Full=Sensor protein srrB;       
  134::337     6e-05  28%  372 aa  SASA_PROMP RecName: Full=Adaptive-response sensory-kinase sasA;    
  625::726     6e-05  25%  738 aa  KINE_BACSU RecName: Full=Sporulation kinase E;       
    2::69      7e-05  39%  621 aa  MUTL_PETMO RecName: Full=DNA mismatch repair protein mutL;
  280::474     7e-05  24%  522 aa  MPRB_MYCA1 RecName: Full=Signal transduction histidine-protein
  262::452     7e-05  29%  457 aa  CPXA_ECOLI RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  262::452     7e-05  29%  457 aa  CPXA_ECOL6 RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  262::452     7e-05  29%  457 aa  CPXA_ECO57 RecName: Full=Sensor protein cpxA;         EC=2.7.13.3;
  601::707     9e-05  33%  858 aa  LUXQ_VIBPA RecName: Full=Autoinducer 2 sensor kinase/phosphatase
  315::458     1e-04  24%  465 aa  ZRAS_SALTY RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  377::458     2e-04  30%  465 aa  ZRAS_SALTI RecName: Full=Sensor protein zraS;         EC=2.7.13.3;
  134::337     2e-04  28%  372 aa  SASA_PROM2 RecName: Full=Adaptive-response sensory-kinase sasA;    
  280::474     2e-04  23%  522 aa  MPRB_MYCPA RecName: Full=Signal transduction histidine-protein
    1::161     3e-04  26%  428 aa  SYS_SYNE7 RecName: Full=Seryl-tRNA synthetase;       
  440::636     4e-04  24%  656 aa  YCF26_PORPU RecName: Full=Uncharacterized sensor-like histidine
  252::377     4e-04  33%  443 aa  SEX3_MYCLE RecName: Full=Sensor-like histidine kinase senX3;       
  134::337     4e-04  28%  372 aa  SASA_PROMS RecName: Full=Adaptive-response sensory-kinase sasA;    
  134::337     4e-04  28%  372 aa  SASA_PROM9 RecName: Full=Adaptive-response sensory-kinase sasA;    
  134::337     4e-04  28%  372 aa  SASA_PROM0 RecName: Full=Adaptive-response sensory-kinase sasA;    
  277::452     4e-04  24%  492 aa  MPRB_MYCS2 RecName: Full=Signal transduction histidine-protein
  357::426     4e-04  33%  428 aa  KINB_BACSU RecName: Full=Sporulation kinase B;         EC=2.7.13.3;
  251::457     5e-04  31%  777 aa  FRZE_MYXXA RecName: Full=Gliding motility regulatory protein;      
  618::715     6e-04  26%  771 aa  NTRY_AZOC5 RecName: Full=Nitrogen regulation protein ntrY;       
  554::672     8e-04  31%  914 aa  TORS_ECO57 RecName: Full=Sensor protein torS;         EC=2.7.13.3;
   27::82      8e-04  39%  637 aa  MUTL_BEII9 RecName: Full=DNA mismatch repair protein mutL;
    1::1077

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxMLVAAYIADNPNPTRRSNDRAVALQEQQKIVDQELNDVRAGA
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------MLDLRLLRENPEATQARLDRRLSLDQQVRQWEQERTQLQARS
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:210
query           NELGTPSDPLVKERLDIMLDSLEKLNGVREEVTSTRVTMLPAVTKYRQIISTLTDFVETLANATNTSSEL
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       NEIGRSVGQKMREGAD---PQSEEIAALREEGNQLKQQIADLEQQERQVRSELDTYLLTLPNLPDETVPL
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:280
query           RESVRALSALGRARDDQSYEAALMVHSLIRDSMSGGVQDSIESTQxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       GSSEDENREIHRWGDDRIREGEFAPHWEIGERL--GLFDFERSTR-------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:350
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:420
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         .         +         .         .         .         .:490
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLSRRSQSLVERQLRLIEHLEQSEQDEE
QSEC_ECO57      -----------------------------------------------------------------DDPQA
QSEC_ECOLI      -----------------------------------------------------------------DDPQA
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      -------------------------------------------LTKRIESQ-ERLLRMVAHELRTPLTAA
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      -------------------------------------------------------------LPEQEMVEL
CPXA_ECOLI      -------------------------------------------------ALLRRRSGESKELERIETEAQ
CPXA_ECOL6      -------------------------------------------------ALLRRRSGESKELERIETEAQ
CPXA_ECO57      -------------------------------------------------ALLRRRSGESKELERIETEAQ
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      -------------------------------------------LTKRIESQ-ERLLRMVAHELRTPLTAA
MPRB_MYCPA      -------------------------------------------------------------LPEQEMVEL
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     -------------------------------------------------------LETLYEYHDSLDDSQ
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      -------------------------------------------LTKRIESQ-ERLLRMVAHELRTPLTAA
SASA_PROM9      -------------------------------------------LTKRIESQ-ERLLRMVAHELRTPLTAA
SASA_PROM0      -------------------------------------------LTKRIESQ-ERLLRMVAHELRTPLTAA
MPRB_MYCS2      -------------------------------------------------------------LPEDEMAGL
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      -------------------------------------------LFERFSRLGDRFLRLAEEIDISNEVRE
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         *         .         .         .         .         +         .:560
query           RLAELFQLDHLATRMRRNNENLLVLSGQDNTRKWAQPVPLVDVLRAAVSEVEQYARVNVRAPSHVSVLGR
QSEC_ECO57      RKKALLQLHSGIDRATRLVDQLLTLSSLDNLQDVAE-IPLEDLLQSSVMDIAQQAKIDVRLTLNVQGIGQ
QSEC_ECOLI      RKKALLQLHSGIDRATRLVDQLLTLSSLDNLQDVAE-IPLEDLLQSSVMDIAQQAKIDVRLTLNAHSIGQ
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ------------------------------------------VSRHKVAADNSQISITTDAPTGYRVLGD
Y1002_RHIME     ---------------------------------------------------EKGVRLTSRVTRSVGEINA
QSEC_SALTI      ----LTQLHAGIDRATRLVDQLLTLSRLDNNLQDVAEISLEELLQSAVMDIAQQANIDVRLQLNVIRTGQ
CUTS_STRLI      ----------------------------DNQIVERKPVDLAEVAGQAIDQVHAEAEVEVRGTREAAVVQG
CUTS_STRCO      ----------------------------DNQIVERKPVDLAEVAGQAIDQVHAEAEVEVRGTREAAVVQG
CREC_ECOLI      -------------RMQALVETLLRQARLENRQEVVLTAVDVAALFRRVSEARQLAEKKITTPTEVNVAAE
SENX3_MYCTU     --------------------------------------------------------VRTDAPSNLRVLGD
SENX3_MYCBO     --------------------------------------------------------VRTDAPSNLRVLGD
QSEC_SALTY      ----LTQLHAGIDRATRLVDQLLTLSRLDNNLQDVAEISLEELLQSAVMDIAQQANIDVRLQLNVIRTGQ
PDHS_OCHA4      -----------------------------------EAVSLNDAIAEAIALMQPQARVIIRSSSNLPDIVA
PDHS_BRUO2      -----------------------------------EAVSLNDAIGEAIALMQPQARVIIRSSSNLPDIVA
PDHS_BRUSU      -----------------------------------EAVSLNDAIGEAIALMQPQARVIIRSSSNLPDIVA
PDHS_BRUSI      -----------------------------------EAVSLNDAIGEAIALMQPQARVIIRSSSNLPDIVA
PDHS_BRUME      -----------------------------------EAVSLNDAIGEAIALMQPQARVIIRSSSNLPDIVA
PDHS_BRUC2      -----------------------------------EAVSLNDAIGEAIALMQPQARVIIRSSSNLPDIVA
PDHS_BRUAB      -----------------------------------EAVSLNDAIGEAIALMQPQARVIIRSSSNLPDIVA
PDHS_BRUA2      -----------------------------------EAVSLNDAIGEAIALMQPQARVIIRSSSNLPDIVA
PDHS_BRUA1      -----------------------------------EAVSLNDAIGEAIALMQPQARVIIRSSSNLPDIVA
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      TLAKLGQIDKLQDVIKRRLEEIELLS-QDGTTKWEQKIDLGNISAEAILELEKFWRIDTDIPSDLPSVYA
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      -------------------------------------------------------RIKVLNPEVVMKIGE
MPRB_MYCA1      RADVLAQIEELSTLVG----DLVDLTRDDAGQVVHEPVDMSDVIDRSLERVRRR-----RNDIHFDVDVT
CPXA_ECOLI      RLDSM--INDLLVMSRNQQKNALVSETIKANQLWSE------VLDNAAFEAEQMGKVNF-PPGPWPLYGN
CPXA_ECOL6      RLDSM--INDLLVMSRNQQKNALVSETIKANQLWSE------VLDNAAFEAEQMGKVNF-PPGPWPLYGN
CPXA_ECO57      RLDSM--INDLLVMSRNQQKNALVSETIKANQLWSE------VLDNAAFEAEQMGKVNF-PPGPWPLYGN
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      -----------------------------------QTVNLNDIITHSLNLVSQDAQLRFTANETLKRIQA
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      TLAKLGQIDKLQEVIKRRLEEIELLS-QDGTTKWEQKIDLGNISAEVILELEKFWRIDTDIPSDLPSVFA
MPRB_MYCPA      RADVLAQIEELSTLVG----DLVDLTRDDAGQVVHEPVDMSDVIDRSLERVRRR-----RNDIHFDVDVT
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     KLEFLAIANKETGRLTRLVNDVLDLSRLESDQEYTQPTDLVSAVEQTIRTYQLSAK-DKRIDLHIDVLGN
SEX3_MYCLE      ------------------------------------------------------AAIEVRTPSGLRVLGD
SASA_PROMS      TLAKLGQIDKLQEVIKRRLEEIELLS-QDGTTKWEQKIDLGNISAEVILELEKFWRIDTDIPSDLPSVFA
SASA_PROM9      TLAKLGQIDKLQEVIKRRLEEIELLS-QDGTTKWEQKIDLGNISAEAILELEKFWRIDTDIPSDLPSVFA
SASA_PROM0      TLAKLGQIDKLQEVIKRRLEEIELLS-QDGTTKWEQKIDLGNISAEVILELEKFWRIDTDIPSDLPSVFA
MPRB_MYCS2      RADVIAQIEELSTLVG----DLVDLTREDAGGITPEPVDMADVIDRSLERVRR-RRNDIEFD--VDVIGW
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      QLSDLHMLRDDAFRVRRNDDGINTLHGNDHVAE-ARLVPLSTVFDAFPRAVREMSRTQGKEVDLVSMLGD
NTRY_AZOC5      ------------------------------------------------------------------LVSQ
TORS_ECO57      -----------------------------------------------------------------ALMGD
MUTL_BEII9      ----------------------------------------------------------------------


                         .         .         .         *         .         .         .:630
query           PVNDVIHLIAELVENATVFSAHDTQVSVTAQAVDNGDIIIEITDSGIGMSAEELESANQKLAEPPVIDVA
QSEC_ECO57      PXXXXXXXXXXX-DNAVRYSPQGSVVDVTLNA-DN----FIVRDNGPGVTPEALARIGERFYRPPG-QTA
QSEC_ECOLI      PXXXXXXXXXXX-DNAVRYSPQGSVVDVTLNA-DN----FIVRDNGPGVTPEALARIGERFYRPPG-QTA
DIVJ_CAUCR      -------IVLNLVSNALKFTPRGGQVTVTAHGYD-GVLEIVVADTGVGISPEDLERLGRPYEQAGGAEQA
SENX3_MYCS2     E-GLLVTAIANLVSNAIAYSPNGTDVSISRRK-RGGNIEIAVTDRGIGIAKDDQERVFERFFR---VDKA
Y1002_RHIME     DQRAFQQILINLIGNAIKFTDRGGLVTVDA-ALEGNMLKLTVSDTGIGIAADKLQMLGQPFVQ---IQND
QSEC_SALTI      PXXXXXXXXXXX-DNAIRYSPQGSVVDVTLHARS-----FTVRDNGPGVAPEILTHIGERFYRPPGQSVT
CUTS_STRLI      NGVLLERIALNLVQNAVRYNVAGQGWVEVATAVENGQAVLVVTNTGPVVPAYEVDNLFEPFTERTGSDKG
CUTS_STRCO      NGVLLERIALNLVQNAVRYNVAGQGWVEVATAVENGQAVLVVTNTGPVVPAYEVDNLFEPFTERTGSDKG
CREC_ECOLI      PAL-LEQALGNLLDNAIDFTPESGCITLSAE-VDQEHVTLKVLDTGSGIPDYALSRIFERFYSLPRANGQ
SENX3_MYCTU     QTL-LVTALANLVSNAIAYSPRGSLVSISRRR-RGANIEIAVTDRGIGIAPEDQERVFERFFRG---DKA
SENX3_MYCBO     QTL-LVTALANLVSNAIAYSPRGSLVSISRRR-RGANIEIAVTDRGIGIAPEDQERVFERFFRG---DKA
QSEC_SALTY      PXXXXXXXXXXX-DNAIRYSPQGSVVDVTLHARS-----FTVRDNGPGVAPEILTHIGERFYRPPGQSVT
PDHS_OCHA4      DTRSIKQVALNLLSNAVRFTAPGGQVIVSTSYEMNGDVVMRVRDTGIGMTKSEVEQA-------------
PDHS_BRUO2      DSRSIKQVALNLLSNAVRFTAPGRQVIVSTSYELNGDVVMRVRDTGIGMSKSEVEQA-------------
PDHS_BRUSU      DSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYELNGDVVMRVRDTGIGMSKSEVEQA-------------
PDHS_BRUSI      DSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYELNGDVVMRVRDTGIGMSKSEVEQA-------------
PDHS_BRUME      DSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYELNGDVVMRVRDTGIGMSKSEVEQA-------------
PDHS_BRUC2      DSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYELNGDVVMRVRDTGIGMSKSEVEQA-------------
PDHS_BRUAB      DSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYELNGDVVMRVRDTGIGMSKSEVEQA-------------
PDHS_BRUA2      DSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYELNGDVVMRVRDTGIGMSKSEVEQA-------------
PDHS_BRUA1      DSRSIKQVALNLLSNAVRFTAPGGQVIVSTSYELNGDVVMRVRDTGIGMSKSEVEQA-------------
LUXQ_VIBHA      ---------------------------------ENSVLVVELTDTGIGIESDKLD----QMFEPFVQEES
SRRB_STAAW      -------VLTNLIDNASRYTKPGDEIAITCDENESEDILY-IKDTGTGIAPEHLQQVFDRFYK---VDAA
SRRB_STAAU      -------VLTNLIDNASRYTKPGDEIAITCDENESEDILY-IKDTGTGIAPEHLQQVFDRFYK---VDAA
SRRB_STAAS      -------VLTNLIDNASRYTKPGDEIAITCDENESEDILY-IKDTGTGIAPEHLQQVFDRFYK---VDAA
SRRB_STAAR      -------VLTNLIDNASRYTKPGDEIAITCDENESEDILY-IKDTGTGIAPEHLQQVFDRFYK---VDAA
SRRB_STAAN      -------VLTNLIDNASRYTKPGDEIAITCDENESEDILY-IKDTGTGIAPEHLQQVFDRFYK---VDAA
SRRB_STAAM      -------VLTNLIDNASRYTKPGDEIAITCDENESEDILY-IKDTGTGIAPEHLQQVFDRFYK---VDAA
SRRB_STAAC      -------VLTNLIDNASRYTKPGDEIAITCDENESEDILY-IKDTGTGIAPEHLQQVFDRFYK---VDAA
SRRB_STAA8      -------VLTNLIDNASRYTKPGDEIAITCDENESEDILY-IKDTGTGIAPEHLQQVFDRFYK---VDAA
SASA_PROMP      DQRRMRQVFLNLIENALKFSENSGRIKITLIHKTNQWVEITICDKGAGIPSEQKRIFLDRVRLPQTSEGT
KINE_BACSU      --NQLKQVFINILKNAIEVMPDGGNIFVTIKALDQDHVLISLKDEGIGMTEDKL----KRLGEPFYTTKE
MUTL_PETMO      VVSGPSSVVKELVENSLDAQAD----SITVEILDGGKSLIKVDDNGIGMEEEELE---------------
MPRB_MYCA1      PAAGLSRAVLNLLDNAAKWSPPGGHVGVTMRQLDPSHAELVVSDHGPGIPPQERRLVFERFYRSTSARAM
CPXA_ECOLI      P-NALESALENIVRNALRYSHTKIEVGF---AVDKDGITITVDDDGPGVSPEDREQIFRPFYR---TDEA
CPXA_ECOL6      P-NALESALENIVRNALRYSHTKIEVGF---AVDKDGITITVDDDGPGVSPEDREQIFRPFYR---TDEA
CPXA_ECO57      P-NALESALENIVRNALRYSHTKIEVGF---AVDKDGITITVDDDGPGVSPEDREQIFRPFYR---TDEA
LUXQ_VIBPA      -------ILFNLVSNAVKFTPSGC-VRLHAEGADNSVLVVEISDTGIGIESDKLD----EMFEPFVQEEA
ZRAS_SALTY      DPDRLTQVLLNLYLNAIHAIGRQGTISVEAKESGTDRVIITVTDSGKGIAPDQLEA----IFTPYFTTKA
ZRAS_SALTI      ------------------------QGTITVEAKESGTVIITVTDSGKGIAPDQLEA----IFTPYFTTKA
SASA_PROM2      DQRRMRQVLLNLIENAIKFSEDSGSIKITMIHKTNQWVEITICDKGAGIPSEQKRIFLDRVRLPQTSEGT
MPRB_MYCPA      PAAGLSRAVLNLLDNAAKWSPPGGHVGVTMRQLDPSHVELVVSDHGPGIPPQERRLVFERFYRSTSARAM
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     -YNLILQILANLVVNSLKFTVDDLKTETEVQHFNSQKVRVEICDNGIGISRKNQERIFARLRIENYVHTL
SEX3_MYCLE      QTL-LVTALANLVSNAIAYSPGGSLVSISRRR--RGDNIIAVTDRGIGIALEDQERVFERFFRG---DKA
SASA_PROMS      DQRRMRQVFLNLIENAIKFSKDSGSIKITMIHKTNQWVEITICDKGAGIPSEQKRIFLDRVRLPQTSEGT
SASA_PROM9      DQRRMRQVFLNLIENAIKFSKDYGSIKITMIHKTNQWVEITICDKGAGIPLNEQKRILDRVRLPQTSEGT
SASA_PROM0      DQRRMRQVFLNLIENAIKFSRDSGSIKITMIHKTNQWVEITICDKGAGIPSEQKRIFLDRVRLPQTSEGT
MPRB_MYCS2      QVQGLGRAVLNLLDNAAKWSPPGGRVGVRLHQVDHMHAEIVVSDQGPGIPPEERRLVFERFYRSDAARAM
KINB_BACSU      -------------------------------------IMINITDNGVGMTDHQM----QKLGEPYYSLKT
FRZE_MYXXA      VRDALVHLLRNSVDHGVESPDTRQQLGKPLNGVDGDMLHIEVEDDGRGIDPERLRQA------------A
NTRY_AZOC5      ALTNILKNAAEAIEAVPPDVRGQGRIRVSANRVGE-DLVIDIIDNGTGLPQE----SRNRLLEPYVTTRE
TORS_ECO57      P-RRIRQVITNLLSNALRFT--DEGQIVLRSRTDGEQWLVEVEDSGCGIDPAKLAEIFQ-----PFIQVS
MUTL_BEII9      --------VKELVENA--LDAQASEIDVVLEG--GGKTLIRVTDNGCGMSAEDLELSVERHATSKLPD--


                         .         +         .         .         .         .         *:700
query           VSRRMGLFVVSRLANRHGIEVRLRPAHNGGITAAVRLPNDLLITPVEPTPPAxxxxxxxxxxxxxxxxxx
QSEC_ECO57      TGSGLGLSIVQRIAKLHGMNVEFGNAEQGGFEAKV-----------------------------------
QSEC_ECOLI      TGSGLGLSIVQRIAKLHGMNVEFGNAEQGGFEAKV-----------------------------------
DIVJ_CAUCR      RGTGLGLSLVRAFAQLHGGEMVIESRLGAGTTVSVRLP--------------------------------
SENX3_MYCS2     RSRALGLAIVKHVAANHNGSIRLWSQPGTGSTFTLSIP--------------------------------
Y1002_RHIME     YTRRLGLSLVKGLAELHGGDVSIRSAEGEGTVIVVTIPSD------------------------------
QSEC_SALTI      GSG-LGLSIVRRIATLHGMTVSFGNAAEGGFEAVVR----------------------------------
CUTS_STRLI      VG--LGLSIARSVARAHGGHISAQPREGGGLVMRVTLP--------------------------------
CUTS_STRCO      VG--LGLSIARSVARAHGGHISAQPREGGGLVMRVTLP--------------------------------
CREC_ECOLI      KSSGLGLAFVSEVARLFNGEVTLRNVQEGGVLASLRL---------------------------------
SENX3_MYCTU     RSRALGLAIVKHVAANHDGTIRVWSKPGTGSTFTLALP--------------------------------
SENX3_MYCBO     RSRALGLAIVKHVAANHDGTIRVWSKPGTGSTFTLALP--------------------------------
QSEC_SALTY      GSG-LGLSIVRRIATLHGMTVSFGNAAEGGFEAVV-----------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      TTTRLGLTIVKNLVDMLEGDVQVRSSKGGGTTFVITLPRERVLRPLE-----------------------
SRRB_STAAW      RTRGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLP--------------------------------
SRRB_STAAU      RTRGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLP--------------------------------
SRRB_STAAS      RTRGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLP--------------------------------
SRRB_STAAR      RTRGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLP--------------------------------
SRRB_STAAN      RTRGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLP--------------------------------
SRRB_STAAM      RTRGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLP--------------------------------
SRRB_STAAC      RTRGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLP--------------------------------
SRRB_STAA8      RTRGLGLFICKMIIEEHGGSIDVKSELGKGTTFIIKLP--------------------------------
SASA_PROMP      SGFGIGLSVCRRIVEVHG----------------------------------------------------
KINE_BACSU      RGTGLGLMVSYKIIEEHQGEIMVESEEGKGTVFHITLP--------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      PGSGLGLAIVKKVVLNHGGMLRVEDTVPGGQPPGTSF---YVLLPGRPLPPA------------------
CPXA_ECOLI      RDRELGLAIVETAIQQHRGWVKAEDSPLGGLRLVIWLP--------------------------------
CPXA_ECOL6      RDRELGLAIVETAIQQHRGWVKAEDSPLGGLRLVIWLP--------------------------------
CPXA_ECO57      RDRELGLAIVETAIQQHRGWVKAEDSPLGGLRLVIWLP--------------------------------
LUXQ_VIBPA      TTTRLGLTIVKNLVDMLDGDVQVRSQKGQGTTFVVTLP--------------------------------
ZRAS_SALTY      DGTGLGLAVVQNIIEQHGGAIKVKSIEGKGAVFTIWLP--------------------------------
ZRAS_SALTI      DGTGLGLAVVQNIIEQHGGAIKVKSIEGKGAVFTIWLP--------------------------------
SASA_PROM2      SGFGIGLSVCRRIVQVHG----------------------------------------------------
MPRB_MYCPA      PGSGLGLAIVKKVVLNHGGMLRVEDTVPGGQPPGTSF---YVLLPGRSLPPA------------------
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     EGTGLGLSIVKNIIQKHNSEIHL-----------------------------------------------
SEX3_MYCLE      RSRALGLAIVKHVAANHNGSIGVWSKPGTGSTFTLSIP--------------------------------
SASA_PROMS      SGFGIGLSVCRRIVQVHG----------------------------------------------------
SASA_PROM9      SGFGIGLSVCRRIVQVHG----------------------------------------------------
SASA_PROM0      SGFGIGLSVCRRIVQVHG----------------------------------------------------
MPRB_MYCS2      PGSGLGLAIVQQVVLKHGGALRIDETVPGG----------------------------------------
KINB_BACSU      NGTGLGLTVTFSIIEHHHGTISFNSSFQKGTTVTIKLPADL-----------------------------
FRZE_MYXXA      ISKRLNAVQAAALSEREAIELIFRP---------------------------------------------
NTRY_AZOC5      KGTGLGLAIVGKIMEEHGGGIELNDAPEG-----------------------------------------
TORS_ECO57      GKRGLGLTISSRLAQAMGGELSATSTPEVGSCFCLRLPLRVATAPVPKT---------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         .         .         .         +         .         .:770
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:840
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         +         .         .         .         .         *         .:910
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         .         .         +         .         .         .:980
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         *         .         .         .         .         +:1050
query           xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ----------------------------------------------------------------------
QSEC_ECOLI      ----------------------------------------------------------------------
DIVJ_CAUCR      ----------------------------------------------------------------------
SENX3_MYCS2     ----------------------------------------------------------------------
Y1002_RHIME     ----------------------------------------------------------------------
QSEC_SALTI      ----------------------------------------------------------------------
CUTS_STRLI      ----------------------------------------------------------------------
CUTS_STRCO      ----------------------------------------------------------------------
CREC_ECOLI      ----------------------------------------------------------------------
SENX3_MYCTU     ----------------------------------------------------------------------
SENX3_MYCBO     ----------------------------------------------------------------------
QSEC_SALTY      ----------------------------------------------------------------------
PDHS_OCHA4      ----------------------------------------------------------------------
PDHS_BRUO2      ----------------------------------------------------------------------
PDHS_BRUSU      ----------------------------------------------------------------------
PDHS_BRUSI      ----------------------------------------------------------------------
PDHS_BRUME      ----------------------------------------------------------------------
PDHS_BRUC2      ----------------------------------------------------------------------
PDHS_BRUAB      ----------------------------------------------------------------------
PDHS_BRUA2      ----------------------------------------------------------------------
PDHS_BRUA1      ----------------------------------------------------------------------
LUXQ_VIBHA      ----------------------------------------------------------------------
SRRB_STAAW      ----------------------------------------------------------------------
SRRB_STAAU      ----------------------------------------------------------------------
SRRB_STAAS      ----------------------------------------------------------------------
SRRB_STAAR      ----------------------------------------------------------------------
SRRB_STAAN      ----------------------------------------------------------------------
SRRB_STAAM      ----------------------------------------------------------------------
SRRB_STAAC      ----------------------------------------------------------------------
SRRB_STAA8      ----------------------------------------------------------------------
SASA_PROMP      ----------------------------------------------------------------------
KINE_BACSU      ----------------------------------------------------------------------
MUTL_PETMO      ----------------------------------------------------------------------
MPRB_MYCA1      ----------------------------------------------------------------------
CPXA_ECOLI      ----------------------------------------------------------------------
CPXA_ECOL6      ----------------------------------------------------------------------
CPXA_ECO57      ----------------------------------------------------------------------
LUXQ_VIBPA      ----------------------------------------------------------------------
ZRAS_SALTY      ----------------------------------------------------------------------
ZRAS_SALTI      ----------------------------------------------------------------------
SASA_PROM2      ----------------------------------------------------------------------
MPRB_MYCPA      ----------------------------------------------------------------------
SYS_SYNE7       ----------------------------------------------------------------------
YCF26_PORPU     ----------------------------------------------------------------------
SEX3_MYCLE      ----------------------------------------------------------------------
SASA_PROMS      ----------------------------------------------------------------------
SASA_PROM9      ----------------------------------------------------------------------
SASA_PROM0      ----------------------------------------------------------------------
MPRB_MYCS2      ----------------------------------------------------------------------
KINB_BACSU      ----------------------------------------------------------------------
FRZE_MYXXA      ----------------------------------------------------------------------
NTRY_AZOC5      ----------------------------------------------------------------------
TORS_ECO57      ----------------------------------------------------------------------
MUTL_BEII9      ----------------------------------------------------------------------


                         .         .         .         .         *         .         .:1120
query           xxxxxxxxxxxxxxxxxxxxxxxxxxx
QSEC_ECO57      ---------------------------
QSEC_ECOLI      ---------------------------
DIVJ_CAUCR      ---------------------------
SENX3_MYCS2     ---------------------------
Y1002_RHIME     ---------------------------
QSEC_SALTI      ---------------------------
CUTS_STRLI      ---------------------------
CUTS_STRCO      ---------------------------
CREC_ECOLI      ---------------------------
SENX3_MYCTU     ---------------------------
SENX3_MYCBO     ---------------------------
QSEC_SALTY      ---------------------------
PDHS_OCHA4      ---------------------------
PDHS_BRUO2      ---------------------------
PDHS_BRUSU      ---------------------------
PDHS_BRUSI      ---------------------------
PDHS_BRUME      ---------------------------
PDHS_BRUC2      ---------------------------
PDHS_BRUAB      ---------------------------
PDHS_BRUA2      ---------------------------
PDHS_BRUA1      ---------------------------
LUXQ_VIBHA      ---------------------------
SRRB_STAAW      ---------------------------
SRRB_STAAU      ---------------------------
SRRB_STAAS      ---------------------------
SRRB_STAAR      ---------------------------
SRRB_STAAN      ---------------------------
SRRB_STAAM      ---------------------------
SRRB_STAAC      ---------------------------
SRRB_STAA8      ---------------------------
SASA_PROMP      ---------------------------
KINE_BACSU      ---------------------------
MUTL_PETMO      ---------------------------
MPRB_MYCA1      ---------------------------
CPXA_ECOLI      ---------------------------
CPXA_ECOL6      ---------------------------
CPXA_ECO57      ---------------------------
LUXQ_VIBPA      ---------------------------
ZRAS_SALTY      ---------------------------
ZRAS_SALTI      ---------------------------
SASA_PROM2      ---------------------------
MPRB_MYCPA      ---------------------------
SYS_SYNE7       ---------------------------
YCF26_PORPU     ---------------------------
SEX3_MYCLE      ---------------------------
SASA_PROMS      ---------------------------
SASA_PROM9      ---------------------------
SASA_PROM0      ---------------------------
MPRB_MYCS2      ---------------------------
KINB_BACSU      ---------------------------
FRZE_MYXXA      ---------------------------
NTRY_AZOC5      ---------------------------
TORS_ECO57      ---------------------------
MUTL_BEII9      ---------------------------