[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55004.1

[Show Plain Result]


## Summary of Sequence Search
    1::219
    7::220     1e-43  43%  221 aa  MDMC_STRMY RecName: Full=O-methyltransferase mdmC;       
   23::226     2e-35  40%  231 aa  CAMT2_DICDI RecName: Full=Probable caffeoyl-CoA O-methyltransferase
   22::228     3e-35  38%  230 aa  CAMT1_DICDI RecName: Full=Probable caffeoyl-CoA O-methyltransferase
   61::244     1e-32  42%  249 aa  CAMT_EUCGU RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   61::244     1e-32  42%  246 aa  CAMT1_EUCGL RecName: Full=Caffeoyl-CoA O-methyltransferase 1;      
   78::262     9e-32  42%  264 aa  CAMT2_MAIZE RecName: Full=Caffeoyl-CoA O-methyltransferase 2;      
   56::240     3e-31  40%  242 aa  CAMT_VITVI RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   55::239     3e-31  41%  241 aa  CAMT_PETCR RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   61::245     3e-31  41%  247 aa  CAMT2_EUCGL RecName: Full=Caffeoyl-CoA O-methyltransferase 2;      
   61::245     5e-31  41%  247 aa  CAMT6_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 6;      
   89::259     6e-31  40%  262 aa  CMTD1_HUMAN RecName: Full=Catechol-O-methyltransferase
   61::245     1e-30  39%  247 aa  CAMT_POPTM RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   61::245     1e-30  39%  247 aa  CAMT1_POPTR RecName: Full=Caffeoyl-CoA O-methyltransferase 1;      
   54::238     1e-30  39%  240 aa  CAMT5_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 5;      
   56::240     2e-30  39%  242 aa  CAMT_SOLTU RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   73::257     3e-30  39%  259 aa  CAMT4_ARATH RecName: Full=Probable caffeoyl-CoA O-methyltransferase
   61::245     5e-30  39%  247 aa  CAMT2_POPTR RecName: Full=Caffeoyl-CoA O-methyltransferase 2;      
   68::252     7e-30  42%  254 aa  CAMT_MESCR RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   56::240     7e-30  38%  242 aa  CAMT4_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 4;      
   53::237     7e-30  38%  239 aa  CAMT1_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 1;      
   56::240     9e-30  39%  242 aa  CAMT2_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 2;      
   56::240     1e-29  38%  242 aa  CAMT3_TOBAC RecName: Full=Caffeoyl-CoA O-methyltransferase 3;      
   61::245     3e-29  38%  247 aa  CAMT_MEDSA RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   89::259     3e-29  40%  262 aa  CMTD1_MOUSE RecName: Full=Catechol-O-methyltransferase
   46::230     1e-28  37%  232 aa  CAMT_CITNA RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   31::233     2e-28  37%  235 aa  CAMT_POPKI RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   73::257     4e-28  39%  259 aa  CAMT_PINTA RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   31::230     2e-27  35%  232 aa  CAMT1_ARATH RecName: Full=Putative caffeoyl-CoA O-methyltransferase
   72::256     2e-27  39%  258 aa  CAMT1_MAIZE RecName: Full=Caffeoyl-CoA O-methyltransferase 1;      
   12::230     4e-26  34%  232 aa  CAMT3_ARATH RecName: Full=Probable caffeoyl-CoA O-methyltransferase
   59::243     6e-26  38%  245 aa  CAMT_ZINEL RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   31::231     5e-24  31%  233 aa  CAMT2_ARATH RecName: Full=Probable caffeoyl-CoA O-methyltransferase
   21::239     9e-22  31%  241 aa  CAMT_STELP RecName: Full=Caffeoyl-CoA O-methyltransferase;       
   30::225     2e-20  34%  226 aa  Y4497_MYCVP RecName: Full=Putative O-methyltransferase Mvan_4497;  
   30::225     3e-20  34%  226 aa  Y2199_MYCGI RecName: Full=Putative O-methyltransferase Mflv_2199;  
   15::223     5e-20  32%  224 aa  Y4520_MYCUA RecName: Full=Putative O-methyltransferase MUL_4520;   
   22::209     3e-18  33%  210 aa  Y5073_MYCS2 RecName: Full=Putative O-methyltransferase MSMEG_5073; 
   18::219     3e-18  31%  220 aa  Y4069_MYCSK RecName: Full=Putative O-methyltransferase Mkms_4069;  
   18::219     3e-18  31%  220 aa  Y3995_MYCSS RecName: Full=Putative O-methyltransferase Mmcs_3995;  
   15::223     6e-17  29%  224 aa  Y4217_MYCMM RecName: Full=Putative O-methyltransferase MMAR_4217;  
   27::214     1e-16  31%  215 aa  Y1361_MYCA9 RecName: Full=Putative O-methyltransferase MAB_1361c;  
   42::214     3e-16  31%  215 aa  Y1280_MYCBP RecName: Full=Putative O-methyltransferase BCG_1280c;  
   42::214     3e-16  31%  215 aa  Y1252_MYCBO RecName: Full=Putative O-methyltransferase Mb1252c;    
   42::214     3e-16  31%  215 aa  Y1229_MYCTA RecName: Full=Putative O-methyltransferase MRA_1229;   
   42::214     3e-16  31%  215 aa  Y1220_MYCTU RecName: Full=Putative O-methyltransferase
   18::192     9e-14  30%  220 aa  Y4009_MYCSJ RecName: Full=Putative O-methyltransferase Mjls_4009;  
   56::216     2e-12  28%  217 aa  YRRM_BACSU RecName: Full=Putative O-methyltransferase yrrM;        
   36::223     2e-12  28%  224 aa  Y1075_MYCLE RecName: Full=Putative O-methyltransferase ML1075;     
   36::223     2e-12  28%  224 aa  Y1075_MYCLB RecName: Full=Putative O-methyltransferase MLBr01075;  
   87::218     3e-12  31%  269 aa  COMT_HORSE RecName: Full=Catechol O-methyltransferase;       
   69::221     5e-12  30%  222 aa  Y1364_MYCA1 RecName: Full=Putative O-methyltransferase MAV_1364;   
   69::221     6e-12  30%  222 aa  Y2558_MYCPA RecName: Full=Putative O-methyltransferase MAP_2558;   
   83::214     4e-10  27%  265 aa  COMT_MOUSE RecName: Full=Catechol O-methyltransferase;       
   90::221     2e-09  28%  271 aa  COMT_HUMAN RecName: Full=Catechol O-methyltransferase;       
   83::214     8e-09  26%  264 aa  COMT_RAT RecName: Full=Catechol O-methyltransferase;       
    5::136     8e-09  28%  186 aa  COMT_PIG RecName: Full=Catechol O-methyltransferase;       
   84::245     3e-08  29%  291 aa  TOMT_HUMAN RecName: Full=Transmembrane O-methyltransferase;        
  113::222     1e-07  30%  272 aa  COMT_BOVIN RecName: Full=Catechol O-methyltransferase;       
   29::213     1e-07  27%  281 aa  COMT2_SCHPO RecName: Full=Probable catechol O-methyltransferase 2; 
   84::245     3e-07  29%  291 aa  TOMT_PANTR RecName: Full=Transmembrane O-methyltransferase;        
   43::194     5e-07  27%  266 aa  COMT1_SCHPO RecName: Full=Probable catechol O-methyltransferase 1; 
   67::228     1e-06  27%  274 aa  TOMT_PROVC RecName: Full=Transmembrane O-methyltransferase;        
   89::250     1e-06  27%  296 aa  TOMT_MACMU RecName: Full=Transmembrane O-methyltransferase;        
   51::212     2e-06  28%  258 aa  TOMT_MOUSE RecName: Full=Transmembrane O-methyltransferase;        
   51::212     4e-06  28%  258 aa  TOMT_RAT RecName: Full=Transmembrane O-methyltransferase;       
   57::173     7e-06  30%  417 aa  Y1184_SYNP6 RecName: Full=Uncharacterized protein syc1184_c;
   46::204     9e-06  29%  241 aa  PIMT_HYPBU RecName: Full=Protein-L-isoaspartate
  153::277     1e-05  30%  292 aa  PRMA_RHILW RecName: Full=Ribosomal protein L11 methyltransferase;  
  153::261     2e-05  28%  291 aa  PRMA_RHISN RecName: Full=Ribosomal protein L11 methyltransferase;  
  153::277     3e-05  29%  292 aa  PRMA_RHIL3 RecName: Full=Ribosomal protein L11 methyltransferase;  
   65::176     3e-05  26%  220 aa  PIMT_THEON RecName: Full=Protein-L-isoaspartate
  154::277     4e-05  29%  292 aa  PRMA_RHIEC RecName: Full=Ribosomal protein L11 methyltransferase;  
  175::273     6e-05  34%  306 aa  PRMA_GEOSM RecName: Full=Ribosomal protein L11 methyltransferase;  
  154::277     2e-04  28%  292 aa  PRMA_RHIE6 RecName: Full=Ribosomal protein L11 methyltransferase;  
   28::170     3e-04  26%  207 aa  PIMT_PYRCJ RecName: Full=Protein-L-isoaspartate
   44::144     4e-04  30%  195 aa  CBIT_PYRCJ RecName: Full=Probable cobalt-precorrin-6Y
  199::277     6e-04  35%  307 aa  PRMA_PELCD RecName: Full=Ribosomal protein L11 methyltransferase;  
  175::273     8e-04  32%  306 aa  PRMA_GEOBB RecName: Full=Ribosomal protein L11 methyltransferase;  
  153::261     8e-04  25%  292 aa  PRMA_AGRT5 RecName: Full=Ribosomal protein L11 methyltransferase;  
    1::219

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xTRTSENLSPELHAYLVAHSTPVDEVLTDLAAETERLFPDHVGMQIAPEQGLFLTLLTQLIGARNIVEVG
MDMC_STRMY      -------LSPALLDYARSVALREDGLLRELHDMTAQL-PGGRAMQIMPEEAQFLGLLIRLVGARRVLEIG
CAMT2_DICDI     --------------YAIDHSDQLTDIQKELIQFTKENIERHI-MLTQAEQCSFFKLLIQVLNAKKTIDIG
CAMT1_DICDI     --------------YAIDHSDQLTDIQKELIQFTKENIERHI-MLTQAEQCSFFKLLIQVLNAKKTIDIG
CAMT_EUCGU      -------------------------------------------MTTSADEGQFLNMLLKLINAKNTMEIG
CAMT1_EUCGL     -------------------------------------------MTTSADEGQFLNMLLKLINAKNTMEIG
CAMT2_MAIZE     -------------------------------------------MTTSADEGQFLNMLIKLIGAKKTMEIG
CAMT_VITVI      -------------------------------------------MTTSADEGQFLNMLLKLINAKNTMEIG
CAMT_PETCR      -------------------------------------------MTTSADEGQFLNMLLKLINAKNTMEIG
CAMT2_EUCGL     -------------------------------------------MTTSADEGQFLNMLLKLINAKNTMEIG
CAMT6_TOBAC     -------------------------------------------MTTSADEGQFLSMLLKLIIAKNTMEIG
CMTD1_HUMAN     ------------------------------------------------EQAQLLANLARLIQAKKALDLG
CAMT_POPTM      -------------------------------------------MTTSADEGQFLNMLLKLVNAKNTMEIG
CAMT1_POPTR     -------------------------------------------MTTSADEGQFLNMLLKLVNAKNTMEIG
CAMT5_TOBAC     -------------------------------------------MTTSADEGQFLNMLLKLINAKNTMEIG
CAMT_SOLTU      -------------------------------------------MTTSADEGQFLNMLLKLINAKNTMEIG
CAMT4_ARATH     -------------------------------------------MTTSADEGQFLNMLIKLVNAKNTMEIG
CAMT2_POPTR     -------------------------------------------MTTSADEGQFLNMLLKLINAKNTMEIG
CAMT_MESCR      -------------------------------------------MTTSADEGQFLNMLLKLINAKNTIEIG
CAMT4_TOBAC     -------------------------------------------MTTSADEGQFLSMLIKLINAKNTMEIG
CAMT1_TOBAC     -------------------------------------------MTTSADEGQFLSMLIKLINAKNTMEIG
CAMT2_TOBAC     -------------------------------------------MTTSADEGQFLSMLLKLINAKNTMEIG
CAMT3_TOBAC     -------------------------------------------MTTSADEGQFLSMLLKLINAKNTMEIG
CAMT_MEDSA      -------------------------------------------MTTSADEGQFLSMLLKLINAKNTMEIG
CMTD1_MOUSE     ------------------------------------------------EQAQLLANLARLIKAKKALDLG
CAMT_CITNA      -------------------------------------------MRTSADEGQFLNMSLKLINAKNTMEIG
CAMT_POPKI      ------------------------EQLKELREATTKKYGSLSGMSVPVDEGRFLSMLLKLMNAKRTLEVG
CAMT_PINTA      -------------------------------------------MTTSADEGQFLGLLLKLINAKNTMEIG
CAMT1_ARATH     ------------------------ELLKELRKATVQKYGNLSEMEVPVDEGHFLSMLVKIMNAKNTIEIG
CAMT1_MAIZE     -------------------------------------------MTTSADEGQFLNMLIKLIGAKKTMEIG
CAMT3_ARATH     --------SEELYKYILETSVYPRE--PEVLRELRNITHNHAGMATAPDAGQLMGMLLNLVNARKTIEVG
CAMT_ZINEL      -------------------------------------------MTTSADEGQFXXXXXXXXXXXXTMEIG
CAMT2_ARATH     ------------------------ELLKELREATIQRYGNLSEMGVPVDESLFLSMLVKIINAKNTIEIG
CAMT_STELP      --------SEQLHQYILDTSVRESEHLKELRKATESHPMSFMGT--SPLAGQLLSFMLKTVKPKKTIEVG
Y4497_MYCVP     ------------------HSISEDAIV---AAARERAVDIGAGA-VSPAVGALLCVLAKLTGARAVVEVG
Y2199_MYCGI     ------------------HSISEDAIV---AAARERAVDIGAGA-VTPAVGALLCVLAKLTGAKAVVEVG
Y4520_MYCUA     --------APSRAELLSAHAEGSISEDTILKTARDRAVDIGVGA-VTPAVGALLSMLAKLSGGKAVAEVG
Y5073_MYCS2     -----------------------------VAAARERA--DDIGAAVTPAVGALLSVLARLTGGRAVVEVG
Y4069_MYCSK     ---------------IVAHAEQSISEDAIVAAARERAVDMGAGA-VTPAVGALLSVLARLTEAKAVVEVG
Y3995_MYCSS     ---------------IVAHAEQSISEDAIVAAARERAVDMGAGA-VTPAVGALLSVLARLTEAKAVVEVG
Y4217_MYCMM     --------APSRAELLSAHAEGSISEDTILKTARDRAVDIGVGA-VTPAVGALLSMLAKLSGGKAVAEVG
Y1361_MYCA9     -----------------------------VAAARERAVDLGAG-PVTPAVGALLSVFARLSGGKAVVEVG
Y1280_MYCBP     ---------------------------------------------VTPAVGALLCLLAKLSGGKAVAEVG
Y1252_MYCBO     ---------------------------------------------VTPAVGALLCLLAKLSGGKAVAEVG
Y1229_MYCTA     ---------------------------------------------VTPAVGALLCLLAKLSGGKAVAEVG
Y1220_MYCTU     ---------------------------------------------VTPAVGALLCLLAKLSGGKAVAEVG
Y4009_MYCSJ     ---------------IVAHAEQSISEDAIVAAARERAVDIGAGA-VTPAVGALLSVLARLTEAKAVVEVG
YRRM_BACSU      ---------------------------------------------------------------KKILEIG
Y1075_MYCLE     -----------------------------LASARER--SEEIGARVTPAVGXXXXXXXXXXXXXXVAEVG
Y1075_MYCLB     -----------------------------LASARER--SEEIGARVTPAVGXXXXXXXXXXXXXXVAEVG
COMT_HORSE      -------------------------------------------MNVGDKKGQFLDAVVQEQQPSVLLELG
Y1364_MYCA1     -----------------------------------------------------------------IAEVG
Y2558_MYCPA     -----------------------------------------------------------------IAEVG
COMT_MOUSE      -------------------------------------------MNVGDAKGQIMDAVIREYRPSLVLELG
COMT_HUMAN      -------------------------------------------MNVGDKKGKIVDAVIQEHQPSVLLELG
COMT_RAT        -------------------------------------------MNVGDAKGQIMDAVIREYSPSLVLELG
COMT_PIG        -------------------------------------------MHVGRKKGQIVDTVVQEQRPSVLLELG
TOMT_HUMAN      -------------SYVLTHALPGDHILTTLDHWSSRCYLSHMG----PVKGQILMRLVEEKAPACVLELG
COMT_BOVIN      -----------------------------------------------------------------LLELG
COMT2_SCHPO     -TKTKKSKEQELENYIFSRGKP-DEVINVIDEYVEQ---GHFLMNIGKLKGKIISEKIQQVKPKVMIELG
TOMT_PANTR      -------------SYVLTHALPGDHILTTLDHWSSCCYLSHMG----PVKGQILMRLVEEKAPACVLELG
COMT1_SCHPO     ----------------------------------EFTYPDGSGVRIGDVKGGFIVGKIRERKPKIMVELG
TOMT_PROVC      -------------SYVLTHALPGDHILTTLDHWSSHCYLSHMG----PVKGQILMRLVEEKAPACVLELG
TOMT_MACMU      -------------SYVLTHALPGDHILTTLDHWSSHCYLSHMG----PVKGQILMRLVEEKAPACVLELG
TOMT_MOUSE      -------------SYVLTHALPGDHILTTLDHWSSCCYLSHMG----PVKGQILMRLVEEKAPACVLELG
TOMT_RAT        -------------SYVITHALPGDHILTTLDHWSSCCYLSHMG----PIKGQILMRLVEEKAPACVLELG
Y1184_SYNP6     -----------------------------------------------PSAYAFCTGRAPQLGRPRILDAG
PIMT_HYPBU      ----------------------VPDELRHLAYEDTPLPIGHGQTISAPHMVAMMTEYADLKPGMKVLEVG
PRMA_RHILW      ---------------------------------------------------------------RNALDLG
PRMA_RHISN      ---------------------------------------------------------------RNVLDLG
PRMA_RHIL3      ---------------------------------------------------------------RNALDLG
PIMT_THEON      ----------------------------------------------APHMVAIMLELAELEEGMNVLDIG
PRMA_RHIEC      ----------------------------------------------------------------NALDLG
PRMA_GEOSM      -----------------------------------------------------------------VLDVG
PRMA_RHIE6      ----------------------------------------------------------------NALDLG
PIMT_PYRCJ      ---------------------PREEFVTPMMAYEDRPLPLFAGATIAPHMVAMMCELIEPRPGMKILEVG
CBIT_PYRCJ      -----------------------------------------------------------------LVDVG
PRMA_PELCD      ----------------------------------------------------------------------
PRMA_GEOBB      -----------------------------------------------------------------VLDVG
PRMA_AGRT5      ---------------------------------------------------------------RNALDLG


                         .         .         *         .         .         .         .:140
query           TFTGYSSICLARGLPNDGTLLACDVSEEWTAVARRYWQRAGVADRIDLRLAPALDTLRALPEEPQFDLAF
MDMC_STRMY      TFTGYSTLCMARALPAGGRIVTCDISDKWPGIGAPFWQRAGVDGLIDLRIGDAARTLAELREDGAFDLVF
CAMT2_DICDI     VFTGLSSLTAALAMGDEGRVVACDVSTEYTQHALKFWAKAGVDHKINLKIQPASKTLQELGEENTYDFVF
CAMT1_DICDI     VFTGLSSLTAALAMGDEGRVVACDVSTDYTQHALKFWAKAGVDHKINLKIQPASKTLQELGEENTYDFVF
CAMT_EUCGU      VFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAGVADKIDFREGPALPILDQLIEDGKFDFIF
CAMT1_EUCGL     VFTGYSLLATALALPDDGKILAMDINRENYELGLPVIQKAGVADKIDFREGPALPILDQLIEDGKFDFIF
CAMT2_MAIZE     VYTGYSLLATALALPEDGTILAMDINRENYELGLPCINKAGVGHKIDFREGPALPVLDDLVADKEFDFAF
CAMT_VITVI      VYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKFDFIF
CAMT_PETCR      VYTGYSLLATALALPDDGKILAMDINRENYEIGLPIIEKAGVGHKIDFREGPALPVLDHMLEDGKFDFVF
CAMT2_EUCGL     VYTGYSLLATALALPDDGKILAMDINRENFEIGLPVIEKAGLAHKIDFREGPALPLLDQLVQDEKYDFIF
CAMT6_TOBAC     VYTGYSLLATALALPDDGKILAMDINKENYELGLPVIQKAGVAHKIDFREGPALPVLDLMIEDKNYDFIF
CMTD1_HUMAN     TFTGYSXXXXXXXXPADGRVVTCEVDAQPPELGRPLWRQAEAEHKIDLRLKPALETLDELGEAGTFDVAV
CAMT_POPTM      VYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKFDFIF
CAMT1_POPTR     VYTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGVAHKIDFKEGPALPVLDQMIEDGKFDFIF
CAMT5_TOBAC     VYTGYSLLATALAIPDDGKILAMDINRENYEIGLPIIEKAGVAHKIEFREGPALPVLDQLVEDKKYDFIF
CAMT_SOLTU      VFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKAGLAHKIDFREGPALPVLDQMIEDGKYDFIF
CAMT4_ARATH     VYTGYSLLATALALPEDGKILAMDVNRENYELGLPIIEKAGVAHKIDFREGPALPVLDEIVADEKYDFIF
CAMT2_POPTR     VFTGYSLLATALAIPEDGKILAMDINRENYELGLPVIQKAGLEHKIEFKEGPALPVLDQMIEDGKYDFIF
CAMT_MESCR      VYTGYXXXXXXXXXPDDGKILAMDINRENYELGLPVIQKAGVAHKIDFREGPALPVLDLLIEDAKFDFAF
CAMT4_TOBAC     VFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKAGLAHKIEFKEGPALPVLDQMIEDGKYDFIF
CAMT1_TOBAC     VFTGYSLLATAMALPDDGKILAMDINRENYEIGLPVIEKAGLAHKIEFKEGPALPVLDQMIEDGKYDFIF
CAMT2_TOBAC     VFTGYSLLATAMALPDDGKILAMDINRENYEIGLPIIEKAGLAHKIVFREGPALPVLDQMIEDGKYDFIF
CAMT3_TOBAC     VFTGYSLLATAMALPDDGKILAMDINRDNYEIGLPVIEKAGLAHKIEFKEGPALPVLDQMIEDGKYDFIF
CAMT_MEDSA      VYTGYSLLATALAIPEDGKILAMDINKENYELGLPVIKKAGVDHKIDFREGPALPVLDEMIKDEKYDFIF
CMTD1_MOUSE     TFTGYSXXXXXXXXPEAGRVVTCEVDAEPPKLGRPMWKQAEVEQKIDLRLQPALQTLDELGEAGTFDIAV
CAMT_CITNA      VYTDYSLLATALAIPDDGKILAMDINRENYEIGLPKIEKAGVAHRIQFREGPALPVLDQLVEDKKYDFIF
CAMT_POPKI      VFTGYSLLSTALALPEDGQVTAIDKDRGAYEIGLPFIQKAGVEDKINFEAPPILNEMLCNDKQPEFDFAF
CAMT_PINTA      VYTGYSLLSTALALPDDGKILAMDINRENYDIGLPIIEKAGVAHKIDFREGPALPVLDELLKNESFDFVF
CAMT1_ARATH     VFTGYSLLTTALALPEDGRITAIDIDKEAYEVGLEFIKKAGVDHKINFIHSDGLKALDQLVNDKEFDFAF
CAMT1_MAIZE     VYTGYSLLATALALPEDGTILAMDINRENYELGLPCIEKAGVAHKIDFREGPALPVLDDLIAEEKFDFVF
CAMT3_ARATH     VFTGYSLLLTALTLPEDGKVIAIDMNRDSYEIGLPVIKKAGVEHKIDFKESEALPALDELVNEGGFDFAF
CAMT_ZINEL      VYTGYSLLSTALALPEDGKILALDINRENYEIGLPIIQKAGVAHKIDFREGPALPLLDQMLQDEKFDFIF
CAMT2_ARATH     VFTGYSLFTVALALPEDGRITAIDIDQAGYNLGLEFMKKAGVDHKINFIQSDAVRGLDQLGEKQEYDFAF
CAMT_STELP      VFTGYSLLATALSIPDDGKITAVDIDREAYNVGLALIKKAGVESKISFIVSXXXXXXXXXXXQGSYDFAF
Y4497_MYCVP     TGAGVSGLWLLSGMREDGVLTTIDVEPEHQRIAKQAFSEAGVGGRTRLISGRAQEVLTRLADE-SYDLVF
Y2199_MYCGI     TGAGVSGLWLLSGMREDGVLTTIDVEPEHQRIAKQAFSEAGVGGRTRLISGRAQEVLTRLADE-SYDLVF
Y4520_MYCUA     TGAGVSGLWLLSGMSDDGVLTTIDIEPEHLRVAKQAFTEAGIGSRTRLISGRAQEVLTRLADD-SYDLVF
Y5073_MYCS2     TGAGVSGLWLLSGMRDDGVLTTIDVEPEHQRIAKQGFSEAGVGGRTRLISGRAQEVLTRLADE-SYDLVF
Y4069_MYCSK     TGAGVSGLWLLSGMREDGVLTTIDVEPEHQRIAKQAFTEAGIGGRTRLISGRAQDVLTRLADE-SYDLVF
Y3995_MYCSS     TGAGVSGLWLLSGMREDGVLTTIDVEPEHQRIAKQAFTEAGIGGRTRLISGRAQDVLTRLADE-SYDLVF
Y4217_MYCMM     TGAGVSGLWLLSGMSDDGVLTTIDIEPEHLRVAKQAFTEAGIGSRTRLISGRAQEVLTRLADD-SYDLVF
Y1361_MYCA9     TGAGVSGLWLLSGMREDGVLTTIDVEPEHQRSAKQAFSEASIASRTRLIGGRAQEVLPRLADE-SYDLLV
Y1280_MYCBP     TGAGVSGLWLLSGMRDDGVLTTIDIEPEHLRLARQAFAEAGIGSRTRLISGRAQEVLTRL-ADASYDLVF
Y1252_MYCBO     TGAGVSGLWLLSGMRDDGVLTTIDIEPEHLRLARQAFAEAGIGSRTRLISGRAQEVLTRL-ADASYDLVF
Y1229_MYCTA     TGAGVSGLWLLSGMRDDGVLTTIDIEPEHLRLARQAFAEAGIGSRTRLISGRAQEVLTRL-ADASYDLVF
Y1220_MYCTU     TGAGVSGLWLLSGMRDDGVLTTIDIEPEHLRLARQAFAEAGIGSRTRLISGRAQEVLTRL-ADASYDLVF
Y4009_MYCSJ     TGAGVSGLWLLSGMREDGVLTTIDVEPEHQRIAKQAFIEAGIGSRTRLISGRAQEVLTRLADE-SYDLVF
YRRM_BACSU      TAIGYSAIRMALELPS-AEIYTIERNEKRHEEAVNNIKEFQLDDRIHVFYGDALELADAVHVTAPYDVIF
Y1075_MYCLE     TGAGVSGLWLLSGMSYDGVLTTIDIEPEYLRLAKQAFSEAGIGSRTRLISGRGQDVLTRLADE-SYDLVF
Y1075_MYCLB     TGAGVSGLWLLSGMSYDGVLTTIDIEPEYLRLAKQAFSEAGIGSRTRLISGRGQDVLTRLADE-SYDLVF
COMT_HORSE      AYCGYSAVRMARLLPPGARLLTIEINPDYAAITQRMLDFAGLQDRVTVVLGASQDIIPQLKKKDTLDVVF
Y1364_MYCA1     TGAGVSGLWLLSGMSDDGVLTTIDIEPEYLRLAKQAFAEAGIGSRTRLIGGRAQEVLTRLADE-SYDLVF
Y2558_MYCPA     TGAGVSGLWLLSGMSDDGVLTTIDIEPEYLRLAKQAFAEAGIGSRTRLIGGRAQEVLTRLADE-YYDLVF
COMT_MOUSE      AYCGYSAVRMARLLPPGARLLTMEINPDYAAITQQMLDFAGLQDKVSILIGAPQDLIPQLKKKDTLDMVF
COMT_HUMAN      AYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKDTLDMVF
COMT_RAT        AYCGYSAVRMARLLQPGARLLTMEMNPDYAAITQQMLNFAGLQDKVTILNGASQDLIPQLKKKDTLDMVF
COMT_PIG        AYCGYSAVRMARLLLPSARLLTIELNPDNAAIAQQVVDFAGLQDRVTVVVGASQDIIPQLKKKDTLDMVF
TOMT_HUMAN      TYCGYSTLLIARALPPGGRLLTVERDPRTAAVAEKLIRLAGFDEHVELIVGSSEDVIPCLRTQYQLDLVL
COMT_BOVIN      AYCGYSAVRMARLLLPGARLLTIEFNPDYAAITQRMVEFAGLQDKVTVVLGASQDIIPQLKKKDTLDMVF
COMT2_SCHPO     GYVGYSAILFGKQLTDPSAYYSLEVNPKFAKIASKIIDLAGLSNKVTIIVGKATDSLRSLPNVPSFDFVF
TOMT_PANTR      TYCGYSTLLIARALPPGGRLLTVERDPRTAAVAEKLIRLAGFDEHVELIVGSSEDVIPCLRTQYQLDLVL
COMT1_SCHPO     GYLGYSAILFGNEISKGGRYYSLEVNEDYAKIAYELVKLAGLDEIVTIMIGKACDSLVELQQKQALDMVF
TOMT_PROVC      TYCGYSTLLIAQALPPGGRLLTVERDPRTAAVAEKLIRLAGFDEHVELIVGSSEEVIPCLRTQYQLDLVL
TOMT_MACMU      TYCGYSTLLIAQALPPGGRLLTVERDPRTAAVAEKLIRLAGFDEHVELIVGSSEEVIPCLRTQYQLDLVL
TOMT_MOUSE      TYCGYSTLLIARALPPGSRLLTVERDSRTAAVAEKVIRLAGFDEQMVELIAEVIPRLRAQHQLNRADLVL
TOMT_RAT        THCGYSTLLIARALPPGSRLLTVERDSRTAAVAEKVIRLAGFDEQMVELIAEVIPRLRAQHQLNRADLVL
Y1184_SYNP6     CGTGVSTDYLAHLNPS-AEITAIDISAGTLAVAQERCQRSGVADRIHFQQLSLYDVAQLPGEFDQINCVG
PIMT_HYPBU      AGSGYHAAVMAEVVPSDGHVYTIERIPELAEFARRNLERAGYADRVTVIVG---DGSRGYPEKAPYDRII
PRMA_RHILW      TGSGVLAIAV-RKLKNI-PVLATDIDPIATRVAAENVRRNGIASGIVTRTAPGFHS-TAFSEHGPFDLII
PRMA_RHISN      TGSGVLAIAAWKLLHVPG--LATDIDPVATRVASDNARRNGVVDGLTFATAPGFHST-AFGTHGPFDLVI
PRMA_RHIL3      TGSGVLAIAVRRNIP----VLATDIDPIATKVAAENVRRNGIASGIVTRTAPGFHS-TAFSEHGPFDLII
PIMT_THEON      TGSGWNAALAAELVKTD--VYTVERIPELVEFARKNLEKAGYADRVHVIIG---DGTKGFPPKAPYDRIL
PRMA_RHIEC      TGSGVLAIAV-RKLKNM-PVLATDIDPIATRVAAENVRRNGIASGIVTRTAPGFHS-TAFSEHGPFDLII
PRMA_GEOSM      TGSGVLSIAAA--LLGAEEIVAVDIDPEAVRVTVENLELNGMADRV----APSTTSLEQLPGGFQVVVAN
PRMA_RHIE6      TGSGVLAIAV-RKLKNI-PVLATDIDPIATRVAAENVRRNGIASGIVTRTAPGFHS-TAFSEHGPFDLII
PIMT_PYRCJ      TGSGYHAAVCAEAIERQGKVYTVEIVRELAIFAAQNLERLGYLGVVEVYRG---DGRRGLERHAPFDAVL
CBIT_PYRCJ      CGTGSVSVEAALIMGEGSRVYAVDYDEEALMLTKRNAEKFGVADRVVLVRGKAPEVLAELPKADRY---F
PRMA_PELCD      ----------------------CDIDETACQVALDNARQNGVIEQI----AVTLDPLETLGGDFDVVLAN
PRMA_GEOBB      TGSGVLSIAAA--LLGAKEIVAVDIDPEAVRVTMENLELNGVADLV----AASTTSLEQLPGGFRVVVAN
PRMA_AGRT5      TGSGVLAIAVRKMRPIP--VLATDIDPIAVKVAKENVRLNGIVSGMALETAPGFHS-DAFRKHGPFDLII


                         +         .         .         .         .         *         .:210
query           IDADKESYIAYWEELVPRVRPGGVLLADNVFSHSRVLDPAQTAARVQAIRDFNVHARDDTRVDLVILPIG
MDMC_STRMY      VDADKAGYLHYYEQALALVRPGGLVAIDNTLFFGXXXXXXXXXXXXXXXXXLNDLLRDDERVDIALLTVA
CAMT2_DICDI     IDADKTGYDTYYELSLKLIRKGGIIAIDNVLQHGRVADPANVEPNLVAIRALNDKILADKRVTKSLLPIA
CAMT1_DICDI     IDADKTGYDTYYELSLKLIRKGGIIAIDNVLQHGRVADPANVEPNLVAIRALNDKILADKRVTKTMLPIA
CAMT_EUCGU      VDADKDNYLNYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAADPRIEICMLPVG
CAMT1_EUCGL     VDADKDNYLNYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAADPRIEICMLPVG
CAMT2_MAIZE     VDADKDNYLNYHERLLKLVRPGGLIGYDNTLWNGSVVLPDDAPMRIRFYRDFNSALAADDRVEICQLPVG
CAMT_VITVI      VDADKDNYLNYHKRLIDLVKVGGIIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAADPRIEICMLPVG
CAMT_PETCR      VDADKDNYINYHKRLIDLVKIGGLIGYDNTLWNGSVAQPADAPMRVRYYRDFNKALAADPRIEICMLPVG
CAMT2_EUCGL     VDADKDNYINYHKRLIDLVKVGGLIGYDNTLWNGSVVAPADAPLRVRYYRDFNKALAVDPRVEICMLPVG
CAMT6_TOBAC     VDADKDNYINYHKRIIELVKVGGVIGYDNTLWNGSVVAPPDAPMRVRYYRDFNKALAADPRIEICMLPVG
CMTD1_HUMAN     VDADKENCSAYYERCLQLLRPGGILAVLRVLWRGKVLQPPKGDVAAECVRNLNERIRRDVRVYISLLPLG
CAMT_POPTM      VDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPMRVRYYRDFNKALAADPRIEICMLPVG
CAMT1_POPTR     VDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPPDAPMRVRYYRDFNKALAADPRIEICMLPVG
CAMT5_TOBAC     VDADKDNYINYHKRIIDLVKVGGLIGYDNTLWNGSVVAPPDAPMRVRYYRDFNKALAADPRIEICMLPVG
CAMT_SOLTU      VDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAADPRIEICQLPVG
CAMT4_ARATH     VDADKDNYINYHKRLIDLVKIGGVIGYDNTLWNGSVVAPPDAPMRVRYYRDFNKALAADPRIEICMLPVG
CAMT2_POPTR     VDADKDNYINYHKRLIELVKVGGLIGYDNTLWNGSVVAPADAPMRVRYYRDFNKALAADPRIEICMLPVG
CAMT_MESCR      VDADKDNYGNYHKRLIDLVKIGGVIGYDNTLWNGSVAAPADAPMRVRYYRDFNKAIAADPRVEICQLPVG
CAMT4_TOBAC     VDADKDNYLNYHKRLIDLVKIGGLIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAADSRIEICQLPVG
CAMT1_TOBAC     VDADKDNYLNYHKRLIDLVKIGGLIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAADSRIEICQLPVG
CAMT2_TOBAC     VDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAADSRIEICQLPVG
CAMT3_TOBAC     VDADKDNYLNYHKRLIDLVKVGGLIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAADSRIEICQLPVG
CAMT_MEDSA      VDADKDNYLNYHKRLIDLVKVGGVIGYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAVDPRIEICMLPVG
CMTD1_MOUSE     VDADKENCTAYYERCLQLLRPGGVLAVLRVLWRGEVLQPQPRNKTVECVRNLNERILRDARVYISLLPLD
CAMT_CITNA      VDADKDNYINYHKRIIDLVKVGGLIGYDNTLWNGSVVGPPDAPMRLRYCRDFVLELAVDPRIEICMLPVG
CAMT_POPKI      VDADKSSYKHYHEQLLKLVKIGGIIAYDNTLWYGLVADEVPEPLRMTVIMEFNKLLSSDLRVEISQISIG
CAMT_PINTA      VDRDKDNYLNYHKRLIDLVKVGGLIAYDNTLWNGSVVAPPDAPLRVRYYRDFNKALAVDPRIEISQIPVL
CAMT1_ARATH     ADADKSSYVNFHERLLKLVKVGGIIAFDNTLWFGFVAEPEHMREYRAALIEFNKKLALDPRVEVSQISIG
CAMT1_MAIZE     VDADKDNYLNYHERXXXXXXXXXXIGYDNTLWNGSVVLPDDAPMRIRFYRDFNKALAADDRVEICQLPVG
CAMT3_ARATH     VDADKLNYWNYHERLIRLIKVGGIIVYDNTLWGGSVAEPDSSTPEKKATLELNKKLSADQRVQISQAALG
CAMT_ZINEL      VDADKDNYLNYHKRLIDLVKFGGVIGYDNTLWNGSLVAPADAPLRVRYYRDFNKALAVDPRVEICQLPVG
CAMT2_ARATH     VDADKTNYVYFLEXXXXXXXXXXXXAFDNTLWFGTLIQPGHMRAYREALLEFNKILARDPRVEIAQISIG
CAMT_STELP      VDADKTNYVNYHERLIELVKVGGIIAYDNTLWGGTVALPESEVPDFMCVTKLNEILGSDARIDIAHLPVG
Y4497_MYCVP     IDAAPADQPHFVTEGVRLLRPGGAIVVHRAALGGRAGDATAKDSEVAAVREAARLIAEDDRLTPVLIPLG
Y2199_MYCGI     IDAAPADQPQFVVEGVRLLRPGGAIVVHRAALGGRAGDASAKDSEVSAVREAARLIAEDERLTPVLIPLG
Y4520_MYCUA     VDADPIDQPDYVVEGVRLLRSGGVIVVHRAALGDRAGDPAVRDAEVTAVREAARLIAEDERLTPALVPLG
Y5073_MYCS2     IDADPVDQPQFVVEGVRLLRSGGAIVVHXXXXXXXXXXXXXXXXEVTAVREAARLIAEDERLTPVLIPLG
Y4069_MYCSK     IDADPVDQPQFVVEGVRLLRSGGAIVVHXXXXXXXXXXXXXXXXEVSAVREAARLIAEDERLTPVLIPLG
Y3995_MYCSS     IDADPVDQPQFVVEGVRLLRSGGAIVVHXXXXXXXXXXXXXXXXEVSAVREAARLIAEDERLTPVLIPLG
Y4217_MYCMM     VDADPIDQPDYVVEGVRLLRSGGVIVVHXXXXXXXXXXXXXXXXEVTAVREAARLIAEDERLTPALVPLG
Y1361_MYCA9     IDAAPADQPDFLAGGIRLLRPGGAVVIHGASAGGRAGDPSANDPDVVGVREAARIIADDGRFTAVLIPLG
Y1280_MYCBP     IDADPIDQPDYVAEGVRLLRSGGVIVVHXXXXXXXXXXXXXXXXEVIAVREAARLIAEDERLTPALVPLG
Y1252_MYCBO     IDADPIDQPDYVAEGVRLLRSGGVIVVHXXXXXXXXXXXXXXXXEVIAVREAARLIAEDERLTPALVPLG
Y1229_MYCTA     IDADPIDQPDYVAEGVRLLRSGGVIVVHXXXXXXXXXXXXXXXXEVIAVREAARLIAEDERLTPALVPLG
Y1220_MYCTU     IDADPIDQPDYVAEGVRLLRSGGVIVVHXXXXXXXXXXXXXXXXEVIAVREAARLIAEDERLTPALVPLG
Y4009_MYCSJ     IDGDPADQPQFVVEGVRLLRPGGAIVVHXXXXXXXXXXXXXXXXEVSAVRE-------------------
YRRM_BACSU      IDAAKGQYQNFFHLYEPMLSPDGVIITDNVLFKGLVIEPKRRRRLVAKIDEYNHWLMNHPDYQTAIIPVG
Y1075_MYCLE     IDADPIDQPAYVVEGVRLLRSCGIIVVHXXXXXXXXXXXXXXXXEVTAVREAARLIAENERLTPALVPLG
Y1075_MYCLB     IDADPIDQPAYVVEGVRLLRSCGIIVVHXXXXXXXXXXXXXXXXEVTAVREAARLIAENERLTPALVPLG
COMT_HORSE      LDHWKDRYLTLLLEECGLLRKGTVLLADNV----------------------------------------
Y1364_MYCA1     IDADPIDQPDYVVEGVRLLRPGGVIVVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDERLTPALVPLG
Y2558_MYCPA     IDADPIDQPDYVVEGVRLLRPGGVIVVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDERLTPALVPLG
COMT_MOUSE      LDHWKDRYLTLLLEECGLLRKGTVLLADNV----------------------------------------
COMT_HUMAN      LDHWKDRYLTLLLEECGLLRKGTVLLADNV----------------------------------------
COMT_RAT        LDHWKDRYLTLLLEKCGLLRKGTVLLADNV----------------------------------------
COMT_PIG        LDHWKDRYLTLLLEECGLLRKGTVLLADNV----------------------------------------
TOMT_HUMAN      LAHRPRCYLRDLQEAHALLPAGATVLADHV----------------------------------------
COMT_BOVIN      LDHWKDRYXXXXXXXXXXXXXGTVLLADNV----------------------------------------
COMT2_SCHPO     IDHWKDLYVPDLRETLDLIGQGSIIAADNI----------------------------------------
TOMT_PANTR      LAHRPRCYLRDLQEAHALLPAGATVLADHV----------------------------------------
COMT1_SCHPO     IDHWKDLYVPDLRESLNMIAPGTLLVADNIIT--------------------------------------
TOMT_PROVC      LIHRPRCYLRDLQEAHALLPAGATVLADHV----------------------------------------
TOMT_MACMU      LIHRPRCYLRDLQEAHALLPAGATVLADHV----------------------------------------
TOMT_MOUSE      LAHRPRYYLRDLQEAHALLPHGATVLADHV----------------------------------------
TOMT_RAT        LAHRPRYYLRDLQEAHALLPHGATVLADHV----------------------------------------
Y1184_SYNP6     VLHHLEDPDRGLAALASKLAPGGIL---------------------------------------------
PIMT_HYPBU      VTAAAPDIPG---PLIDQLKPGGIPIGDRYLQHLYVV---------------------------------
PRMA_RHILW      ANILARPLIRMAPKLATHLAPGGSVILSGILATQRKVIAAYSGARLRHVR--------------------
PRMA_RHISN      ANILARPLMKMAPELVAHIAPGGSVILSGILAEQR-----------------------------------
PRMA_RHIL3      ANILARPLIRMAPKLATHLAPGGSVILSGILAGQRKVIAAYSGARLRHVK--------------------
PIMT_THEON      VAAGAPNVP---EPLVEQLKPGGKLI--------------------------------------------
PRMA_RHIEC      ANILARPLIRMAPQLAAHLAPGGSVILSGILAAQRKVIAAYSGARLRHVR--------------------
PRMA_GEOSM      ILA--EELVRLAGELTARVAPGGWLILSGILT--------------------------------------
PRMA_RHIE6      ANILARPLIRMAPQLAAHLAPAGSVILSGILAAQRKVIAAYSGARLRHVR--------------------
PIMT_PYRCJ      VTAAASEIP---KALVEQLREGGVMV--------------------------------------------
CBIT_PYRCJ      VGGGGLELPAIIKAAVERMEK-GIIVADVV----------------------------------------
PRMA_PELCD      ILAEENARLA--PELVHRLAPGGVLILSGILNEKEQL---------------------------------
PRMA_GEOBB      ILAEELVRLA--DELTARVAPGGWLILSGILT--------------------------------------
PRMA_AGRT5      ANILARPLIKMAPQLVTHLAPGGTVILSGILASQR-----------------------------------


                         .         .         .         +         .         .         .:280
query           DGFTLARRR
MDMC_STRMY      DGITLARRR
CAMT2_DICDI     DGITL----
CAMT1_DICDI     DGITLVTK-
CAMT_EUCGU      DGITLCRR-
CAMT1_EUCGL     DGITLCRR-
CAMT2_MAIZE     DGVTLCRR-
CAMT_VITVI      DGITLCRR-
CAMT_PETCR      DGVTLCRR-
CAMT2_EUCGL     DGITLCRR-
CAMT6_TOBAC     DGITLCRR-
CMTD1_HUMAN     DGLTLA---
CAMT_POPTM      DGITLCRR-
CAMT1_POPTR     DGITLCRR-
CAMT5_TOBAC     DGITLCRR-
CAMT_SOLTU      DGITLCRR-
CAMT4_ARATH     DGITICRR-
CAMT2_POPTR     DGITLCRR-
CAMT_MESCR      DGITLCRR-
CAMT4_TOBAC     DGITLCRR-
CAMT1_TOBAC     DGITLCRR-
CAMT2_TOBAC     DGITLCRR-
CAMT3_TOBAC     DGITLCRR-
CAMT_MEDSA      DGITICRR-
CMTD1_MOUSE     DGLSLA---
CAMT_CITNA      DGITLSRR-
CAMT_POPKI      DGVTLCRR-
CAMT_PINTA      DGVTLCRR-
CAMT1_ARATH     DGITLCRR-
CAMT1_MAIZE     DGVTLCRR-
CAMT3_ARATH     DGITICRR-
CAMT_ZINEL      DGITLCRR-
CAMT2_ARATH     DGLTLCRR-
CAMT_STELP      DGITFCRR-
Y4497_MYCVP     DGLLAAAR-
Y2199_MYCGI     DGLLAAAR-
Y4520_MYCUA     DGVLAAVR-
Y5073_MYCS2     DGLLAAVR-
Y4069_MYCSK     DGLLAAAR-
Y3995_MYCSS     DGLLAAAR-
Y4217_MYCMM     DGVLAAVR-
Y1361_MYCA9     DGLLAATR-
Y1280_MYCBP     DGVLAAVR-
Y1252_MYCBO     DGVLAAVR-
Y1229_MYCTA     DGVLAAVR-
Y1220_MYCTU     DGVLAAVR-
Y4009_MYCSJ     ---------
YRRM_BACSU      DGLAISKKK
Y1075_MYCLE     DGLLAAVR-
Y1075_MYCLB     DGLLAAVR-
COMT_HORSE      ---------
Y1364_MYCA1     DGILAAVR-
Y2558_MYCPA     DGILAAVR-
COMT_MOUSE      ---------
COMT_HUMAN      ---------
COMT_RAT        ---------
COMT_PIG        ---------
TOMT_HUMAN      ---------
COMT_BOVIN      ---------
COMT2_SCHPO     ---------
TOMT_PANTR      ---------
COMT1_SCHPO     ---------
TOMT_PROVC      ---------
TOMT_MACMU      ---------
TOMT_MOUSE      ---------
TOMT_RAT        ---------
Y1184_SYNP6     ---------
PIMT_HYPBU      ---------
PRMA_RHILW      ---------
PRMA_RHISN      ---------
PRMA_RHIL3      ---------
PIMT_THEON      ---------
PRMA_RHIEC      ---------
PRMA_GEOSM      ---------
PRMA_RHIE6      ---------
PIMT_PYRCJ      ---------
CBIT_PYRCJ      ---------
PRMA_PELCD      ---------
PRMA_GEOBB      ---------
PRMA_AGRT5      ---------