[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55025.1

[Show Plain Result]


## Summary of Sequence Search
    1::107
    1::84      5e-17  45%  107 aa  MMR_MYCPA RecName: Full=Multidrug resistance protein mmr;
    1::77      2e-16  47%  119 aa  YVAE_BACSU RecName: Full=Uncharacterized membrane protein yvaE;
    4::83      3e-16  46%  110 aa  QACF_ENTAE RecName: Full=Quaternary ammonium compound-resistance
    4::83      3e-16  48%  110 aa  QACE_KLEAE RecName: Full=Quaternary ammonium compound-resistance
    4::83      3e-16  48%  110 aa  QACE_ECOLX RecName: Full=Quaternary ammonium compound-resistance
    4::83      3e-16  48%  115 aa  EBR_SALTY RecName: Full=Putative ethidium bromide resistance
    4::83      3e-16  48%  115 aa  EBR_PSEAE RecName: Full=Putative ethidium bromide resistance
    4::83      3e-16  48%  115 aa  EBR_ECOLX RecName: Full=Putative ethidium bromide resistance
    1::79      5e-16  46%  107 aa  MMR_MYCLE RecName: Full=Multidrug resistance protein mmr;
    1::84      1e-15  43%  107 aa  MMR_MYCTU RecName: Full=Multidrug resistance protein mmr;
    1::84      1e-15  43%  107 aa  MMR_MYCBO RecName: Full=Multidrug resistance protein mmr;
    1::84      9e-14  36%  104 aa  SUGE_PHOLL RecName: Full=Quaternary ammonium compound-resistance
    4::83      9e-14  44%  110 aa  EMRE_ECOLI RecName: Full=Multidrug transporter emrE;AltName:
    1::80      5e-13  40%  104 aa  SUGE_YERPS RecName: Full=Quaternary ammonium compound-resistance
    1::80      5e-13  40%  104 aa  SUGE_YERPE RecName: Full=Quaternary ammonium compound-resistance
    1::81      2e-12  33%  104 aa  SUGE_PROVU RecName: Full=Quaternary ammonium compound-resistance
    1::76      2e-11  38%  107 aa  QACG_STAS9 RecName: Full=Quaternary ammonium compound-resistance
    1::76      7e-11  36%  107 aa  QACC_STAAU RecName: Full=Quaternary ammonium compound-resistance
    1::76      2e-10  34%  107 aa  QACC_STASS RecName: Full=Quaternary ammonium compound-resistance
    1::62      1e-09  42%  105 aa  SUGE_SALTY RecName: Full=Quaternary ammonium compound-resistance
    1::62      1e-09  42%  105 aa  SUGE_SALTI RecName: Full=Quaternary ammonium compound-resistance
   12::90      3e-09  34%  109 aa  MDTI_YERE8 RecName: Full=Spermidine export protein mdtI;
    1::76      4e-09  30%  107 aa  QACH_STASA RecName: Full=Quaternary ammonium compound-resistance
   11::88      4e-09  35%  109 aa  MDTI_SHIDS RecName: Full=Spermidine export protein mdtI;
   12::90      5e-09  34%  109 aa  MDTI_YERPY RecName: Full=Spermidine export protein mdtI;
   12::90      5e-09  34%  109 aa  MDTI_YERPP RecName: Full=Spermidine export protein mdtI;
   12::90      5e-09  34%  109 aa  MDTI_YERPN RecName: Full=Spermidine export protein mdtI;
   12::90      5e-09  34%  109 aa  MDTI_YERPG RecName: Full=Spermidine export protein mdtI;
   12::90      5e-09  34%  109 aa  MDTI_YERPE RecName: Full=Spermidine export protein mdtI;
   12::90      5e-09  34%  109 aa  MDTI_YERPA RecName: Full=Spermidine export protein mdtI;
   12::90      5e-09  34%  109 aa  MDTI_YERP3 RecName: Full=Spermidine export protein mdtI;
   12::90      7e-09  34%  109 aa  MDTI_YERPS RecName: Full=Spermidine export protein mdtI;
   12::90      7e-09  34%  109 aa  MDTI_YERPB RecName: Full=Spermidine export protein mdtI;
    4::84      9e-09  30%  119 aa  MDTJ_ENTS8 RecName: Full=Spermidine export protein mdtJ;
    1::62      2e-08  37%  105 aa  SUGE_SALTH RecName: Full=Quaternary ammonium compound-resistance
    1::62      2e-08  37%  105 aa  SUGE_SALCH RecName: Full=Quaternary ammonium compound-resistance
    1::62      2e-08  37%  105 aa  SUGE_KLEOX RecName: Full=Quaternary ammonium compound-resistance
    1::62      2e-08  37%  105 aa  SUGE_CITFR RecName: Full=Quaternary ammonium compound-resistance
    1::62      2e-08  37%  105 aa  SUGE2_SALTY RecName: Full=Quaternary ammonium compound-resistance
    1::62      2e-08  37%  105 aa  SUGE2_ECOLX RecName: Full=Quaternary ammonium compound-resistance
    5::84      2e-08  32%  105 aa  EBRA_BACSU RecName: Full=Multidrug resistance protein ebrA;
    4::84      3e-08  29%  146 aa  MDTJ_PROMH RecName: Full=Spermidine export protein mdtJ;
   11::88      5e-08  35%  109 aa  MDTI_ENT38 RecName: Full=Spermidine export protein mdtI;
    1::59      6e-08  41%  105 aa  SUGE_SHIFL RecName: Full=Quaternary ammonium compound-resistance
    1::59      6e-08  41%  105 aa  SUGE_ECOLI RecName: Full=Quaternary ammonium compound-resistance
    1::59      6e-08  41%  105 aa  SUGE_ECOL6 RecName: Full=Quaternary ammonium compound-resistance
    1::59      6e-08  41%  105 aa  SUGE_ECO57 RecName: Full=Quaternary ammonium compound-resistance
   25::84      6e-08  35%  105 aa  EBRA_BACLD RecName: Full=Multidrug resistance protein ebrA;
    4::84      8e-08  31%  120 aa  MDTJ_ENT38 RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  23%  147 aa  MDTJ_YERPY RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  23%  147 aa  MDTJ_YERPP RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  23%  147 aa  MDTJ_YERPN RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  23%  147 aa  MDTJ_YERPG RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  23%  147 aa  MDTJ_YERPE RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  23%  147 aa  MDTJ_YERPA RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  23%  147 aa  MDTJ_YERP3 RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALTY RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALTI RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALSV RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALPK RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALPC RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALPB RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALPA RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALNS RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALHS RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALEP RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALDC RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALCH RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  26%  120 aa  MDTJ_SALA4 RecName: Full=Spermidine export protein mdtJ;
   15::90      2e-07  30%  109 aa  MDTI_PHOLL RecName: Full=Spermidine export protein mdtI;
    4::84      2e-07  23%  147 aa  MDTJ_YERPS RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  23%  147 aa  MDTJ_YERPB RecName: Full=Spermidine export protein mdtJ;
    4::84      2e-07  28%  138 aa  MDTJ_PHOLL RecName: Full=Spermidine export protein mdtJ;
    4::84      3e-07  26%  120 aa  MDTJ_SALAR RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_SHISS RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_SHIFL RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_SHIF8 RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_SHIDS RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_SHIBS RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_SHIB3 RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECOUT RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECOSM RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECOSE RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECOLI RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECOLC RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECOL5 RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECOK1 RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECOHS RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECODH RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECOBW RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECO8A RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECO81 RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECO5E RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECO57 RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECO55 RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECO45 RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECO27 RecName: Full=Spermidine export protein mdtJ;
    5::85      7e-07  26%  121 aa  MDTJ_ECO24 RecName: Full=Spermidine export protein mdtJ;
    5::84      7e-07  31%  117 aa  EBRB_BACSU RecName: Full=Multidrug resistance protein ebrB;
    5::85      9e-07  25%  121 aa  MDTJ_ECOL6 RecName: Full=Spermidine export protein mdtJ;
    4::84      1e-06  27%  122 aa  MDTJ_SERP5 RecName: Full=Spermidine export protein mdtJ;
   11::68      1e-06  38%  109 aa  MDTI_KLEP7 RecName: Full=Spermidine export protein mdtI;
   11::68      1e-06  40%  109 aa  MDTI_KLEP3 RecName: Full=Spermidine export protein mdtI;
    1::77      2e-06  25%  106 aa  YVDR_BACSU RecName: Full=Uncharacterized membrane protein yvdR;
    1::80      9e-06  25%  104 aa  YKKD_BACLD RecName: Full=Multidrug resistance protein ykkD;
    4::81      9e-06  23%  126 aa  MDTJ_SODGM RecName: Full=Spermidine export protein mdtJ;
   11::88      1e-05  29%  109 aa  MDTI_SHISS RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_SHIF8 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_SHIBS RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_SHIB3 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECOUT RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECOSM RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECOSE RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECOLU RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECOLI RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECOLC RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECOK1 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECOHS RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECODH RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECOBW RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECO8A RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECO7I RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECO5E RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECO57 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECO55 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECO45 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECO27 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-05  29%  109 aa  MDTI_ECO24 RecName: Full=Spermidine export protein mdtI;
    4::84      2e-05  27%  120 aa  MDTJ_KLEP7 RecName: Full=Spermidine export protein mdtJ;
   11::88      2e-05  29%  109 aa  MDTI_ECOL6 RecName: Full=Spermidine export protein mdtI;
   11::88      2e-05  32%  109 aa  MDTI_ENTS8 RecName: Full=Spermidine export protein mdtI;
   11::88      4e-05  28%  109 aa  MDTI_SHIFL RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALTY RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALTI RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALSV RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALPC RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALPB RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALNS RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALHS RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALEP RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALDC RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALCH RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALA4 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  28%  109 aa  MDTI_ECOL5 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  28%  109 aa  MDTI_ECO81 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  28%  109 aa  MDTI_CITK8 RecName: Full=Spermidine export protein mdtI;
   11::88      1e-04  29%  109 aa  MDTI_SALPA RecName: Full=Spermidine export protein mdtI;
   16::84      4e-04  27%  120 aa  MDTJ_CITK8 RecName: Full=Spermidine export protein mdtJ;
    1::107

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MQWLLLIGAILTEVTGTISLRLSDGFTRLVPSLIALTSYGIAFTLLAQVLKLGMGVGVAYGIWSALGVTL
MMR_MYCPA       MTYLFLICAILAEVVATSLLKSTQGFTRLWPTVICLLGYAVSFALLAVSISRGMQTDVAYALWSAIGTAL
YVAE_BACSU      MNWVFLCLAILFEVAGTVSMKLSSGFTKLIPSLLLIFFYGGSLFFLTLTLK-SIDVSVAYAVWSGMGIVL
QACF_ENTAE      --WIFLAVSIFGEVIATSALKSSHGFTRLVPSVVVVAGYGLAFYFLSLALK-SIPVGIAYAVWAGLGIVL
QACE_KLEAE      --WLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLK-SIPVGVAYAVWSGLGVVI
QACE_ECOLX      --WLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLK-SIPVGVAYAVWSGLGVVI
EBR_SALTY       --WLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLK-SIPVGVAYAVWSGLGVVI
EBR_PSEAE       --WLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLK-SIPVGVAYAVWSGLGVVI
EBR_ECOLX       --WLFLVIAIVGEVIATSALKSSEGFTKLAPSAVVIIGYGIAFYFLSLVLK-SIPVGVAYAVWSGLGVVI
MMR_MYCLE       MAYLFLFCAIFVEVVATTLLKSTEGFTRLVPTLACLAGYAVTFTLLALSISRGMKTDVAYALWSAIGTAA
MMR_MYCTU       MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAYALWSAIGTAA
MMR_MYCBO       MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAYALWSAIGTAA
SUGE_PHOLL      MSWFVLVIAGLFEVVWAVGLKYTHGFTRLIPSLITASAVALSMGLLAYAMK-GLPIGTAYAVWTGIGAVG
EMRE_ECOLI      --YIYLGGAILAEVIGTTLMKFSEGFTRLWPSVGTIICYCASFWLLAQTLAY-IPTGIAYAIWSGVGIVL
SUGE_YERPS      MAWIILVIAGLLEVIWAIGLKYSHGFSRLTPSIITLVAMAASVFLLAYAMK-SLPAGTAYAVWTGIGAVG
SUGE_YERPE      MAWIILVIAGLLEVIWAIGLKYSHGFSRLTPSIITLVAMAASVFLLAYAMK-SLPAGTAYAVWTGIGAVG
SUGE_PROVU      MSWIILFVAGLLEIVWAVGLKYTHGFTRLTPSIITISAMIVSMGMLSYAMK-GLPAGTAYAIWTGIGAVG
QACG_STAS9      MHYLYLFISIATEIIGTSFLKTSEGFTKLWPTLGTLLSFGICFYFLSLTIKF-LPLNITYATWAGLGLVL
QACC_STAAU      MPYIYLIIAISTEVIGSAFLKSSEGFSKFIPSLGTIISFGICFYFLSKTMQ-HLPLNITYATWAGLGLVL
QACC_STASS      MPYIYLIISISTEVIGSAFLKSSEGFSKFIPSLGTIISFGICFYFLSKTMQ-HLPLNITYATWAGLGLVL
SUGE_SALTY      MSWIILLIAGLLEVVWAVGLKYTHGFSRLTPSIITITAMVISMALLSWAMKT-LPVGTAYAIW-------
SUGE_SALTI      MSWIILLIAGLLEVVWAVGLKYTHGFSRLTPSIITITAMVISMALLSWAMKT-LPVGTAYAIW-------
MDTI_YERE8      -----LILAVILEIIANILLKMSDGFRRVWLGILSLLSVLGAFSALAQAVK-GIELSVAYALWGGFGIAA
QACH_STASA      MPYLYLLLSIVSEVIGSAFLKSSDGFSKLYPTITTIISFLICFYFLSKTMQ-HLPLNITYASWAGLGLVL
MDTI_SHIDS      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGLLSQAAVLAAFSALSQAVK-GIDLSVAYALWGGFGIAA
MDTI_YERPY      -----LILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVK-GIELSVAYALWGGFGIAA
MDTI_YERPP      -----LILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVK-GIELSVAYALWGGFGIAA
MDTI_YERPN      -----LILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVK-GIELSVAYALWGGFGIAA
MDTI_YERPG      -----LILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVK-GIELSVAYALWGGFGIAA
MDTI_YERPE      -----LILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVK-GIELSVAYALWGGFGIAA
MDTI_YERPA      -----LILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVK-GIELSVAYALWGGFGIAA
MDTI_YERP3      -----LILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVK-GIELSVAYALWGGFGIAA
MDTI_YERPS      -----LILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVK-GIELSVAYAMWGGFGIAA
MDTI_YERPB      -----LILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVK-GIELSVAYAMWGGFGIAA
MDTJ_ENTS8      --WILLALAIVSEITGTLALKWASVGGGHAGFILMLVMISLSYILLSFSVKR-IALGVAYALWEGVGIVL
SUGE_SALTH      MSWIVLLIAGLLEVVWAIGLKYTHGFTRLTPSIITIAAMIVSIAMLSWAMRT-LPVGTAYAVW-------
SUGE_SALCH      MSWIVLLIAGLLEVVWAIGLKYTHGFTRLTPSIITIAAMIVSIAMLSWAMRT-LPVGTAYAVW-------
SUGE_KLEOX      MSWIVLLIAGLLEVVWAIGLKYTHGFTRLTPSIITIAAMIVSIAMLSWAMRT-LPVGTAYAVW-------
SUGE_CITFR      MSWIVLLIAGLLEVVWAIGLKYTHGFTRLTPSIITIAAMIVSIAMLSWAMRT-LPVGTAYAVW-------
SUGE2_SALTY     MSWIVLLIAGLLEVVWAIGLKYTHGFTRLTPSIITIAAMIVSIAMLSWAMRT-LPVGTAYAVW-------
SUGE2_ECOLX     MSWIVLLIAGLLEVVWAIGLKYTHGFTRLTPSIITIAAMIVSIAMLSWAMRT-LPVGTAYAVW-------
EBRA_BACSU      --YIFLTIAICSESIGAAMLKVSDGFKKWKPSALVVIGYSLAFYMLSLTLN-HIPLSLSYATWSGAGTVL
MDTJ_PROMH      --WIFLVLAIICEVIGTLSMKVSGGYTGMIVMWLMIAT---SYIFLAIAVKK-VALGVAYALWEGIGIVI
MDTI_ENT38      --WLAF--AIVLEIIANVFLKFSDGFRRKWFGLLSIAAVLGAFSALSQAVK-GIDLSVAYALWGGFGIAA
SUGE_SHIFL      MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMK-SLPVGTAY----------
SUGE_ECOLI      MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMK-SLPVGTAY----------
SUGE_ECOL6      MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSLALLAWAMK-SLPVGTAY----------
SUGE_ECO57      MSWIILVIAGLLEVVWAVGLKYTHGFSRLTPSVITVTAMIVSMALLAWAMK-SLPVGTAY----------
EBRA_BACLD      ----------------------SDGFARWQPSVLVVIGYGLAFYMMSLTLQV-IPLSLSYATWSGAGTVL
MDTJ_ENT38      --WILLALAIVAEITGTLSMKISDDNTGFILMLVMIS---LSYIFLSFAVKK-IALGVAYALWEGIGILL
MDTJ_YERPY      --WIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKK-VALGVAYALWEGIGILI
MDTJ_YERPP      --WIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKK-VALGVAYALWEGIGILI
MDTJ_YERPN      --WIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKK-VALGVAYALWEGIGILI
MDTJ_YERPG      --WIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKK-VALGVAYALWEGIGILI
MDTJ_YERPE      --WIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKK-VALGVAYALWEGIGILI
MDTJ_YERPA      --WIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKK-VALGVAYALWEGIGILI
MDTJ_YERP3      --WIFLGLAIIAEIIGTLSMKYASVSGEMTGHIVMYFMITGSYVMLSLAVKK-VALGVAYALWEGIGILI
MDTJ_SALTY      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALTI      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALSV      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALPK      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALPC      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALPB      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALPA      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALNS      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALHS      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALEP      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALDC      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALCH      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SALA4      --WILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTI_PHOLL      --------AVVLDILANILLKLSNGFRRPWMGILSLIAVLGAFSALAQAVK-GIELSIAYALWGAFGIIA
MDTJ_YERPS      --WIFLGLAIIAEIIGTLSMKYASVSGEMTGHVVMYFMITGSYVMLSLAVKK-VALGVAYALWEGIGILI
MDTJ_YERPB      --WIFLGLAIIAEIIGTLSMKYASVSGEMTGHVVMYFMITGSYVMLSLAVKK-VALGVAYALWEGIGILI
MDTJ_PHOLL      --WLFLAMAIITEVIGTLSMKHXXXXXXXXXXXXXYIMIATSYILLAMAVKK-VALGVAYALWEGVGILF
MDTJ_SALAR      --WILLALAIVAEITGTLSMKWASVGNGNAGYILMLVMITLSYIFLSFAVKK-IALGVAYALWEGIGILF
MDTJ_SHISS      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SHIFL      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SHIF8      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SHIDS      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SHIBS      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SHIB3      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECOUT      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECOSM      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECOSE      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECOLI      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECOLC      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECOL5      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECOK1      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECOHS      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECODH      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECOBW      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECO8A      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECO81      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECO5E      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECO57      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECO55      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECO45      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECO27      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_ECO24      --WILLGLAIATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
EBRB_BACSU      ---LYLALAIVSEVFGSTMLKLSEGFTQAWPIAGVIVGXXXXXXXXXXXXKT-IDLSSAYATWSGVGTAL
MDTJ_ECOL6      --WILLGLAVATEITGTLSMKWASVSEGNGGFILMLVMISLSYIFLSFAVK-KIALGVAYALWEGIGILF
MDTJ_SERP5      --WIFLGLAIATEIIGTLSMKISGGMTGHIVMYVMITA---SYVMLSMAVKR-VALGVAYALWEGIGILF
MDTI_KLEP7      --WLAI--AIVLEIIANVFLKFSDGFRRKIYGILSLAAVLGAFSALSQAVK-GIDLSVAYALW-------
MDTI_KLEP3      --WLAV--AIVLEIIANVFLKFSDGFRRKVYGILSLAAVLGAFSALSQAVK-GIDLSVAYALW-------
YVDR_BACSU      MAWFLLVXXXXXXXXXXXXMKYIDGTRKKWPIIVMTVGFGLSFYCLSQAM-IVLPAGVAYAVWTGIGSIG
YKKD_BACLD      MEWICLIAAGILEMLGVTMMNQFHKDKRVRWIFLLIIGFAASFFLLSLAMET-LPMGTAYAVWTGIGTVG
MDTJ_SODGM      --WIFLALAITAEVIGTLSMKYATVNGQITGHIVMYIMITASYILLSLAIK-RVALGVAYALWEGIGILF
MDTI_SHISS      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_SHIF8      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_SHIBS      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_SHIB3      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECOUT      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECOSM      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECOSE      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECOLU      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECOLI      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECOLC      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECOK1      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECOHS      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECODH      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECOBW      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECO8A      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECO7I      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECO5E      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECO57      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECO55      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECO45      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECO27      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECO24      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTJ_KLEP7      --WXXXXXXXXXEITGTLSMKVSGGHTGFI---LMLAMIALSYIFLAFAVKK-IALGVAYALWEGIGILL
MDTI_ECOL6      --WLAL--AIVLEIIANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ENTS8      --WLLL--AIGLEIIANIWLKFSDGFRRPVYGXXXXXXXXXXXXXXGQAVE-GIDLAVAYALWGGFGIAA
MDTI_SHIFL      --WLAL--AIVLEIVANVFLKFSDGFRRKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVVYALWGGFGIAA
MDTI_SALTY      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALTI      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALSV      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALPC      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALPB      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALNS      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALHS      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALEP      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALDC      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALCH      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALA4      --WLGL--AIMLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_ECOL5      --WLAL--AIVLEIVANVFLKFSDGFRCKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_ECO81      --WLAL--AIVLEIVANVFLKFSDGFRCKIFGXXXXXXXXXXXXXXXQAVK-GIDLSVAYALWGGFGIAA
MDTI_CITK8      --WLAM--AIVLEIVANVFLKFSDGFRRKFYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTI_SALPA      --WLGL--AIVLEIAANVLLKFSDGFRRKCYGIXXXXXXXXXXXXXXXXVK-GIDLSVAYALWGGFGIAA
MDTJ_CITK8      --------------TGTLSMKVSNGNTGFILMLVMIT---LSYIFLSFAVKK-IALGVAYALWEGIGILF


                         .         .         *         .         .         .         .:140
query           VAVIGAVFLGDTLTWxxxxxxxxxxxxxxxxxxxxxx
MMR_MYCPA       IVLIAVLFLGSPIS-----------------------
YVAE_BACSU      ITVVGFLF-----------------------------
QACF_ENTAE      VAAIAWIFHGQKL------------------------
QACE_KLEAE      ITAIAWLLHGQKL------------------------
QACE_ECOLX      ITAIAWLLHGQKL------------------------
EBR_SALTY       ITAIAWLLHGQKL------------------------
EBR_PSEAE       ITAIAWLLHGQKL------------------------
EBR_ECOLX       ITAIAWLLHGQKL------------------------
MMR_MYCLE       IVLIAVLFL----------------------------
MMR_MYCTU       IVLVAVLFLGSPIS-----------------------
MMR_MYCBO       IVLVAVLFLGSPIS-----------------------
SUGE_PHOLL      TAIFGIIVFGESASF----------------------
EMRE_ECOLI      ISLLSWGFFGQRL------------------------
SUGE_YERPS      TAILGIVLLGE--------------------------
SUGE_YERPE      TAILGIVLLGE--------------------------
SUGE_PROVU      TAIFGIIVFGES-------------------------
QACG_STAS9      TTIISVI------------------------------
QACC_STAAU      TTVVSII------------------------------
QACC_STASS      TTVVSII------------------------------
SUGE_SALTY      -------------------------------------
SUGE_SALTI      -------------------------------------
MDTI_YERE8      TVAAGWILFNQRLNY----------------------
QACH_STASA      TTIVSVL------------------------------
MDTI_SHIDS      TLAAGWILFGQRL------------------------
MDTI_YERPY      TVAAGWILFNQRLNY----------------------
MDTI_YERPP      TVAAGWILFNQRLNY----------------------
MDTI_YERPN      TVAAGWILFNQRLNY----------------------
MDTI_YERPG      TVAAGWILFNQRLNY----------------------
MDTI_YERPE      TVAAGWILFNQRLNY----------------------
MDTI_YERPA      TVAAGWILFNQRLNY----------------------
MDTI_YERP3      TVAAGWILFNQRLNY----------------------
MDTI_YERPS      TVAAGWILFNQRLNY----------------------
MDTI_YERPB      TVAAGWILFNQRLNY----------------------
MDTJ_ENTS8      ITLFSVLLFNETLT-----------------------
SUGE_SALTH      -------------------------------------
SUGE_SALCH      -------------------------------------
SUGE_KLEOX      -------------------------------------
SUGE_CITFR      -------------------------------------
SUGE2_SALTY     -------------------------------------
SUGE2_ECOLX     -------------------------------------
EBRA_BACSU      TTVIGVKWFKEDL------------------------
MDTJ_PROMH      ITTFSVLWFGESLS-----------------------
MDTI_ENT38      TLAAGWVLFGQRL------------------------
SUGE_SHIFL      -------------------------------------
SUGE_ECOLI      -------------------------------------
SUGE_ECOL6      -------------------------------------
SUGE_ECO57      -------------------------------------
EBRA_BACLD      TAIIGVLWFQEKL------------------------
MDTJ_ENT38      ITLFSVMLFDEALS-----------------------
MDTJ_YERPY      ITIFSVMWFGETLS-----------------------
MDTJ_YERPP      ITIFSVMWFGETLS-----------------------
MDTJ_YERPN      ITIFSVMWFGETLS-----------------------
MDTJ_YERPG      ITIFSVMWFGETLS-----------------------
MDTJ_YERPE      ITIFSVMWFGETLS-----------------------
MDTJ_YERPA      ITIFSVMWFGETLS-----------------------
MDTJ_YERP3      ITIFSVMWFGETLS-----------------------
MDTJ_SALTY      ITIFSVLLFDEALS-----------------------
MDTJ_SALTI      ITIFSVLLFDEALS-----------------------
MDTJ_SALSV      ITIFSVLLFDEALS-----------------------
MDTJ_SALPK      ITIFSVLLFDEALS-----------------------
MDTJ_SALPC      ITIFSVLLFDEALS-----------------------
MDTJ_SALPB      ITIFSVLLFDEALS-----------------------
MDTJ_SALPA      ITIFSVLLFDEALS-----------------------
MDTJ_SALNS      ITIFSVLLFDEALS-----------------------
MDTJ_SALHS      ITIFSVLLFDEALS-----------------------
MDTJ_SALEP      ITIFSVLLFDEALS-----------------------
MDTJ_SALDC      ITIFSVLLFDEALS-----------------------
MDTJ_SALCH      ITIFSVLLFDEALS-----------------------
MDTJ_SALA4      ITIFSVLLFDEALS-----------------------
MDTI_PHOLL      TVAAGWIMFNQRLNY----------------------
MDTJ_YERPS      ITIFSVMWFGETLS-----------------------
MDTJ_YERPB      ITIFSVMWFGETLS-----------------------
MDTJ_PHOLL      ITVFSVMWFDESLS-----------------------
MDTJ_SALAR      ITVFSVLLFDEVLS-----------------------
MDTJ_SHISS      ITLFSVLLFDESLS-----------------------
MDTJ_SHIFL      ITLFSVLLFDESLS-----------------------
MDTJ_SHIF8      ITLFSVLLFDESLS-----------------------
MDTJ_SHIDS      ITLFSVLLFDESLS-----------------------
MDTJ_SHIBS      ITLFSVLLFDESLS-----------------------
MDTJ_SHIB3      ITLFSVLLFDESLS-----------------------
MDTJ_ECOUT      ITLFSVLLFDESLS-----------------------
MDTJ_ECOSM      ITLFSVLLFDESLS-----------------------
MDTJ_ECOSE      ITLFSVLLFDESLS-----------------------
MDTJ_ECOLI      ITLFSVLLFDESLS-----------------------
MDTJ_ECOLC      ITLFSVLLFDESLS-----------------------
MDTJ_ECOL5      ITLFSVLLFDESLS-----------------------
MDTJ_ECOK1      ITLFSVLLFDESLS-----------------------
MDTJ_ECOHS      ITLFSVLLFDESLS-----------------------
MDTJ_ECODH      ITLFSVLLFDESLS-----------------------
MDTJ_ECOBW      ITLFSVLLFDESLS-----------------------
MDTJ_ECO8A      ITLFSVLLFDESLS-----------------------
MDTJ_ECO81      ITLFSVLLFDESLS-----------------------
MDTJ_ECO5E      ITLFSVLLFDESLS-----------------------
MDTJ_ECO57      ITLFSVLLFDESLS-----------------------
MDTJ_ECO55      ITLFSVLLFDESLS-----------------------
MDTJ_ECO45      ITLFSVLLFDESLS-----------------------
MDTJ_ECO27      ITLFSVLLFDESLS-----------------------
MDTJ_ECO24      ITLFSVLLFDESLS-----------------------
EBRB_BACSU      TAIVGFLLFGETIS-----------------------
MDTJ_ECOL6      ITLFSVLLFDESLS-----------------------
MDTJ_SERP5      ITLFSVLWFDEPIS-----------------------
MDTI_KLEP7      -------------------------------------
MDTI_KLEP3      -------------------------------------
YVDR_BACSU      VSAVGLIW-----------------------------
YKKD_BACLD      GALVGILFYGE--------------------------
MDTJ_SODGM      ITLFSVMWFDE--------------------------
MDTI_SHISS      TLAAGWILFGQRL------------------------
MDTI_SHIF8      TLAAGWILFGQRL------------------------
MDTI_SHIBS      TLAAGWILFGQRL------------------------
MDTI_SHIB3      TLAAGWILFGQRL------------------------
MDTI_ECOUT      TLAAGWILFGQRL------------------------
MDTI_ECOSM      TLAAGWILFGQRL------------------------
MDTI_ECOSE      TLAAGWILFGQRL------------------------
MDTI_ECOLU      TLAAGWILFGQRL------------------------
MDTI_ECOLI      TLAAGWILFGQRL------------------------
MDTI_ECOLC      TLAAGWILFGQRL------------------------
MDTI_ECOK1      TLAAGWILFGQRL------------------------
MDTI_ECOHS      TLAAGWILFGQRL------------------------
MDTI_ECODH      TLAAGWILFGQRL------------------------
MDTI_ECOBW      TLAAGWILFGQRL------------------------
MDTI_ECO8A      TLAAGWILFGQRL------------------------
MDTI_ECO7I      TLAAGWILFGQRL------------------------
MDTI_ECO5E      TLAAGWILFGQRL------------------------
MDTI_ECO57      TLAAGWILFGQRL------------------------
MDTI_ECO55      TLAAGWILFGQRL------------------------
MDTI_ECO45      TLAAGWILFGQRL------------------------
MDTI_ECO27      TLAAGWILFGQRL------------------------
MDTI_ECO24      TLAAGWILFGQRL------------------------
MDTJ_KLEP7      ITLFSVLLFDESLS-----------------------
MDTI_ECOL6      TLAAGWILFGQRL------------------------
MDTI_ENTS8      TVAAGWIMFGQRL------------------------
MDTI_SHIFL      TLAAGWILFGQRL------------------------
MDTI_SALTY      TLAAGWVLFGQRL------------------------
MDTI_SALTI      TLAAGWVLFGQRL------------------------
MDTI_SALSV      TLAAGWVLFGQRL------------------------
MDTI_SALPC      TLAAGWVLFGQRL------------------------
MDTI_SALPB      TLAAGWVLFGQRL------------------------
MDTI_SALNS      TLAAGWVLFGQRL------------------------
MDTI_SALHS      TLAAGWVLFGQRL------------------------
MDTI_SALEP      TLAAGWVLFGQRL------------------------
MDTI_SALDC      TLAAGWVLFGQRL------------------------
MDTI_SALCH      TLAAGWVLFGQRL------------------------
MDTI_SALA4      TLAAGWVLFGQRL------------------------
MDTI_ECOL5      TLAAGWILFGQRL------------------------
MDTI_ECO81      TLAAGWILFGQRL------------------------
MDTI_CITK8      TLAAGWVLFGQRL------------------------
MDTI_SALPA      TLAAGWVLFGQRL------------------------
MDTJ_CITK8      ITLFSVLLFDEALS-----------------------