[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55030.1

[Show Plain Result]


## Summary of Sequence Search
    1::236
    1::236     e-140 100%  236 aa  LIPB_THEFY RecName: Full=Octanoyltransferase;       
   18::213     1e-70  65%  213 aa  LIPB_SALAI RecName: Full=Octanoyltransferase;       
   18::211     2e-69  64%  213 aa  LIPB_SALTO RecName: Full=Octanoyltransferase;       
   12::250     3e-68  64%  273 aa  LIPB_STRGG RecName: Full=Octanoyltransferase;       
   12::250     6e-67  64%  265 aa  LIPB_STRCO RecName: Full=Octanoyltransferase;       
   10::192     9e-67  65%  221 aa  LIPB_ACIC1 RecName: Full=Octanoyltransferase;       
   12::250     2e-64  61%  265 aa  LIPB_STRAW RecName: Full=Octanoyltransferase;       
   32::232     4e-63  59%  240 aa  LIPB_CORJK RecName: Full=Octanoyltransferase;       
   22::227     1e-62  60%  238 aa  LIPB_MYCGI RecName: Full=Octanoyltransferase;       
   26::210     2e-62  63%  238 aa  LIPB_MYCVP RecName: Full=Octanoyltransferase;       
    9::210     2e-62  59%  224 aa  LIPB_LEIXX RecName: Full=Octanoyltransferase;       
   23::203     7e-62  64%  258 aa  LIPB_RHOOB RecName: Full=Octanoyltransferase;       
   23::203     2e-61  64%  258 aa  LIPB_RHOSR RecName: Full=Octanoyltransferase;       
   19::207     3e-60  61%  235 aa  LIPB_MYCLE RecName: Full=Octanoyltransferase;       
   19::207     3e-60  61%  235 aa  LIPB_MYCLB RecName: Full=Octanoyltransferase;       
   20::211     5e-60  62%  241 aa  LIPB_MYCUA RecName: Full=Octanoyltransferase;       
    9::215     9e-60  55%  233 aa  LIPB_CLAM3 RecName: Full=Octanoyltransferase;       
    9::230     1e-59  54%  232 aa  LIPB_CLAMS RecName: Full=Octanoyltransferase;       
   20::195     2e-59  64%  233 aa  LIPB_MYCA1 RecName: Full=Octanoyltransferase;       
   30::216     2e-59  56%  251 aa  LIPB_CORGL RecName: Full=Octanoyltransferase;       
   30::216     2e-59  56%  251 aa  LIPB_CORGB RecName: Full=Octanoyltransferase;       
   20::195     6e-59  63%  233 aa  LIPB_MYCPA RecName: Full=Octanoyltransferase;       
   20::211     1e-58  63%  241 aa  LIPB_MYCMM RecName: Full=Octanoyltransferase;       
   21::192     4e-58  65%  228 aa  LIPB_MYCS2 RecName: Full=Octanoyltransferase;       
   22::195     8e-58  66%  238 aa  LIPB_MYCSS RecName: Full=Octanoyltransferase;       
   22::195     8e-58  66%  238 aa  LIPB_MYCSK RecName: Full=Octanoyltransferase;       
   22::195     8e-58  66%  238 aa  LIPB_MYCSJ RecName: Full=Octanoyltransferase;       
   20::198     1e-57  62%  230 aa  LIPB_MYCTU RecName: Full=Octanoyltransferase;       
   20::198     1e-57  62%  230 aa  LIPB_MYCTA RecName: Full=Octanoyltransferase;       
    3::208     2e-57  56%  240 aa  LIPB_KOCRD RecName: Full=Octanoyltransferase;       
   30::216     2e-57  55%  251 aa  LIPB_COREF RecName: Full=Octanoyltransferase;       
    3::200     2e-57  55%  222 aa  LIPB_ARTS2 RecName: Full=Octanoyltransferase;       
   20::198     9e-57  61%  230 aa  LIPB_MYCBT RecName: Full=Octanoyltransferase;       
   20::198     9e-57  61%  230 aa  LIPB_MYCBP RecName: Full=Octanoyltransferase;       
   20::198     9e-57  61%  230 aa  LIPB_MYCBO RecName: Full=Octanoyltransferase;       
   25::208     1e-55  58%  250 aa  LIPB_NOCFA RecName: Full=Octanoyltransferase;       
   15::199     2e-55  55%  233 aa  LIPB_RENSM RecName: Full=Octanoyltransferase;       
   32::209     2e-55  56%  250 aa  LIPB_CORDI RecName: Full=Octanoyltransferase;       
    3::200     3e-54  53%  222 aa  LIPB_ARTAT RecName: Full=Octanoyltransferase;       
    3::200     5e-54  52%  222 aa  LIPB_ARTCA RecName: Full=Octanoyltransferase;       
   29::225     3e-53  50%  235 aa  LIPB_TROWT RecName: Full=Octanoyltransferase;       
   19::215     3e-53  50%  225 aa  LIPB_TROW8 RecName: Full=Octanoyltransferase;       
   32::216     2e-52  55%  268 aa  LIPB_CORA7 RecName: Full=Octanoyltransferase;       
   48::225     2e-50  55%  272 aa  LIPB_PROAC RecName: Full=Octanoyltransferase;       
   20::217     1e-45  50%  221 aa  LIPB_RUBXD RecName: Full=Octanoyltransferase;       
    4::202     2e-43  51%  223 aa  LIPB_CHLSY RecName: Full=Octanoyltransferase;       
    4::202     2e-43  51%  223 aa  LIPB_CHLAA RecName: Full=Octanoyltransferase;       
    6::211     1e-42  48%  221 aa  LIPB_CHLAD RecName: Full=Octanoyltransferase;       
   12::211     1e-41  49%  240 aa  LIPB_ROSS1 RecName: Full=Octanoyltransferase;       
   10::201     2e-38  46%  251 aa  LIPB_ACIBL RecName: Full=Octanoyltransferase;       
    9::174     9e-38  49%  209 aa  LIPB_PELPD RecName: Full=Octanoyltransferase;       
   11::212     2e-37  44%  235 aa  LIPB_CALS8 RecName: Full=Octanoyltransferase;       
   11::206     5e-37  46%  221 aa  LIPB_BACFR RecName: Full=Octanoyltransferase;       
   12::172     8e-37  51%  222 aa  LIPB_GLOVI RecName: Full=Octanoyltransferase;       
   11::206     2e-36  46%  221 aa  LIPB_BACFN RecName: Full=Octanoyltransferase;       
   11::218     2e-36  43%  227 aa  LIPB_BACTN RecName: Full=Octanoyltransferase;       
   11::206     3e-36  45%  217 aa  LIPB_THET8 RecName: Full=Octanoyltransferase;       
   11::206     3e-36  45%  217 aa  LIPB_THET2 RecName: Full=Octanoyltransferase;       
   31::187     3e-36  50%  213 aa  LIPB_GEOMG RecName: Full=Octanoyltransferase;       
   16::210     4e-36  44%  222 aa  LIPB_NOVAD RecName: Full=Octanoyltransferase;       
   15::205     7e-36  50%  232 aa  LIPB_FLAJ1 RecName: Full=Octanoyltransferase;       
  268::470     9e-36  46%  492 aa  LIPB_PORGI RecName: Full=Octanoyltransferase;       
    3::172     9e-36  46%  227 aa  LIPB_GEOSL RecName: Full=Octanoyltransferase;       
   15::229     1e-35  44%  234 aa  LIPB_GRAFK RecName: Full=Octanoyltransferase;       
    7::213     1e-35  43%  228 aa  LIPB_ANATD RecName: Full=Octanoyltransferase;       
   17::232     3e-35  43%  244 aa  LIPB_CYTH3 RecName: Full=Octanoyltransferase;       
   36::196     4e-35  50%  224 aa  LIPB_DANRE RecName: Full=Putative octanoyltransferase,
   11::200     6e-35  46%  246 aa  LIPB_ACIC5 RecName: Full=Octanoyltransferase;       
    9::199     7e-35  43%  211 aa  LIPB_PELCD RecName: Full=Octanoyltransferase;       
    9::185     2e-34  47%  212 aa  LIPB_MAGSA RecName: Full=Octanoyltransferase;       
   16::235     2e-34  44%  241 aa  LIPB_NITHX RecName: Full=Octanoyltransferase;       
    7::184     3e-34  46%  233 aa  LIPB_SYNP6 RecName: Full=Octanoyltransferase;       
    7::184     3e-34  46%  233 aa  LIPB_SYNE7 RecName: Full=Octanoyltransferase;       
   13::190     6e-34  47%  230 aa  LIPB_NOSP7 RecName: Full=Octanoyltransferase;       
    9::182     1e-33  45%  214 aa  LIPB_GEOUR RecName: Full=Octanoyltransferase;       
   12::184     2e-33  45%  228 aa  LIPB_THETN RecName: Full=Octanoyltransferase;       
    6::215     2e-33  45%  221 aa  LIPB_PARD8 RecName: Full=Octanoyltransferase;       
   20::190     2e-33  48%  221 aa  LIPB_ANAVT RecName: Full=Octanoyltransferase;       
   16::209     2e-33  43%  221 aa  LIPB_TRIEI RecName: Full=Octanoyltransferase;       
   55::235     2e-33  45%  278 aa  LIP2P_ARATH RecName: Full=Plastidial lipoyltransferase 2;       
   28::202     3e-33  50%  239 aa  LIPB_XENTR RecName: Full=Putative octanoyltransferase,
    1::216     4e-33  42%  216 aa  LIPB_JANSC RecName: Full=Octanoyltransferase;       
   13::194     4e-33  43%  232 aa  LIPB_DICT6 RecName: Full=Octanoyltransferase;       
   12::206     7e-33  44%  220 aa  LIPB_SOLUE RecName: Full=Octanoyltransferase;       
   14::213     9e-33  47%  260 aa  LIPB_SYNJA RecName: Full=Octanoyltransferase;       
   15::228     3e-32  41%  235 aa  LIPB_ARATH RecName: Full=Octanoyltransferase;       
   21::204     4e-32  47%  262 aa  LIPB_SYNJB RecName: Full=Octanoyltransferase;       
   20::190     4e-32  46%  221 aa  LIPB_ANASP RecName: Full=Octanoyltransferase;       
   14::184     6e-32  45%  226 aa  LIPB_THEEB RecName: Full=Octanoyltransferase;       
   34::210     8e-32  45%  217 aa  LIPB_SPHAL RecName: Full=Octanoyltransferase;       
   10::181     1e-31  41%  209 aa  LIPB_NEOSM RecName: Full=Octanoyltransferase;       
   18::215     2e-31  42%  234 aa  LIPB_DROME RecName: Full=Putative octanoyltransferase,
   13::203     2e-31  41%  218 aa  LIPB_ALKMQ RecName: Full=Octanoyltransferase;       
    9::184     3e-31  42%  209 aa  LIPB_RICBR RecName: Full=Octanoyltransferase;       
    9::184     3e-31  42%  209 aa  LIPB_RICB8 RecName: Full=Octanoyltransferase;       
   27::231     3e-31  43%  231 aa  LIPB_NITWN RecName: Full=Octanoyltransferase;       
   28::184     4e-31  46%  209 aa  LIPB_RICPU RecName: Full=Octanoyltransferase;       
   28::233     4e-31  42%  246 aa  LIPB_MESSB RecName: Full=Octanoyltransferase;       
   21::227     4e-31  40%  241 aa  LIPB_BURPP RecName: Full=Octanoyltransferase;       
   57::232     5e-31  43%  280 aa  LIPBL_ARATH RecName: Full=Putative lipoyltransferase-like protein,
   19::223     6e-31  43%  225 aa  LIPB_PARL1 RecName: Full=Octanoyltransferase;       
   14::184     1e-30  47%  227 aa  LIPB_SYNY3 RecName: Full=Octanoyltransferase;       
   13::184     1e-30  43%  209 aa  LIPB_RICCN RecName: Full=Octanoyltransferase;       
    7::206     1e-30  40%  216 aa  LIPB_RHORT RecName: Full=Octanoyltransferase;       
   17::182     1e-30  45%  212 aa  LIPB_MAGSM RecName: Full=Octanoyltransferase;       
   29::205     2e-30  44%  246 aa  LIPB_SYNPW RecName: Full=Octanoyltransferase;       
   15::186     2e-30  42%  211 aa  LIPB_RICM5 RecName: Full=Octanoyltransferase;       
   13::184     2e-30  43%  209 aa  LIPB_RICAE RecName: Full=Octanoyltransferase;       
   28::184     3e-30  46%  209 aa  LIPB_RICRS RecName: Full=Octanoyltransferase;       
   28::184     3e-30  46%  209 aa  LIPB_RICRO RecName: Full=Octanoyltransferase;       
   43::213     3e-30  49%  232 aa  LIPB_GLUDA RecName: Full=Octanoyltransferase;       
   30::210     4e-30  45%  245 aa  LIPB_RHOPA RecName: Full=Octanoyltransferase;       
   15::200     5e-30  46%  232 aa  LIPB_FLAPJ RecName: Full=Octanoyltransferase;       
   13::184     7e-30  42%  209 aa  LIPB_RICPR RecName: Full=Octanoyltransferase;       
   35::215     9e-30  45%  216 aa  LIPB_SILPO RecName: Full=Octanoyltransferase;       
   76::229     9e-30  46%  256 aa  LIPB_SALRD RecName: Full=Octanoyltransferase;       
   28::184     9e-30  46%  209 aa  LIPB_RICFE RecName: Full=Octanoyltransferase;       
   33::184     9e-30  46%  209 aa  LIPB_RICCK RecName: Full=Octanoyltransferase;       
   58::231     9e-30  47%  234 aa  LIPB_RHOP5 RecName: Full=Octanoyltransferase;       
   12::188     9e-30  44%  223 aa  LIPB_DESPS RecName: Full=Octanoyltransferase;       
   15::206     1e-29  39%  228 aa  LIPB_SYNFM RecName: Full=Octanoyltransferase;       
   78::259     1e-29  44%  264 aa  LIPB_BRUME RecName: Full=Octanoyltransferase;       
   78::259     1e-29  44%  264 aa  LIPB_BRUMB RecName: Full=Octanoyltransferase;       
   81::262     1e-29  44%  267 aa  LIPB_BRUAB RecName: Full=Octanoyltransferase;       
   81::262     1e-29  44%  267 aa  LIPB_BRUA2 RecName: Full=Octanoyltransferase;       
   36::232     2e-29  41%  262 aa  LIPB_SINMW RecName: Full=Octanoyltransferase;       
   28::184     2e-29  46%  209 aa  LIPB_RICAH RecName: Full=Octanoyltransferase;       
   11::170     2e-29  47%  228 aa  LIPB_PYRCJ RecName: Full=Probable octanoyltransferase;       
   40::187     2e-29  46%  219 aa  LIPB_ERYLH RecName: Full=Octanoyltransferase;       
   81::262     2e-29  44%  267 aa  LIPB_BRUSU RecName: Full=Octanoyltransferase;       
   11::202     3e-29  42%  234 aa  LIPB_HYPNA RecName: Full=Octanoyltransferase;       
   28::191     4e-29  41%  232 aa  LIPB_SYNSC RecName: Full=Octanoyltransferase;       
   33::184     4e-29  46%  209 aa  LIPB_RICTY RecName: Full=Octanoyltransferase;       
   30::201     4e-29  45%  220 aa  LIPB_DINSH RecName: Full=Octanoyltransferase;       
   29::199     5e-29  42%  231 aa  LIPB_SYNPX RecName: Full=Octanoyltransferase;       
   30::210     5e-29  44%  245 aa  LIPB_RHOPT RecName: Full=Octanoyltransferase;       
    8::184     5e-29  43%  228 aa  LIPB_DESRM RecName: Full=Octanoyltransferase;       
    5::196     6e-29  41%  224 aa  LIPB_PYRAE RecName: Full=Probable octanoyltransferase;       
   10::191     6e-29  39%  208 aa  LIPB_ORITB RecName: Full=Octanoyltransferase;       
   12::199     6e-29  40%  217 aa  LIPB_HALHL RecName: Full=Octanoyltransferase;       
    7::173     8e-29  40%  225 aa  LIPB_BURPS RecName: Full=Octanoyltransferase;       
   34::200     8e-29  40%  252 aa  LIPB_BURP6 RecName: Full=Octanoyltransferase;       
   36::202     8e-29  40%  254 aa  LIPB_BURP1 RecName: Full=Octanoyltransferase;       
   28::194     8e-29  40%  246 aa  LIPB_BURP0 RecName: Full=Octanoyltransferase;       
   31::197     8e-29  40%  249 aa  LIPB_BURMS RecName: Full=Octanoyltransferase;       
    7::173     8e-29  40%  225 aa  LIPB_BURMA RecName: Full=Octanoyltransferase;       
   31::197     8e-29  40%  249 aa  LIPB_BURM9 RecName: Full=Octanoyltransferase;       
   31::197     8e-29  40%  249 aa  LIPB_BURM7 RecName: Full=Octanoyltransferase;       
   31::216     8e-29  40%  231 aa  LIPB_AZOSE RecName: Full=Octanoyltransferase;       
   29::206     8e-29  42%  227 aa  LIPB_AZOSB RecName: Full=Octanoyltransferase;       
   10::191     1e-28  39%  208 aa  LIPB_ORITI RecName: Full=Octanoyltransferase;       
    9::221     1e-28  40%  226 aa  LIPB_VARPS RecName: Full=Octanoyltransferase;       
   11::183     1e-28  44%  237 aa  LIPB_DESDA RecName: Full=Octanoyltransferase;       
   26::235     1e-28  38%  241 aa  LIPB_BARBK RecName: Full=Octanoyltransferase;       
    5::196     2e-28  41%  221 aa  LIPB_FRASC RecName: Full=Octanoyltransferase;       
   28::192     3e-28  44%  229 aa  LIPB_XYLFA RecName: Full=Octanoyltransferase;       
    4::172     3e-28  48%  213 aa  LIPB_BORPD RecName: Full=Octanoyltransferase;       
   36::201     4e-28  44%  218 aa  LIPB_PARDP RecName: Full=Octanoyltransferase;       
   35::239     4e-28  39%  245 aa  LIPB_BARQU RecName: Full=Octanoyltransferase;       
   41::210     5e-28  41%  223 aa  LIPB_SPHWW RecName: Full=Octanoyltransferase;       
   10::209     5e-28  45%  231 aa  LIPB_MOUSE RecName: Full=Putative octanoyltransferase,
   13::212     5e-28  36%  232 aa  LIPB_DICTD RecName: Full=Octanoyltransferase;       
    9::183     5e-28  44%  218 aa  LIPB_DESDG RecName: Full=Octanoyltransferase;       
   13::208     5e-28  37%  233 aa  LIPB_CLOK5 RecName: Full=Octanoyltransferase;       
   37::220     5e-28  38%  255 aa  LIPB_BURTA RecName: Full=Octanoyltransferase;       
   61::214     7e-28  41%  357 aa  LIPB_MYXXA RecName: Full=Octanoyltransferase;       
   55::232     7e-28  46%  240 aa  LIPB_BRASO RecName: Full=Octanoyltransferase;       
   28::192     9e-28  41%  229 aa  LIPB_XYLFT RecName: Full=Octanoyltransferase;       
   30::237     1e-27  36%  251 aa  LIPB_BURVG RecName: Full=Octanoyltransferase;       
   36::232     1e-27  41%  252 aa  LIPB_RHIME RecName: Full=Octanoyltransferase;       
   35::239     1e-27  38%  245 aa  LIPB_BART1 RecName: Full=Octanoyltransferase;       
    9::184     2e-27  44%  218 aa  LIPB_DESVM RecName: Full=Octanoyltransferase;       
   40::226     3e-27  43%  226 aa  LIPB_MARMM RecName: Full=Octanoyltransferase;       
   40::237     3e-27  37%  252 aa  LIPB_BURS3 RecName: Full=Octanoyltransferase;       
    3::191     3e-27  41%  208 aa  LIPB_EHRRW RecName: Full=Octanoyltransferase;       
    3::191     3e-27  41%  208 aa  LIPB_EHRRG RecName: Full=Octanoyltransferase;       
   16::206     3e-27  35%  215 aa  LIPB_CELJU RecName: Full=Octanoyltransferase;       
   17::217     3e-27  39%  226 aa  LIPB_CAUCR RecName: Full=Octanoyltransferase;       
   27::237     4e-27  35%  251 aa  LIPB_BURCA RecName: Full=Octanoyltransferase;       
    1::212     6e-27  35%  212 aa  LIPB_MARAV RecName: Full=Octanoyltransferase;       
   34::181     7e-27  44%  205 aa  LIPB_WOLPP RecName: Full=Octanoyltransferase;       
   55::232     7e-27  44%  240 aa  LIPB_BRASB RecName: Full=Octanoyltransferase;       
   12::200     1e-26  38%  228 aa  LIPB_THEPX RecName: Full=Octanoyltransferase;       
   12::200     1e-26  38%  228 aa  LIPB_THEP3 RecName: Full=Octanoyltransferase;       
   31::185     1e-26  44%  218 aa  LIPB_DESVV RecName: Full=Octanoyltransferase;       
   31::185     1e-26  44%  218 aa  LIPB_DESVH RecName: Full=Octanoyltransferase;       
   90::297     1e-26  37%  336 aa  LIPB_DEIRA RecName: Full=Octanoyltransferase;       
   44::191     1e-26  41%  232 aa  LIPB_XANOR RecName: Full=Octanoyltransferase;       
   44::191     1e-26  41%  232 aa  LIPB_XANOM RecName: Full=Octanoyltransferase;       
   48::191     1e-26  43%  253 aa  LIPB_RALEJ RecName: Full=Octanoyltransferase;       
   27::237     1e-26  35%  251 aa  LIPB_BURCH RecName: Full=Octanoyltransferase;       
   35::213     1e-26  40%  245 aa  LIPB_BARHE RecName: Full=Octanoyltransferase;       
   12::223     1e-26  36%  234 aa  LIPB_AERHH RecName: Full=Octanoyltransferase;       
   28::237     2e-26  40%  255 aa  LIPB_RHOP2 RecName: Full=Octanoyltransferase;       
   11::203     2e-26  35%  214 aa  LIPB_POLSQ RecName: Full=Octanoyltransferase;       
   29::215     2e-26  43%  224 aa  LIPB_POLNA RecName: Full=Octanoyltransferase;       
    9::188     2e-26  40%  204 aa  LIPB_GEOSM RecName: Full=Octanoyltransferase;       
   13::192     2e-26  39%  220 aa  LIPB_CHRSD RecName: Full=Octanoyltransferase;       
   34::237     2e-26  36%  251 aa  LIPB_BURCM RecName: Full=Octanoyltransferase;       
   34::237     3e-26  36%  251 aa  LIPB_BURA4 RecName: Full=Octanoyltransferase;       
   11::182     4e-26  38%  212 aa  LIPB_PYRAR RecName: Full=Probable octanoyltransferase;       
   11::167     4e-26  39%  205 aa  LIPB_DECAR RecName: Full=Octanoyltransferase;       
   28::191     5e-26  38%  232 aa  LIPB_XANCB RecName: Full=Octanoyltransferase;       
   26::211     5e-26  39%  215 aa  LIPB_NITMU RecName: Full=Octanoyltransferase;       
   31::197     5e-26  38%  248 aa  LIPB_BURCC RecName: Full=Octanoyltransferase;       
   10::214     5e-26  36%  225 aa  LIPB_AERS4 RecName: Full=Octanoyltransferase;       
   28::191     6e-26  38%  232 aa  LIPB_XANCP RecName: Full=Octanoyltransferase;       
   28::191     6e-26  38%  232 aa  LIPB_XANC8 RecName: Full=Octanoyltransferase;       
   15::213     6e-26  34%  218 aa  LIPB_AZOVD RecName: Full=Octanoyltransferase;       
   27::181     8e-26  41%  227 aa  LIPB_SHEDO RecName: Full=Octanoyltransferase;       
   26::202     8e-26  42%  233 aa  LIPB_GLUOX RecName: Full=Octanoyltransferase;       
   36::234     8e-26  35%  248 aa  LIPB_BURM1 RecName: Full=Octanoyltransferase;       
   28::191     1e-25  38%  232 aa  LIPB_XANC5 RecName: Full=Octanoyltransferase;       
   20::173     1e-25  41%  229 aa  LIPB_RALPJ RecName: Full=Octanoyltransferase;       
   14::209     1e-25  44%  231 aa  LIPB_HUMAN RecName: Full=Putative octanoyltransferase,
    2::170     1e-25  38%  219 aa  LIPB_SHEWM RecName: Full=Octanoyltransferase;       
   28::237     1e-25  40%  255 aa  LIPB_RHOPS RecName: Full=Octanoyltransferase;       
   33::173     1e-25  45%  229 aa  LIPB_RALSO RecName: Full=Octanoyltransferase;       
   13::213     1e-25  35%  214 aa  LIPB_MARMS RecName: Full=Octanoyltransferase;       
   35::185     1e-25  44%  208 aa  LIPB_ANAPZ RecName: Full=Octanoyltransferase;       
    9::230     1e-25  40%  231 aa  LIPB_ACIAC RecName: Full=Octanoyltransferase;       
   28::191     2e-25  37%  232 aa  LIPB_XANAC RecName: Full=Octanoyltransferase;       
    2::170     2e-25  40%  219 aa  LIPB_SHESH RecName: Full=Octanoyltransferase;       
   13::177     2e-25  41%  207 aa  LIPB_METCA RecName: Full=Octanoyltransferase;       
   15::198     2e-25  37%  216 aa  LIPB_ZYMMO RecName: Full=Octanoyltransferase;       
   27::189     2e-25  41%  229 aa  LIPB_SYNS9 RecName: Full=Octanoyltransferase;       
   34::181     3e-25  43%  205 aa  LIPB_WOLTR RecName: Full=Octanoyltransferase;       
   52::191     3e-25  43%  243 aa  LIPB_PROMM RecName: Full=Octanoyltransferase;       
   11::181     3e-25  36%  206 aa  LIPB_PELUB RecName: Full=Octanoyltransferase;       
   42::240     3e-25  41%  241 aa  LIPB_DELAS RecName: Full=Octanoyltransferase;       
   49::245     3e-25  39%  268 aa  LIPB_AGRT5 RecName: Full=Octanoyltransferase;       
   26::231     4e-25  39%  247 aa  LIPB_RHOPB RecName: Full=Octanoyltransferase;       
   14::213     4e-25  33%  219 aa  LIPB_PSEU5 RecName: Full=Octanoyltransferase;       
   11::223     4e-25  35%  224 aa  LIPB_METPP RecName: Full=Octanoyltransferase;       
   35::170     5e-25  41%  216 aa  LIPB_SHEAM RecName: Full=Octanoyltransferase;       
   40::188     5e-25  41%  204 aa  LIPB_GEOBB RecName: Full=Octanoyltransferase;       
   38::186     5e-25  44%  214 aa  LIPB_EHRCR RecName: Full=Octanoyltransferase;       
    4::219     5e-25  39%  220 aa  LIPB_BORPE RecName: Full=Octanoyltransferase;       
    4::219     5e-25  39%  220 aa  LIPB_BORBR RecName: Full=Octanoyltransferase;       
   16::170     7e-25  38%  217 aa  LIPB_SHESR RecName: Full=Octanoyltransferase;       
   16::170     7e-25  38%  217 aa  LIPB_SHESM RecName: Full=Octanoyltransferase;       
    9::194     7e-25  33%  214 aa  LIPB_DESAD RecName: Full=Octanoyltransferase;       
    4::200     7e-25  40%  220 aa  LIPB_BORPA RecName: Full=Octanoyltransferase;       
   19::182     7e-25  40%  215 aa  LIPB_ALHEH RecName: Full=Octanoyltransferase;       
   25::181     1e-24  43%  205 aa  LIPB_WOLPM RecName: Full=Octanoyltransferase;       
   38::172     1e-24  42%  218 aa  LIPB_SHELP RecName: Full=Octanoyltransferase;       
   17::212     1e-24  33%  216 aa  LIPB_SACD2 RecName: Full=Octanoyltransferase;       
   27::217     2e-24  38%  218 aa  LIPB_THIDA RecName: Full=Octanoyltransferase;       
   16::170     2e-24  38%  217 aa  LIPB_SHESA RecName: Full=Octanoyltransferase;       
   18::172     2e-24  38%  219 aa  LIPB_SHEON RecName: Full=Octanoyltransferase;       
   16::170     2e-24  38%  216 aa  LIPB_SHEFN RecName: Full=Octanoyltransferase;       
    9::174     2e-24  39%  207 aa  LIPB_NEIMB RecName: Full=Octanoyltransferase;       
    9::174     2e-24  39%  207 aa  LIPB_NEIM0 RecName: Full=Octanoyltransferase;       
    9::174     2e-24  39%  207 aa  LIPB_NEIG2 RecName: Full=Octanoyltransferase;       
    9::174     2e-24  39%  207 aa  LIPB_NEIG1 RecName: Full=Octanoyltransferase;       
   21::227     2e-24  35%  241 aa  LIPB_BURXL RecName: Full=Octanoyltransferase;       
   33::225     2e-24  39%  249 aa  LIPB_BRAJA RecName: Full=Octanoyltransferase;       
   16::170     3e-24  38%  217 aa  LIPB_SHESW RecName: Full=Octanoyltransferase;       
   18::172     3e-24  38%  219 aa  LIPB_SHEPC RecName: Full=Octanoyltransferase;       
   11::248     3e-24  42%  251 aa  LIPB_POLSJ RecName: Full=Octanoyltransferase;       
    3::138     3e-24  44%  155 aa  LIPB_PARVE RecName: Full=Octanoyltransferase;       
    9::174     3e-24  39%  207 aa  LIPB_NEIMA RecName: Full=Octanoyltransferase;       
    9::175     3e-24  39%  207 aa  LIPB_LARHH RecName: Full=Octanoyltransferase;       
    7::208     3e-24  36%  217 aa  LIPB_BORA1 RecName: Full=Octanoyltransferase;       
   21::210     4e-24  43%  231 aa  LIPB_VEREI RecName: Full=Octanoyltransferase;       
   36::191     4e-24  40%  219 aa  LIPB_SCHPO RecName: Full=Probable octanoyltransferase;       
   57::242     4e-24  38%  255 aa  LIPB_BURP8 RecName: Full=Octanoyltransferase;       
   15::169     6e-24  40%  218 aa  LIPB_VIBVY RecName: Full=Octanoyltransferase;       
   15::169     6e-24  40%  218 aa  LIPB_VIBVU RecName: Full=Octanoyltransferase;       
    9::174     6e-24  38%  207 aa  LIPB_NEIMF RecName: Full=Octanoyltransferase;       
   11::175     6e-24  39%  199 aa  LIPB_LEGPL RecName: Full=Octanoyltransferase;       
   11::175     6e-24  39%  199 aa  LIPB_LEGPH RecName: Full=Octanoyltransferase;       
   20::194     6e-24  39%  246 aa  LIPB_ALCBS RecName: Full=Octanoyltransferase;       
   11::175     8e-24  38%  199 aa  LIPB_LEGPA RecName: Full=Octanoyltransferase;       
    5::185     8e-24  41%  214 aa  LIPB_EHRCJ RecName: Full=Octanoyltransferase;       
   32::179     1e-23  39%  213 aa  LIPB_ENT38 RecName: Full=Octanoyltransferase;       
   36::170     1e-23  41%  219 aa  LIPB_SHEHH RecName: Full=Octanoyltransferase;       
   30::236     1e-23  40%  239 aa  LIPB_RHIL3 RecName: Full=Octanoyltransferase;       
    3::203     1e-23  34%  205 aa  LIPB_PSEMY RecName: Full=Octanoyltransferase;       
   52::230     1e-23  43%  244 aa  LIPB_OLICO RecName: Full=Octanoyltransferase;       
   11::175     1e-23  39%  199 aa  LIPB_LEGPC RecName: Full=Octanoyltransferase;       
   36::170     2e-23  41%  219 aa  LIPB_SHEPA RecName: Full=Octanoyltransferase;       
    4::209     2e-23  38%  230 aa  LIPB_RHOFD RecName: Full=Octanoyltransferase;       
   15::179     2e-23  37%  215 aa  LIPB_PSEF5 RecName: Full=Octanoyltransferase;       
   39::210     2e-23  36%  244 aa  LIPB_PROM1 RecName: Full=Octanoyltransferase;       
   28::219     2e-23  36%  225 aa  LIPB_NITEC RecName: Full=Octanoyltransferase;       
   13::179     2e-23  36%  218 aa  LIPB_PSEU2 RecName: Full=Octanoyltransferase;       
   39::210     2e-23  36%  239 aa  LIPB_PROMT RecName: Full=Octanoyltransferase;       
   15::194     3e-23  36%  220 aa  LIPB_VIBHB RecName: Full=Octanoyltransferase;       
   36::170     3e-23  40%  217 aa  LIPB_SHEB9 RecName: Full=Octanoyltransferase;       
   36::170     3e-23  40%  217 aa  LIPB_SHEB8 RecName: Full=Octanoyltransferase;       
   36::170     3e-23  40%  217 aa  LIPB_SHEB5 RecName: Full=Octanoyltransferase;       
   36::170     3e-23  40%  217 aa  LIPB_SHEB2 RecName: Full=Octanoyltransferase;       
   38::172     5e-23  40%  220 aa  LIPB_SHEPW RecName: Full=Octanoyltransferase;       
   31::192     5e-23  41%  218 aa  LIPB_RHOS5 RecName: Full=Octanoyltransferase;       
    6::184     5e-23  35%  216 aa  LIPB_PSYIN RecName: Full=Octanoyltransferase;       
   13::179     5e-23  36%  218 aa  LIPB_PSESM RecName: Full=Octanoyltransferase;       
   15::179     5e-23  35%  215 aa  LIPB_PSEPF RecName: Full=Octanoyltransferase;       
   13::179     5e-23  36%  218 aa  LIPB_PSE14 RecName: Full=Octanoyltransferase;       
   39::184     5e-23  39%  214 aa  LIPB_PROM5 RecName: Full=Octanoyltransferase;       
   32::178     5e-23  40%  214 aa  LIPB_PHOPR RecName: Full=Octanoyltransferase;       
   52::233     6e-23  40%  247 aa  LIPB_RHILO RecName: Full=Octanoyltransferase;       
   32::170     6e-23  41%  213 aa  LIPB_CITK8 RecName: Full=Octanoyltransferase;       
   15::169     8e-23  38%  220 aa  LIPB_VIBPA RecName: Full=Octanoyltransferase;       
   52::220     8e-23  42%  239 aa  LIPB_RHIEC RecName: Full=Octanoyltransferase;       
   48::191     8e-23  39%  268 aa  LIPB_RALEH RecName: Full=Octanoyltransferase;       
   14::178     8e-23  37%  215 aa  LIPB_PSEE4 RecName: Full=Octanoyltransferase;       
   13::197     8e-23  34%  214 aa  LIPB_POLNS RecName: Full=Octanoyltransferase;       
   14::212     8e-23  32%  221 aa  LIPB_IDILO RecName: Full=Octanoyltransferase;       
   11::176     8e-23  36%  200 aa  LIPB_DICNV RecName: Full=Octanoyltransferase;       
   32::207     1e-22  35%  222 aa  LIPB_SERP5 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_SHISS RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_SHIDS RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_SHIBS RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_SHIB3 RecName: Full=Octanoyltransferase;       
   14::178     1e-22  37%  215 aa  LIPB_PSEPW RecName: Full=Octanoyltransferase;       
   20::185     1e-22  36%  224 aa  LIPB_HAHCH RecName: Full=Octanoyltransferase;       
   32::182     1e-22  37%  223 aa  LIPB_ERWT9 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECOUT RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECOSE RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECOLI RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECOLC RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECOL6 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECOL5 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECOK1 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECOHS RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECOBW RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECO8A RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECO81 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECO5E RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECO57 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECO55 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECO45 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECO27 RecName: Full=Octanoyltransferase;       
   32::170     1e-22  41%  213 aa  LIPB_ECO24 RecName: Full=Octanoyltransferase;       
   35::213     1e-22  35%  245 aa  LIPB2_PICTO RecName: Full=Probable octanoyltransferase 2;       
   36::208     2e-22  36%  233 aa  LIPB_YERPY RecName: Full=Octanoyltransferase;       
   36::208     2e-22  37%  233 aa  LIPB_YERP3 RecName: Full=Octanoyltransferase;       
   12::177     2e-22  35%  203 aa  LIPB_PERMH RecName: Full=Octanoyltransferase;       
   14::194     2e-22  36%  204 aa  LIPB_NITEU RecName: Full=Octanoyltransferase;       
   16::175     2e-22  38%  218 aa  LIPB_HAES1 RecName: Full=Octanoyltransferase;       
   15::214     2e-22  34%  220 aa  LIPB_ACTSZ RecName: Full=Octanoyltransferase;       
   36::208     2e-22  36%  233 aa  LIPB_YERPS RecName: Full=Octanoyltransferase;       
   36::208     2e-22  36%  233 aa  LIPB_YERPP RecName: Full=Octanoyltransferase;       
   36::208     2e-22  36%  233 aa  LIPB_YERPN RecName: Full=Octanoyltransferase;       
   36::208     2e-22  36%  233 aa  LIPB_YERPE RecName: Full=Octanoyltransferase;       
   36::208     2e-22  36%  233 aa  LIPB_YERPB RecName: Full=Octanoyltransferase;       
   36::208     2e-22  36%  233 aa  LIPB_YERPA RecName: Full=Octanoyltransferase;       
   15::179     2e-22  35%  215 aa  LIPB_PSEFS RecName: Full=Octanoyltransferase;       
   36::179     2e-22  38%  214 aa  LIPB_KLEP3 RecName: Full=Octanoyltransferase;       
   36::170     3e-22  41%  213 aa  LIPB_SHIFL RecName: Full=Octanoyltransferase;       
   36::170     3e-22  41%  213 aa  LIPB_SHIF8 RecName: Full=Octanoyltransferase;       
   36::180     3e-22  38%  213 aa  LIPB_SALTY RecName: Full=Octanoyltransferase;       
   36::180     3e-22  38%  213 aa  LIPB_SALTI RecName: Full=Octanoyltransferase;       
   36::180     3e-22  38%  213 aa  LIPB_SALPA RecName: Full=Octanoyltransferase;       
   14::158     3e-22  38%  191 aa  LIPB_SALCH RecName: Full=Octanoyltransferase;       
   36::170     3e-22  41%  213 aa  LIPB_ECOSM RecName: Full=Octanoyltransferase;       
   36::170     3e-22  41%  213 aa  LIPB_ECOLU RecName: Full=Octanoyltransferase;       
   36::170     3e-22  41%  213 aa  LIPB_ECO7I RecName: Full=Octanoyltransferase;       
   28::227     3e-22  34%  235 aa  LIPB_COLP3 RecName: Full=Octanoyltransferase;       
   35::169     4e-22  41%  225 aa  LIPB_VIBF1 RecName: Full=Octanoyltransferase;       
   11::201     4e-22  36%  207 aa  LIPB_CHRVO RecName: Full=Octanoyltransferase;       
   41::184     7e-22  38%  214 aa  LIPB_PROMP RecName: Full=Octanoyltransferase;       
   36::179     7e-22  38%  214 aa  LIPB_KLEP7 RecName: Full=Octanoyltransferase;       
    1::212     9e-22  34%  218 aa  LIPB_PASMU RecName: Full=Octanoyltransferase;       
   13::182     9e-22  35%  224 aa  LIPB_HAEDU RecName: Full=Octanoyltransferase;       
   13::178     9e-22  35%  242 aa  LIPB_COXBU RecName: Full=Octanoyltransferase;       
   40::188     9e-22  40%  214 aa  LIPB_ANAMM RecName: Full=Octanoyltransferase;       
   40::188     9e-22  40%  214 aa  LIPB_ANAMF RecName: Full=Octanoyltransferase;       
    3::169     1e-21  38%  216 aa  LIPB_VIBCH RecName: Full=Octanoyltransferase;       
    3::169     1e-21  38%  216 aa  LIPB_VIBC3 RecName: Full=Octanoyltransferase;       
   12::180     1e-21  35%  209 aa  LIPB_THICR RecName: Full=Octanoyltransferase;       
   13::178     1e-21  35%  242 aa  LIPB_COXBR RecName: Full=Octanoyltransferase;       
   13::178     1e-21  35%  242 aa  LIPB_COXB2 RecName: Full=Octanoyltransferase;       
   46::196     1e-21  46%  228 aa  LIPB_ACICJ RecName: Full=Octanoyltransferase;       
    4::212     2e-21  33%  217 aa  LIPB_PSEAE RecName: Full=Octanoyltransferase;       
    4::212     2e-21  33%  217 aa  LIPB_PSEAB RecName: Full=Octanoyltransferase;       
    4::212     2e-21  33%  217 aa  LIPB_PSEA8 RecName: Full=Octanoyltransferase;       
    4::212     2e-21  33%  217 aa  LIPB_PSEA7 RecName: Full=Octanoyltransferase;       
    1::215     2e-21  31%  217 aa  LIPB_PSEA6 RecName: Full=Octanoyltransferase;       
   35::183     2e-21  39%  227 aa  LIPB_PECCP RecName: Full=Octanoyltransferase;       
   13::178     2e-21  35%  242 aa  LIPB_COXBN RecName: Full=Octanoyltransferase;       
   35::183     2e-21  39%  227 aa  LIPB_ERWCT RecName: Full=Octanoyltransferase;       
   52::220     3e-21  41%  239 aa  LIPB_RHIE6 RecName: Full=Octanoyltransferase;       
   15::169     5e-21  36%  219 aa  LIPB_VIBSL RecName: Full=Octanoyltransferase;       
   15::179     5e-21  37%  216 aa  LIPB_PSEPK RecName: Full=Octanoyltransferase;       
   14::178     5e-21  37%  215 aa  LIPB_PSEP1 RecName: Full=Octanoyltransferase;       
   16::175     5e-21  36%  218 aa  LIPB_HAES2 RecName: Full=Octanoyltransferase;       
   12::206     5e-21  32%  219 aa  LIPB_BDEBA RecName: Full=Octanoyltransferase;       
   17::191     5e-21  34%  215 aa  LIPB1_PICTO RecName: Full=Probable octanoyltransferase 1;       
   15::170     6e-21  36%  212 aa  LIPB_HAEIG RecName: Full=Octanoyltransferase;       
   15::170     6e-21  36%  212 aa  LIPB_HAEIE RecName: Full=Octanoyltransferase;       
   15::170     6e-21  36%  212 aa  LIPB_HAEI8 RecName: Full=Octanoyltransferase;       
    1::182     6e-21  33%  230 aa  LIPB_ACTPJ RecName: Full=Octanoyltransferase;       
    1::182     6e-21  33%  218 aa  LIPB_ACTP7 RecName: Full=Octanoyltransferase;       
    1::182     6e-21  33%  218 aa  LIPB_ACTP2 RecName: Full=Octanoyltransferase;       
   14::178     8e-21  36%  215 aa  LIPB_PSEPG RecName: Full=Octanoyltransferase;       
   39::174     8e-21  39%  213 aa  LIPB_PHOLL RecName: Full=Octanoyltransferase;       
   13::178     8e-21  34%  242 aa  LIPB_COXB1 RecName: Full=Octanoyltransferase;       
   36::185     2e-20  37%  237 aa  LIPB_YERE8 RecName: Full=Octanoyltransferase;       
   15::210     2e-20  31%  221 aa  LIPB_MANSM RecName: Full=Octanoyltransferase;       
   34::215     2e-20  36%  216 aa  LIPB_HERAR RecName: Full=Octanoyltransferase;       
   36::179     2e-20  33%  211 aa  LIPB_BUCAI RecName: Full=Octanoyltransferase;       
   40::175     2e-20  39%  219 aa  LIPB_ACIAD RecName: Full=Octanoyltransferase;       
   40::192     2e-20  43%  218 aa  LIPB_RHOS1 RecName: Full=Octanoyltransferase;       
   41::216     2e-20  35%  216 aa  LIPB_JANMA RecName: Full=Octanoyltransferase;       
   98::322     5e-20  34%  332 aa  LIPB_KLULA RecName: Full=Octanoyltransferase, mitochondrial;       
   26::213     7e-20  36%  224 aa  LIPB_NITOC RecName: Full=Octanoyltransferase;       
   15::170     7e-20  35%  212 aa  LIPB_HAEIN RecName: Full=Octanoyltransferase;       
   40::192     9e-20  42%  218 aa  LIPB_RHOS4 RecName: Full=Octanoyltransferase;       
   38::214     9e-20  35%  217 aa  LIPB_PSEHT RecName: Full=Octanoyltransferase;       
   20::199     1e-19  35%  218 aa  LIPB_METFK RecName: Full=Octanoyltransferase;       
   11::174     2e-19  34%  204 aa  LIPB_RUTMC RecName: Full=Octanoyltransferase;       
   21::179     3e-19  36%  216 aa  LIPB_PROM9 RecName: Full=Octanoyltransferase;       
   21::179     6e-19  35%  216 aa  LIPB_PROM2 RecName: Full=Octanoyltransferase;       
   35::170     6e-19  38%  203 aa  LIPB_BUCBP RecName: Full=Octanoyltransferase;       
   27::216     6e-19  32%  227 aa  LIPB_BAUCH RecName: Full=Octanoyltransferase;       
   21::179     7e-19  36%  216 aa  LIPB_PROMS RecName: Full=Octanoyltransferase;       
   21::179     7e-19  36%  216 aa  LIPB_PROM0 RecName: Full=Octanoyltransferase;       
   97::316     1e-18  32%  328 aa  LIPB_YEAST RecName: Full=Octanoyltransferase, mitochondrial;       
   34::169     1e-18  37%  206 aa  LIPB_FRATW RecName: Full=Octanoyltransferase;       
   34::169     1e-18  37%  206 aa  LIPB_FRATT RecName: Full=Octanoyltransferase;       
   34::169     1e-18  37%  206 aa  LIPB_FRATO RecName: Full=Octanoyltransferase;       
   34::169     1e-18  37%  206 aa  LIPB_FRATN RecName: Full=Octanoyltransferase;       
   34::169     1e-18  37%  206 aa  LIPB_FRATM RecName: Full=Octanoyltransferase;       
   34::169     1e-18  37%  206 aa  LIPB_FRATH RecName: Full=Octanoyltransferase;       
   34::169     1e-18  37%  206 aa  LIPB_FRATF RecName: Full=Octanoyltransferase;       
   34::169     1e-18  37%  206 aa  LIPB_FRAT1 RecName: Full=Octanoyltransferase;       
   25::189     4e-18  36%  224 aa  LIPB_PROMA RecName: Full=Octanoyltransferase;       
   35::212     1e-17  33%  219 aa  LIPB_SODGM RecName: Full=Octanoyltransferase;       
   39::211     2e-17  35%  235 aa  LIPB_PROM4 RecName: Full=Octanoyltransferase;       
   36::210     2e-17  31%  218 aa  LIPB_BUCAP RecName: Full=Octanoyltransferase;       
   11::174     3e-17  32%  204 aa  LIPB_VESOH RecName: Full=Octanoyltransferase;       
   39::221     1e-16  38%  285 aa  LIPB_PSYCK RecName: Full=Octanoyltransferase;       
   39::222     3e-16  37%  286 aa  LIPB_PSYA2 RecName: Full=Octanoyltransferase;       
   10::181     2e-15  35%  219 aa  LIPB_LEPBL RecName: Full=Octanoyltransferase;       
   10::181     2e-15  35%  219 aa  LIPB_LEPBJ RecName: Full=Octanoyltransferase;       
   36::176     5e-15  34%  216 aa  LIPB_WIGBR RecName: Full=Octanoyltransferase;       
   10::181     3e-14  35%  216 aa  LIPB_LEPIN RecName: Full=Octanoyltransferase;       
   10::181     3e-14  35%  216 aa  LIPB_LEPIC RecName: Full=Octanoyltransferase;       
   12::120     1e-13  48%  120 aa  LIPB_PROHO RecName: Full=Octanoyltransferase;       
   37::174     3e-11  30%  214 aa  LIPB_CYACA RecName: Full=Probable octanoyltransferase;       
    1::236

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MKSVSELLYHWLGESPVPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPWDRPLTDPGAP
LIPB_THEFY      MKSVSELLYHWLGESPVPYMEGWELQRQLHKRRVADQVPDTVLLLEHEPVYTAGKRTGPWDRPLTDPGAP
LIPB_SALAI      ------------------YEAAWEEQRRLHESVVTDKHGDAVLLLEHPSVYTAGKRTEPWDRPMD--GTP
LIPB_SALTO      ------------------YEAAWEEQRRLHESVVADERGDAVLLLEHPSVYTAGKRTEPWDRPMD--GTP
LIPB_STRGG      ------------GEQAVEYTEAWQKQREVHADRFEDRVPDTCLLLEHPPVYTAGRRTAESERPLD--GTP
LIPB_STRCO      ------------GADRVEYQEAWDEQRRVHAARFVDEVPDTVLLLEHPPVYTAGRRTEDSERPLD--GTP
LIPB_ACIC1      ----------------VPYEEAWARQRELHALRVADEIPDTCLLLEHPPVYTAGKRTEDFERP-TD-GTP
LIPB_STRAW      ------------GAEAVEYQAAWDEQRRVHAARFLDEVPDTCLLLEHPPVYTAGRRTADNERPLD--GTP
LIPB_CORJK      ----------------VDYEDTWHLQANLAAQRAEEKIPDTILLLQHPPTYTAGKRTQDSDRPTN--GLP
LIPB_MYCGI      ----------WLGR--IDYQAAWDLQRELAEERIAGG-PDSLLLLEHPEVYTAGRRTLAHERPVD--GTP
LIPB_MYCVP      ----------------VDYLAAWDLQREIAEAR-AEGGPDTLLLLQHPAVYTAGRRTLPEERPAD--GTP
LIPB_LEIXX      -----------LDGSPVDYETALQLQRRLHGEVATGTTAETMLLLEHAPVYTAGKRTTDDERP-TD-GTP
LIPB_RHOOB      ----------------IGYVDAWDRQRELAAERAENLGADTLLLLEHPAVYTAGRRTEPEDRP-TD-GTP
LIPB_RHOSR      ----------------IGYVDAWDRQRELAAERAENVGTDTLLLLEHPAVYTAGRRTEPEDRP-TD-GTP
LIPB_MYCLE      ----------------VDYHIAWQLQRDLADARVAGG-PDTLLLLQHPPVYTAGRRTQPHERPNPSHGVP
LIPB_MYCLB      ----------------VDYHIAWQLQRDLADARVAGG-PDTLLLLQHPPVYTAGRRTQPHERPNPSHGVP
LIPB_MYCUA      ----------------VDYQTAWQMQRDLADARVAGG-PDTLLLLQHPAVYTAGRRTEPHERPAGDEAID
LIPB_CLAM3      -----------LSANSVPYIEALERQRALHADVVAGRAQDTVILLEHPSVYTAGRRTEPEDRPRD--GTP
LIPB_CLAMS      -----------LSANSVPYIEALERQRALHADVVAGRAQDTVILLEHPSVYTAGRRTEPDDRPRD--GTP
LIPB_MYCA1      ----------------VDYRAAWQQQRDLADARVAGG-PDTLLLLQHPAVYTAGRRTEPHERPLD--GTP
LIPB_CORGL      ----------------IDYQEAWDYQAELATRRANDEIPDQLLILEHPSVYTAGKRTQPEDLPTN--GLP
LIPB_CORGB      ----------------IDYQEAWDYQAELATRRANDEIPDQLLILEHPSVYTAGKRTQPEDLPTN--GLP
LIPB_MYCPA      ----------------VDYRAAWQQQRDLADARVAGG-PDTLLLLQHPAVYTAGRRTEPHERPLD--GTP
LIPB_MYCMM      ----------------VDYQTAWQMQRDLADARVAGG-PDTLLLLQHPAVYTAGRRTEPHERPAGAAGAE
LIPB_MYCS2      ------------------YTSAWQLQRETADARVAGG-PDTLLLLEHPPVYTAGKRTEPHERPLD--GTP
LIPB_MYCSS      ----------------VEYLDAWELQRGLVDARVAGG-SDALLLLQHPSVYTAGKRTEPHERPAD--GTP
LIPB_MYCSK      ----------------VEYLDAWELQRGLVDARVAGG-SDALLLLQHPSVYTAGKRTEPHERPAD--GTP
LIPB_MYCSJ      ----------------VEYLDAWELQRGLVDARVAGG-SDALLLLQHPSVYTAGKRTEPHERPAD--GTP
LIPB_MYCTU      ----------------VDYRTAWQLQRELADARVAGGA-DTLLLLEHPAVYTAGRRTETHERPID--GTP
LIPB_MYCTA      ----------------VDYRTAWQLQRELADARVAGGA-DTLLLLEHPAVYTAGRRTETHERPID--GTP
LIPB_KOCRD      ------LHFERIGFAPVNYRECLDLQRQVHQEVVAGSRGNTVLMVEHDPVYTAGRRTEPWD------GTE
LIPB_COREF      ----------------VDYRDSWDLQASLAEQRARDEIADQILVLEHPSVYTAGKRTQPEDLPTN--GLP
LIPB_ARTS2      ------LEFSTLGLAPVDYMKGWDTQRELHDKVVAAEAPSTVLLLEHAAVYTAGKLTEDHERPFD--GTP
LIPB_MYCBT      ----------------VDYRTAWQLQRELADARVAGGA-DTLLLLEHPAVYTAGRRTETHERPID--GTP
LIPB_MYCBP      ----------------VDYRTAWQLQRELADARVAGGA-DTLLLLEHPAVYTAGRRTETHERPID--GTP
LIPB_MYCBO      ----------------VDYRTAWQLQRELADARVAGGA-DTLLLLEHPAVYTAGRRTETHERPID--GTP
LIPB_NOCFA      ----------------IDYHAAWELQRTIAAERAEGAGSDRLLLLEHPSVYTAGRRTEDADLPID--GSP
LIPB_RENSM      ----------------VDYMQAWEMQQKLHDAVVEGQAPSTVLLLEHAAVYTAGKRTEDHERPFD--GTP
LIPB_CORDI      ------------------YQRAWDLQAELNKQRQHDEINDVILVLEHPSIYTAGKRTQPSDRPQN--GLP
LIPB_ARTAT      ------LEFSQLGLAPVDYMQGWDLQRDIHNKVVAGEKNSTVLILEHAAVYTAGKLTEDHERPFD--GTP
LIPB_ARTCA      ------LEFSGLGLAPVDYQHAWDVQRELHGKVVAGEAPSTVLLLEHAAVYTAGKLTEDHERPFD--GTP
LIPB_TROWT      ----------------LPFEEGWRMQQELHKKITESQTNKSMIFCEHEPVYTAGARTRSWEMPQNEK---
LIPB_TROW8      ----------------LPFEEGWRMQQELHKKITESQTNKSMIFCEHEPVYTAGARTRSWEMPQNEK---
LIPB_CORA7      ------------------YQEAWDLQAEIAAARAAGTQGDVILVVEHPNVYTAGKRTQPEDMP--DNGLP
LIPB_PROAC      ------------------YNECWAHQREVHAEVSAHQRPNTVIYVEHDPVYTAGRRTRKEAYPFD--GTP
LIPB_RUBXD      -----------------PYAEAWELQRELVRKRRSGEIPDTLLLLEHPPVYTVGRAAGAGEEYLRSLGAE
LIPB_CHLSY      ------LTVHYLGQ--IAYTAAWDIQRQLAAERSRGQIGDTLLLLEHPPTITLGNKARP-DHVLASPGVA
LIPB_CHLAA      ------LTVHYLGQ--IAYTAAWDIQRQLAAERSRGQIGDTLLLLEHPPTITLGNKARP-DHVLASPGVA
LIPB_CHLAD      -------VYH-LGH--IDYTAAWEMQRRLARQRSSGQIGDTLLLLEHPPTITLGNKARPTPAELAARGVV
LIPB_ROSS1      ----------------IDYRTAWDVQRRIARARSAGQVGDTLLLLEHPPTITLGSRASTEHEHLSAEGVT
LIPB_ACIBL      ----------------VDYTTAQQLQTTLVDLRKRGVIQDTLLLLEHSPVITMGRNAKQKNEILAQRGVE
LIPB_PELPD      ----------------VDYAAAFSLQERIADGVYRNATPETLLLLEHHPVYTIGR--AGCEENILDHSIQ
LIPB_CALS8      ----------------VEYEDALHLQERLHKLRVANELEDTLLLLQHPPVITIGRR-GKWENKLLQMGVK
LIPB_BACFR      ----------------IPYSEAWSRQTEVHAKQNGESYENRIIFCEHPHVYTLG-RSGKGEEQLKTIGAT
LIPB_GLOVI      ----------------VPYLTAWEWQRQLMATRIAHRDPDVLMLLEHPPVYTLGQGADA-KHVLVDPASE
LIPB_BACFN      ----------------IPYSEAWSRQTEVHAKQNGESYENRIIFCEHPHVYTLG-RSGKGEEQLKTIGAT
LIPB_BACTN      ----------------IPYAEAWQRQTEVRAKAQGEAYENRIIMCEHPHVYTLGRSGKENNMLLNDDQAT
LIPB_THET8      ----------------VPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKTGEWYR---ENGFE
LIPB_THET2      ----------------VPYGEAWAYQKRVHREVVAGNRPPTLLLLEHPRVITLGRKTGEWYR---ENGFE
LIPB_GEOMG      --------------------------------------PETLLLLEHPPVYTIGR--GGCRENVLDPGIR
LIPB_NOVAD      ----------------VPYREALDAMASRNAAIAEGTAPELIWLLEHPPVYTAGTSASPDE--LLDPRFE
LIPB_FLAJ1      ------------------YKSTWEYQEELFQRREELDLPTSLLFVEHPHVYTLGKSXXXXXKQLEAKGAA
LIPB_PORGI      ---VSRSEYHYQDCGRIGYESALTLQRKLFHDAVADKLENTLLFCEHEPVLTLGKHGHXXXXXXXXXXXK
LIPB_GEOSL      ------------------YAEAFALQERLAADVAAGRAEETLLLLEHPPVYTLGRRGDGGSLP--DPSVR
LIPB_GRAFK      ------------------YKETWDYQENIFKRREGTEIPNYFLFVEHPHVYTLGKSGDAEEKELKAKNAT
LIPB_ANATD      ----------YLGE--VEYQEALFIQERIWALRVEKKIGDTLLLLEHPPVITIGRRGSKKNILVSDEDVK
LIPB_CYTH3      ----------------IDYQQAWDYQTQLEKKLALRDLPEDLIFCEHPHVYTLGK-SGKREHLLISEAAA
LIPB_DANRE      ----------------------------------SSNIPNTLLLCEHEPVYTIGLRQAPYEQRLKALGAD
LIPB_ACIC5      ----------------IGYAQGLELQRQLVEARHSGRIGNXXXXXXXXXXXXXGRNSEASDEFLAYRGVE
LIPB_PELCD      ----------------MPYAEAYALQEQLVRDIAAGSAPETLLLVEHPPVYTLG-RSGHMEN-LLDDSIE
LIPB_MAGSA      -----------ISDSPVDYPQAIAAMEERVAAIRAGTAPELVWLLEHPPLYSAGTSADP--RDLVDPGRP
LIPB_NITHX      --SPGELVDWQLSDTPVPYPXXXXXXXXXXXXXXXXXXXXLVWLLEHPPLYTSG--TSGRETDLLQARFP
LIPB_SYNP6      ----------WLVQAGLDYAQVWAWQRQLQNRRNNPDRPDVLLLLEHPAVYTLGRGSSLAHLKFDPPPAP
LIPB_SYNE7      ----------WLVQAGLDYAQVWAWQRQLQNRRNNPDRPDVLLLLEHPAVYTLGRGSSLAHLKFDPPPAP
LIPB_NOSP7      ------LLYN---QGLMPYLDAHRWQRSLLNERIHDSLDDVLILLEHPPVYTLGQGSNSFIKFDIDQGED
LIPB_GEOUR      ----------------IDFDEAYSIQERLAAEVFAGSGAETLLLLEHPPVYTIG--SGGDEGNILDTAIE
LIPB_THETN      ----------------VPYLEGKEIQLKAFEKVKKEETDGILILLQHKPVYTIGV-SGGYDEDILVPKAE
LIPB_PARD8      --------YHDLGR--IAYADALEYQTALDAKATGKKEDNQLFFCEHLPVLTIGKSGKDSEETLRERGVS
LIPB_ANAVT      ----------------MPYLEAHAWQRSLHQRIDYPNLEDVLILLEHPPVYTLGQGSS-LEFLKFDPNQS
LIPB_TRIEI      ------------------YSVAWEWQRSLQQRHNCPELADVLILLEHPQVYTLGQGA-KLDFLKFDPTQN
LIP2P_ARATH     ----------------VPYKKAWSWQKSIEKKTLIDRCADTVILLQHSPVYTMGTASTELNFDIKDAPFN
LIPB_XENTR      --------------------------RELKAGGEAGSPGGALLLCEHPAVYTVGVRRGRYEARLRGLGAD
LIPB_JANSC      -------MVEWISDAPVPYPLAVAEMEARANAIAKGEAGEAVWLLEHPPLYTAG--TSARESDLRDPDRP
LIPB_DICT6      ----------------IKYEDAWDLQKKLHDLRVKDTIYDTLILLEHFPVITLGKXXXXXXXXXXSMGID
LIPB_SOLUE      ----------------IDYASALEIQEQLAASRKQGTAADHLLLLEHPHVITLGRNGHAGDDILERAGIA
LIPB_SYNJA      ------LQVHQAGE--VPYRRAWAWQQVRLAQMIRDQVPDGLLLLTHPPVYTLGAGADPKGSPDTQPESP
LIPB_ARATH      ----------------VNYLKSLKLQEKLVSERKAHQIPDTLLSLQHPPTYTLGKRRTDHESELTKIGAE
LIPB_SYNJB      ----------------VPYRTAWAWQQARLAHMIRDQLPDGLLLLTHPAVYTLGAGADPFLKSLSQPGSP
LIPB_ANASP      ----------------MPYLAAHAWQRSLLRQRIDPNLEDVLILLEHPPVYTLGQGSS-LEFLKFDPNQS
LIPB_THEEB      ----------------IPYRDAWRWQQQLAERRQNLAAPDVLLTLEHPAIYTLGQTTAHIHFDPVATGIE
LIPB_SPHAL      ----------------------------------ADEAGERIWLLEHPPLYTAGTSADPAE--LLDPRFP
LIPB_NEOSM      ----------------VDYQMSLMFMQERVKQVINGSGDELVWMLQYEALYTGGTSADPQDL-LNSDLFP
LIPB_DROME      ------------------YSAGLQLQQRLARSNQILNPPNYLVLQEHDPVYTVGLRTKDYTAQDEDRGAD
LIPB_ALKMQ      ------------------YEKALQVQIELLEKRQRGEIEDTLILVEHPPVITKGRHADETEASLINHGIQ
LIPB_RICBR      --------------TPIDYQDSLMLMEDYVNKVIDGEAPEAVYLVEHLDVYTAGTNYKQ-EELLNHNNIP
LIPB_RICB8      --------------TPIDYQDSLMLMEDYVNKVIDGEAPEAVYLVEHLDVYTAGTNYKQ-EELLNHNNIP
LIPB_NITWN      -------------DQPVPYPGAVDXXXXXXXXXXXXXXXXQVWLLEHPPLYTCG--TSGREADLVKARFP
LIPB_RICPU      ---------------------------------ISDHEPEIIYLVEHSEVYTAG--TNYKQEELLNYGIP
LIPB_MESSB      -----------------PYEKALAFMEQRADAIRAGTAGEMVWLVEHPPLYTAGTSASPGD--LLDPNRP
LIPB_BURPP      ----------WRGSEP--YEASFEAMRTFTDERTAD-TPDEIWLVEHPPVFTLGQAGNPAHLLAADSGIP
LIPBL_ARATH     ----------------IPYKKAWSWQKSILNEKKAQECSDSLIILQHPSVYTMGTGSSENYLNFDIKNAP
LIPB_PARL1      -----------ISDLPVPYEEAVKTMXXXXXXXXXXXXXXLVWLLEHPALYTAGTSADETD--LLDPKRP
LIPB_SYNY3      ----------------VPYCQAWQYQRRWVRAKQRDQREDGLMLLEHPPVYTLG--TGSQTKYLKDPAYP
LIPB_RICCN      ------------------YQVTLKLMEDYVNKVISDHKPEIIYLVEHSEVYTAG--TNYKQEELLNYGIP
LIPB_RHORT      -------------DTPVSYPEALAFMDDRIAKIREDRAGECVWLLEHPPLYTAGTSADPADL-LSPDRFP
LIPB_MAGSM      ------------------YQQAWEQQLAWVQAIHEGQRQDTLILLEHMPVYTLGKRATRADVLRQD--IP
LIPB_SYNPW      ----------------VPFVQAWTWQRLWQERLLGDPPPEAVWLLQHPPCYTLGRGASE-DHLLFDPEAP
LIPB_RICM5      ------------------YQVTLKLMEDYVNKVISDHEPEIIYLVEHSEVYTAG--TNYKQEELLNYGIP
LIPB_RICAE      ------------------YQVTLKLMEDYVNKVISDHEPEIIYLVEHLEVYTAG--TNYKQEELLNYGIP
LIPB_RICRS      ---------------------------------INDHEPEIIYLVEHSEVYTAG--TNYKQEELLNYGIP
LIPB_RICRO      ---------------------------------INDHEPEIIYLVEHSEVYTAG--TNYKQEELLNYGIP
LIPB_GLUDA      --------------------------------------PERVWLLEHPPTFTAG--TSARDEDLFNPHHP
LIPB_RHOPA      -----------ISDSPVPYPXXXXXXXXXXXXXXXXXXXXLVWLLEHPPLYTAG--TSGHASDLLEERFP
LIPB_FLAPJ      ------------------YKATWDYQEQLRREERQDQTPNYFLFVEHPHVYTLGK-SGDLEKQLEAKGAT
LIPB_RICPR      ------------------YQVTLKLMEDYVNKVINDNEPEIVYLVEHSEVYTAGTNYKQ-EELLNYDDIP
LIPB_SILPO      -----------------------------------------IWLLEHPPLYTAGTSARPAD--LTDPDRP
LIPB_SALRD      ---------------------------------------------------------------LEEVGAT
LIPB_RICFE      ---------------------------------ISDNEPEIVYLVEHSEVYTAG--TNYKQEELLNYGIP
LIPB_RICCK      --------------------------------------PEIVYLVEHSEVYTAGTNYKQ-EELLNYSDIP
LIPB_RHOP5      -------------------------------------------LLEHPPLYTSGTSAKPAD--LLDPRFP
LIPB_DESPS      ------------------YIACYATQQAVVARRCSGDLDDCFLLTEHPPVYTLGKRGGEQHEMLAQKGID
LIPB_SYNFM      ------------------YNRSRDLQKRLHARRVIDVVPDTVLLVEHPHTITLGRRASPED--LERMGIP
LIPB_BRUME      ---------------------------------------ELVWLVEHPPLYTAGTSANAEDL-LTPDRFP
LIPB_BRUMB      ---------------------------------------ELVWLVEHPPLYTAGTSANAEDL-LTPDRFP
LIPB_BRUAB      ---------------------------------------ELVWLVEHPPLYTAGTSANAEDL-LTPDRFP
LIPB_BRUA2      ---------------------------------------ELVWLVEHPPLYTAGTSANAEDL-LTPDRFP
LIPB_SINMW      -----------IAPAPVDYQEAVETMEREAADIAAGTADELVWLVEHPPLYTAGTSANAADLVIPDR-FP
LIPB_RICAH      ---------------------------------ISDNELEVVYLVEHSEVYTAG--TNYKQEELLNYGIP
LIPB_PYRCJ      ------------------YVSAWRMMKILH-REVASGGDDAFILVEHPHVITVGKRTNKWE-------LF
LIPB_ERYLH      ---------------------------------------ELIWLLEHPPVYTAGTSANAAE--LLDPRFE
LIPB_BRUSU      ---------------------------------------ELVWLVEHPPLYTAGTSANAEDL-LTPDRFP
LIPB_HYPNA      -----------VSDAPVPYXXXXXXXXXXXXXIREDGAPELVWFLEHPPLYTAG--TSARIEDLKDPARP
LIPB_SYNSC      ---------------PVRFDAAWSAQQRWQTRLLADSAPEAVWILQHQTCYTLGR--GASEKHLAEPPAP
LIPB_RICTY      --------------------------------------PEIVYLVEHSEVYTAG--TNYKQEELLNYGIP
LIPB_DINSH      ------------------------------------RAPEMIWLLEHPPLYTAGTSADPAD--LTDPDRP
LIPB_SYNPX      ----------------VPFERSWADQRHWQQRLLEQHLPEAVWLLQHKACYTLGRGASSEHLPLDQPPAP
LIPB_RHOPT      -----------ISDSPVPYPXXXXXXXXXXXXXXXXXXXXLVWLLEHPPLYTAG--TSGHASDLLEERFP
LIPB_DESRM      -----------LGE--IDYQDALTMQEKLLLLRQQNKVEDIMLLLQHPPTLTLGTRENRYEVELKRQGVN
LIPB_PYRAE      ----------WIGRTQ--YAEAWRLMKSLHCAVAQGLTGDIALVTEHEPVVTVGKHGRKWD-------VP
LIPB_ORITB      ---------------PIEYSEAYKMMKSRLTGILNGTASEAVFILEHQDVYTAGI-SAKNDELLNCYDIP
LIPB_HALHL      ----------YLGEQP--YEPTWTAMRTFTEER-SSETRDELWLLQHPPVYTLGQAGRP--EHILDTGTP
LIPB_BURPS      ----------WLGETP--YDACFDAMRAFTDARTPD-TDDEIWVVEHPPVYTLGQAGNPAHLLVADSGVP
LIPB_BURP6      ----------WLGETP--YDACFDAMRAFTDARTPD-TDDEIWVVEHPPVYTLGQAGNPAHLLVADSGVP
LIPB_BURP1      ----------WLGETP--YDACFDAMRAFTDARTPD-TDDEIWVVEHPPVYTLGQAGNPAHLLVADSGVP
LIPB_BURP0      ----------WLGETP--YDACFDAMRAFTDARTPD-TDDEIWVVEHPPVYTLGQAGNPAHLLVADSGVP
LIPB_BURMS      ----------WLGETP--YDACFDAMRAFTDARTPD-TDDEIWVVEHPPVYTLGQAGNPAHLLVADSGVP
LIPB_BURMA      ----------WLGETP--YDACFDAMRAFTDARTPD-TDDEIWVVEHPPVYTLGQAGNPAHLLVADSGVP
LIPB_BURM9      ----------WLGETP--YDACFDAMRAFTDARTPD-TDDEIWVVEHPPVYTLGQAGNPAHLLVADSGVP
LIPB_BURM7      ----------WLGETP--YDACFDAMRAFTDARTPD-TDDEIWVVEHPPVYTLGQAGNPAHLLVADSGVP
LIPB_AZOSE      ----------------VDYEPTWHAMRAFTDARSAD-TPDEIWLLEHPPVYTLGQAGQP-EHLLRDVGIP
LIPB_AZOSB      ----------------VDYAPAWEAMQHFTASRGEDTA-DEIWLLEHPPVYTLGQAGRPEHLLRNDAGIP
LIPB_ORITI      ---------------PIEYGEAYKMMKSRLTGILNGTASEAVFILEHQDVYTAGI-SAKNDELLNCYDIP
LIPB_VARPS      ----------WLGAAD--YAATYGAMKQFTLERLPE-TPDALWICEHAPVFTQGI-AGRQDHILNPGAIP
LIPB_DESDA      ------------------YEDAFTLQKQV-QAMVQSGGDDILLLLEHPPTVSIGKNSGAENVPLQDMWNG
LIPB_BARBK      -----------ISDGLVEYPEALRYMQKRVENIYAKIAHEQVWLLEHPSLYTAGTSANKNDL-LIPHVFP
LIPB_FRASC      --------------------------RVMVRERIDGVRPDTLWFLSHPPVYTVGKRTPPEHRPLAGLGIP
LIPB_XYLFA      -----------------PYVPVWHAMQRFTDVRDATAV-DELWVVEHDPVFTLGQ-AGKLEHVL-DPGEP
LIPB_BORPD      ----------WLTR-PADYAPVWQDMRAFTAGRGA-ATPDEVWLCEHAPVYTLGQAGKP--EHLLNPGAP
LIPB_PARDP      -----------------------------------------VWLVEHPPLYTAGTSAKAAD--LLEARFP
LIPB_BARQU      ----------------IEYPEALHYMQEHVENIFAQNAPEQVWLLEHPSLYTAG--TSAKKKDLLAPHLP
LIPB_SPHWW      -----------------------------------------IWLLEHPPLYTAGT-SAEADELLLPDRFP
LIPB_MOUSE      ----------WLGR--VHYSELLALQEHWLRRLQADPRPGTLVLLVCEPVYTGGLRGGLTPEETTRLGAE
LIPB_DICTD      ----------------IKYEDAWNFQRKLHDLRVNNIIYDTLILLEHFPVITLGKFGNESNEELEDIGID
LIPB_DESDG      ----------------IPYAEAVEIQTG-RVQEVAAGAENTLYLLEHPKVITFGRNGGREDSTLASMGIE
LIPB_CLOK5      ----------------ISYSEGIEIQQKAFDFVIRNNIDGILLLLQHKPVITIGKSGGKNNILASKYELD
LIPB_BURTA      ----------WLGETP--YDACFDAMRAFTDARTPD-TGDEIWVVEHPPVYTLGQAGNPAHLLVADSGVP
LIPB_MYXXA      ------------------------------------------------------------DAQLAKEGAE
LIPB_BRASO      -----------------------------------------VWLLEHPPVYTSGTSGKPED--LRDPRFP
LIPB_XYLFT      -----------------PYVPVWHAMQRFTDVRDATAV-DELWVVEHEPVFTLGQ-AGKLEHVLAPGEIP
LIPB_BURVG      ------LTVRWRGTEA--YQTSFDAMRAFTDARTAE-TPDEIWIVEHPPVYTLGQAGDPAHLLVADSGVP
LIPB_RHIME      -----------IAPSLVDYPEAVETMER-EAAAIADGTADELVLVEHPPLYTAGTSANAADLVMPDL-LP
LIPB_BART1      ----------------VEYPEALRYMQERVEKILAKTAHEQVWLLEHPSLYTAGTSADKKDL-LAPHLFP
LIPB_DESVM      ----------------IRYAEADALQRA-RLEEVAAGAEETLYLLEHHPVITLGRNGGEW---LATQGID
LIPB_MARMM      -----------------------------------------VWLLEHPPLYTAGTSAKAGDL-LSPDRFP
LIPB_BURS3      ------------------YEASFDAMRAFTDARTAD-TGDEIWLVEHPPVYTLGQAGDPSHLLVADSGVP
LIPB_EHRRW      ----------WKIESPVPYDKAMCFMQQRVEGIANKTQDELVWLLEHFPLYTAGTSARS-EELLTDSLFP
LIPB_EHRRG      ----------WKIESPVPYDKAMCFMQQRVEGIANKTQDELVWLLEHFPLYTAGTSARS-EELLTDSLFP
LIPB_CELJU      -----------------PYEQSWQAMTAFTNQRTPD-TPDQLWLVEHPPVFTQGQ-AGKAEHLLFPGDIP
LIPB_CAUCR      ---------------PVPYPXXXXXXXXXXXXXXXXXXGELIWLLEHPPLYTAGVSAKAGD--LIQPDRP
LIPB_BURCA      ---VQPVTVRWRGREA--YEASFDAMRAFTDTRTAD-TGDEIWVVEHPPVYTLGQAGDPAHLLVADSGVP
LIPB_MARAV      ---MADLIVRSLGQQP--YMETWEAMKSFTANRDETTV-DELWCLEHPRVFTQGQ-AGKAEHILLPGDIP
LIPB_WOLPP      ---------------------------------------ELVWLLQHPPLYTAG--IGATDDDIIEKLFP
LIPB_BRASB      -----------------------------------------VWLLEHPPVYTSGTSGKPED--LRDPRFP
LIPB_THEPX      ----------------VPYMEGKEIQLKAFERVKKGETDGILILLQHPPVYTIGV-SGGFDENILVPXXX
LIPB_THEP3      ----------------VPYMEGKEIQLKAFERVKKGETDGILILLQHPPVYTIGV-SGGFDENILVPXXX
LIPB_DESVV      ---------------------------------------DTLYLVEHPPVITLGRNGGIENLHLAERGIE
LIPB_DESVH      ---------------------------------------DTLYLVEHPPVITLGRNGGIENLHLAERGIE
LIPB_DEIRA      IRDVKEAAFDVLDLGLLPYPQAWARQKQ-ELARVAVGGRPTLLLVEHPAVLTLGRKAQEGENILAAQGID
LIPB_XANOR      -----------------------------------ERTADEVWVVEHAPVFTLGQAGKP-EHVLAPGDIP
LIPB_XANOM      -----------------------------------ERTADEVWVVEHAPVFTLGQAGKP-EHVLAPGDIP
LIPB_RALEJ      ------------------------------------ETPDQVWLVEHPPVYTLGQAGDPAHLLAPDERIP
LIPB_BURCH      ---VQPVTVRWRGREA--YEASFDAMRAFTDTRTAD-TGDEIWVVEHPPVYTLGQAGDPAHLLVADSGVP
LIPB_BARHE      ----------------VEYPEALRYMQERVENILAQNAHEQVWLLEHPSLYTAGTSAKKKDL-LTPHLFP
LIPB_AERHH      --SAPRLLVRQLGRRP--YQPVWDAMKAFTDSRTPD-TPDEFWVVEHDPVYTQGQ-AGKAEHLLAPGDIP
LIPB_RHOP2      ----------WLSEAPVPYPDXXXXXXXXXXXXXXXXXXELVWLLEHPPLYTSG--TSGQSTDLLDPRFP
LIPB_POLSQ      ----------------VDYVSTYEVMRAFTKERNST-TPDEIWILEHPPVFTLGLAGDAGNLHSPSNQIP
LIPB_POLNA      -----------------------------------EATPDALWICEHPAVYTQGL-AGKIDHLLNPGEIP
LIPB_GEOSM      ----------------IGYAEALRIQEQL-VAKVQQGGXXXXXXXXXXPVYTIGAG-GSRDNVL-DPELE
LIPB_CHRSD      ---------HRLGRRP--YVPVWQAMREFTDTRDADS-PDQFWLVEHDPVFTQGQ-AGKAEHLLMPGDIP
LIPB_BURCM      ----------WRGSEA--YQTSFDAMRAFTDTRTAD-TGDEIWVVEHPPVYTLGQAGDPAHLLVADSGVP
LIPB_BURA4      ----------WRGSEA--YETSFDAMRAFTDTRTAD-TGDEIWVVEHPPVYTLGQAGDPAHLLVADSGVP
LIPB_PYRAR      ------------------YQEAWALMKRIHDEVASGVSEEMILVTEHDHVITVG-RHGRLNNVLRRE-LP
LIPB_DECAR      ----------------VDYQPTFQAMQDFTASRTAE-TPDEIWIVEHPPVYTLGQAGKP-EHILRDVGIP
LIPB_XANCB      ------------------YVPVWRAMQRFTDTR-DEHTGDELWVVEHAPVFTLGQAGKP-EHVLAPGEIP
LIPB_NITMU      ------------------YLSIWQAMKAFTASRTQN-TPDEIWLLQHWPVYTQGVAGKP-EHLLCNPGIP
LIPB_BURCC      ----------WRGREA--YEASFDAMRAFTDTRTAD-TGDEIWVVEHPPVYTLGQAGDPAHLLVADSGVP
LIPB_AERS4      -----QLLVRQLGRRP--YQPVWDAMKAFTDNRTSD-TPDEFWVVEHDPVYTQGQ-AGKAEHLLAPGDIP
LIPB_XANCP      ------------------YAPVWRAMQRFTDTR-DEHTGDELWVVEHTPVFTLGQAGKP-EHVLAPGEIP
LIPB_XANC8      ------------------YAPVWRAMQRFTDTR-DEHTGDELWVVEHTPVFTLGQAGKP-EHVLAPGEIP
LIPB_AZOVD      ------------------YLPAWQAMQRFTGQRGA-QTPDELWLLEHPPVFTQGQ-AGKAEHLLFPGDIP
LIPB_SHEDO      ------------------YQTVWHAMQAYTDNRGADS-QDELWIVEHTPVFTQGQ-AGKSEHILNPGDIP
LIPB_GLUOX      -----------------PYPEALTFMEERARAIHQGTAEPLVWLVEHPPVFTAG--TSAKDADLYNPGYP
LIPB_BURM1      -----------------PYETSFDAMRAFTDARTADTV-DEIWIVEHPPVYTLGQAGDPAHLLVGDSGIP
LIPB_XANC5      ------------------YAPVWRAMQRFTDAR-GEHTADEVWVVEHAPVFTLGQAGKP-EHVLAPGEIP
LIPB_RALPJ      -------------------------EMQTFTARRGPDTPDTIWLVEHPPVFTLGLAGDP--AHLLAPGIP
LIPB_HUMAN      ----------------VPYAELLGLQDRWLRRLQAEEAPSALLLCEPAPVYTAGLRGGLTPEELRALGAE
LIPB_SHEWM      --SESTLHVRYLGQQD--YESVWHAMQEYTDNRDSSS-PDQLWIVEHPPVFTQGQ-AGKSEHILNPGDIP
LIPB_RHOPS      ----------WLSDSQVPYSEXXXXXXXXXXXXXXXXXNELVWLLEHPPLYTSG--TSGQAADLLDPRFP
LIPB_RALSO      --------------------------------------PDTIWLVEHPPVFTLGLAGDP--AHLLAPGIP
LIPB_MARMS      ----------------VDYAETWERMKQFTQIRSKDDA-DEIWLLEHPSLFTQGQ-AGKEEHLLAPGDIP
LIPB_ANAPZ      ---------------------------------------EMVWLLEHPPVYTAGTSANSSDL-LIDNLFP
LIPB_ACIAC      ----------------VDLRETVEAMQAFTAQRTGD-TPDVLWVCEHAPHFTQGL-AGHADHLLAPGDIP
LIPB_XANAC      ------------------YAPVWRAMQRFTDAR-EEYTADEIWVVEHAPVFTLGQAGKP-EHVLAPGEIP
LIPB_SHESH      --SESTLHVRYLGKQD--YESVWHAMQDYTDNRDASS-PDQLWIVEHPPVFTQGQ-AGKSEHILNPGDIP
LIPB_METCA      ------------------YEPVWRAMQEFTGQR-ADDTADELWLVEHPPVYTLGMNGDP-AHILDAGGVP
LIPB_ZYMMO      ----------------------YEYARSEMTKRVADEASEMLWFLQHPPLYTAGSSADRRELLMPDR-FP
LIPB_SYNS9      ----------------IPFERAWRDQ-QLWQQRLFEEPPEAVWILQHPACYTLGRGASAQHLHFNEPPAP
LIPB_WOLTR      ---------------------------------------ELVWLLQHPPLYTAG--ISATDDDVVEKLLP
LIPB_PROMM      --------------------------------------PQAVWLLQHQACYTLGRGASEANLDVNNPPAA
LIPB_PELUB      ---------------PIKYEDAIKLLEERLLEINNGQKEDLIWILEHEEVYSAG--TSYKEKEILNKDIS
LIPB_DELAS      ---------------------------------------DELWICEHAPHFTQGL-AGKSDHLLNPGDIP
LIPB_AGRT5      -----------ISEGLVAYGQAVEEMEREVAAIAAGEADELVWLLEHPPLYTAGTSADVAD--LIEPDRP
LIPB_RHOPB      -----------VSDALVPYPEXXXXXXXXXXXXXXXXXPELVWLLEHPPLYTSG--TSGKDGDLLIPRFP
LIPB_PSEU5      ----------------IEYRAAWQAMQHFTNTRDADS-GDEIWLLQHPPVFTQGQ-AGKAEHLLFPGEIP
LIPB_METPP      ----------------VDYATTFDAMRAFTETRTPG-TPDELWLCEHPPVFTQGL-AGKAEHVLDAGDIP
LIPB_SHEAM      --------------------------------------PDELWLVEHPPVFTQGQ-AGKAEHILNPGDIP
LIPB_GEOBB      ------------------------------------------------PVYTIG--AGGDRGNVLDPELE
LIPB_EHRCR      ---------------------------------------ELVWLLEHPPLYTAGTGAKVEDL-LVDNLFP
LIPB_BORPE      ----------WLAR-PADYASVWDAMKTFTAAR-GPGTADEIWLCEHAPVYTLGQVGRP--EHLLNPGLP
LIPB_BORBR      ----------WLAR-PADYGSVWDAMKAFTAAR-GPGTADEIWLCEHAPVYTLGQAGRP--EHLLNPGLP
LIPB_SHESR      ------------------YESVWHAMQHYTDTRNSDS-PDELWIVEHPPVFTQGQ-AGKSEHILNPGDIP
LIPB_SHESM      ------------------YESVWHAMQHYTDTRNSDS-PDELWIVEHPPVFTQGQ-AGKSEHILNPGDIP
LIPB_DESAD      ----------------IPHGEAERIQLERLKQVMEGTAEDALYLLEHPPVVTLGRQGGLENLLISEEGAE
LIPB_BORPA      ----------WLAR-PADYGSVWDAMKAFTAAR-GPGTADEIWLCEHAPVYTLGQAGRP--EHLLNPGLP
LIPB_ALHEH      ------------------YRETWSAMRRYTDERGPD-TPDQLWVVSHPPVYTLGQ-AGRREHIL-DPGEP
LIPB_WOLPM      --------------------------QQIHNNS-ADEL---VWLLQHPPLYTAGISATADD--IVEKLFP
LIPB_SHELP      ---------------------------------------DELWIVEHPPVFTQGQ-AGKSEHILNPGDIP
LIPB_SACD2      ------------------YQPVWQAMKDFTDGRDA-HTPDELWLVEHPPVFTQGQ-AGKAEHLLAPGAIP
LIPB_THIDA      ----------------VAYEPTWRAMQAFAAQRSAGTA-DELWLLEHPPVYTLGQ-AGKREHLIAATDIP
LIPB_SHESA      ------------------YESVWHAMQHYTDTRNSDS-PDELWIVEHPPVFTQGQ-AGKSEHILNPGDIP
LIPB_SHEON      ------------------YESVWHAMQHYTDTRNNDS-PDELWIVEHPPVFTQGQ-AGKSEHILNPGDIP
LIPB_SHEFN      ------------------YESTWHAMQEYTDTRDSDS-QDELWIVEHPPVFTQGQ-AGKSEHILNPGDIP
LIPB_NEIMB      ----------------VEYLPTFEAMKTFNAGRNAD-TEDELWVVEHPPVFTQGLAGKP-EHLLIRDDIP
LIPB_NEIM0      ----------------VEYLPTFEAMKTFNAGRNAD-TEDELWVVEHPPVFTQGLAGKP-EHLLIRDDIP
LIPB_NEIG2      ----------------VEYLPTFEAMKTFNAGRNAD-TEDELWVVEHPPVFTQGLAGKP-EHLLIRDDIP
LIPB_NEIG1      ----------------VEYLPTFEAMKTFNAGRNAD-TEDELWVVEHPPVFTQGLAGKP-EHLLIRDDIP
LIPB_BURXL      ----------WRGTEP--YEASFEAMRAFTDGRTAE-TPDEIWLVEHPPVFTLGQAGDPAHLLAADSGIP
LIPB_BRAJA      -----------ISDAPVPYPXXXXXXXXXXXXXXXXXXXXXXWLLEHPPLYTSG--TSGKDSDLLDPRFP
LIPB_SHESW      ------------------YESVWHAMQHYTDTRNSES-PDELWIVEHPPVFTQGQ-AGKSEHILNAGDIP
LIPB_SHEPC      ------------------YESVWHAMQHYTDTRNSES-PDELWIVEHPPVFTQGQ-AGKSEHILNAGDIP
LIPB_POLSJ      ----------------VDYLPTYEAMQAFTLERTA-ATPNSLWICEHPPVYTQGL-AGKIEHVLNPGDIP
LIPB_PARVE      ----------------------------------------------------------------------
LIPB_NEIMA      ----------------VEYLPTFEAMKTFNAGRNAD-TEDELWVVEHPPVFTQGL-VGKPEHLLIRDDIP
LIPB_LARHH      ----------------VDYEPTWHAMQAFTETRTGE-TPDELWIVEHPPVYTLGLAGKP-EHLLQQTAIP
LIPB_BORA1      ----------WLSPGAA-YADVWEAMKAFTASR-GPATPDEIWLCEHAPVYTLGQAGLP-QHVLNPADIA
LIPB_VEREI      ---------------------------QDYTARRGPQDPDLLWLCEHDRLYTQG--LAGQDRHVLAPGIP
LIPB_SCHPO      -----------------------------YKANKVEQPPKTIITSQVCPVYTLGRRESSINFTKGFPKAK
LIPB_BURP8      ------------------------------------ETSDEIWLVEHPPVFTLGQAGDPAHLLAADSGIP
LIPB_VIBVY      ------------------YLPVWQAMHEFTDTR-NEETPDEVWLVEHNPVFTQGQ-AGKAEHLLNTGDIP
LIPB_VIBVU      ------------------YLPVWQAMHEFTDTR-NEETPDEVWLVEHNPVFTQGQ-AGKAEHLLNTGDIP
LIPB_NEIMF      ----------------VEYLPTFEAMKTFNANRTAS-TEDELWVVEHPPVFTQGLAGKP-EHLLIRDDIP
LIPB_LEGPL      ------------------YTEIWEQMKEFTAVRDSNSY-DELWLLEHYPVYTQGQAGKP-EHVLNPNSIK
LIPB_LEGPH      ------------------YTEIWEQMKEFTAIRDSNSY-DELWLLEHYPVYTQGQAGKP-EHVLNPNSIK
LIPB_ALCBS      ----------------VDYSSCWHAMRDLTDHRDAQQ-SDEFWVLEHPPIFTLGQAGKP-EHVLNAGEIP
LIPB_LEGPA      ------------------YTEIWEQMKEFTATRDSNSC-DELWLLEHYPVYTQGQAGKP-EHVLNPNSIK
LIPB_EHRCJ      -------LVEWIESSPIDYQEAYFMQRKVDS--ISDGLQELVWLLEHPALYTAGTGATVEDL-LASNLLP
LIPB_ENT38      -----------------------------------DHTPDEIWLVEHHPVFTQGQ-AGKAEHVLVPGDIP
LIPB_SHEHH      ---------------------------------------DEIWIVEHTPVFTQGQ-AGKSEHILNPGDIP
LIPB_RHIL3      ----------------VPYEEAVEMEREV--ALIADGGDELVWLVEHPPLYTAG--TSANARDLVQPNRP
LIPB_PSEMY      -----ELVVRHLGL--VEYQPTLESMRQLTRER-DERTADEIWLLQHPKVFTQGQ-AGKAEHLLAPGDIP
LIPB_OLICO      --------------------------------------PELVWLLEHPPLYTSGTSAKASD--LIEARFP
LIPB_LEGPC      ------------------YTEIWEQMKAFTAIRDSNSC-DELWLLEHYPVYTQGQAGKP-EHVLNPNSIK
LIPB_SHEPA      ---------------------------------------DEIWIVEHTPVFTQGQ-AGKSEHILNPGDIP
LIPB_RHOFD      -----DLLRHRLGR--IDYLPAYEAMQVFTAARTPE-TPDELWICEHPPVYTQGL-AGKAEHVFNPGTIP
LIPB_PSEF5      ------------------YEPVWQAMQRFTNERGTD-APDEVWLVQHPPVFTQGQ-AGKAEHLLLPGDIP
LIPB_PROM1      ----------------VPFETALGWQKNFLKNLIEEPFPQAVWLLEHFSCFTMGRGSDKKNLLFEENNSP
LIPB_NITEC      ------------------YLTAWQAMKDFTQQRTRE-TPDEIWLLEHPPVYTQGIAGKP-EHLLFPSNIP
LIPB_PSEU2      ----------------IDYETAWHAMKRFTDER-GREAADEVWLVQHPPVFTQGQ-SGKAEHLLLPGNIP
LIPB_PROMT      ----------------VPFETALGWQKNFQKNLIEQPFPQAVWLLEHFSCFTMGRGSDKKNLLFEENNSP
LIPB_VIBHB      ------------------YEPVWKAMHEFTDQRT-DDTPDEVWLVEHNPVFTQGQ-AGKAEHLINTGDIP
LIPB_SHEB9      ---------------------------------------DELWIVEHPPVFTQGQ-AGKSEHILNAGDIP
LIPB_SHEB8      ---------------------------------------DELWIVEHPPVFTQGQ-AGKSEHILNAGDIP
LIPB_SHEB5      ---------------------------------------DELWIVEHPPVFTQGQ-AGKSEHILNAGDIP
LIPB_SHEB2      ---------------------------------------DELWIVEHPPVFTQGQ-AGKSEHILNAGDIP
LIPB_SHEPW      ---------------------------------------DEIWVVEHTPVFTQGQ-AGKSEHILNPGDIP
LIPB_RHOS5      ----------------------------------AGDAPEAVWLLEHPPLYTAGTSARPED--LVEPDRP
LIPB_PSYIN      ----TQLKLRYLGRQD--YLTSWQAMSDFTNQRDENTI-DEIWLVEHPAVFTQGL-AGKAEHLLKHSEIP
LIPB_PSESM      ----------------IDYETAWHAMQRFTDGR-GREAGDEVWLVQHPPVFTQGQ-SGKAEHLLLPGNIP
LIPB_PSEPF      ------------------YEPVWQAMQRFTNER-GTTAPDEIWLVEHPPVFTQGQ-AGKAEHLLLPGDIP
LIPB_PSE14      ----------------IDYETAWHAMQRFTDGR-GREAADEVWLVQHPPVFTQGQ-SGKAEHLLLPGNIP
LIPB_PROM5      ---------------------------------------DFIWLGEHQLCYTIGRGSNMGNLLFSLDEQD
LIPB_PHOPR      ------------------------------------ETTDEVWLVEHNPVFTQGQ-AGKTEHLLNTGDIP
LIPB_RHILO      ---------------------------------------EMVWLVEHPPLYTAG--TSARIEDLIEPDRP
LIPB_CITK8      -----------------------------------ENTPDEIWLVEHFPVFTQGQ-AGKAEHVLMPGDIP
LIPB_VIBPA      ------------------YEPVWKAMHEFTDQRT-EETPDEVWLVEHNPVFTQGQ-AGKAEHLINTGDIP
LIPB_RHIEC      ---------------------------------------ELVWLVEHPPLYTAGTSANASD--LVQPDRP
LIPB_RALEH      ------------------------------------ETPDQVWLVEHPPVYTLGQAGDPAHLLAPDDRIP
LIPB_PSEE4      -----------------PYEPVLEAMRRFTEQR-GPESQDEVWLVEHPPVFTQGQ-AGKAEHLLIPGEIP
LIPB_POLNS      ------------------YASTYEAMQAFTKARTSETL-DEIWVLEHPPVFTLGLAGDAGNLHSPSNQIS
LIPB_IDILO      -----------------PYEPVWHAMQEFTDQR-DEHTADELWVVEHDPVFTQGQ-AGKAEHILAPGDIP
LIPB_DICNV      ------------------YVSVWQKMQDFTRQRGGAE-DDQLWLVEHYPVYTQGQ-AGKAEHILNTGNIP
LIPB_SERP5      --------------------------------RRTETTPDELWLVQHQPVFTQGQ-AGKAEHLLMPGDIP
LIPB_SHISS      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_SHIDS      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_SHIBS      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_SHIB3      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_PSEPW      -----------------PYEPVLEAMRRFTEQRSPDS-QDEIWLVEHPAVFTQGQ-AGKAEHLLVPGDIP
LIPB_HAHCH      ----------------VSYEPVWRAMQDFTQQRDAETT-DEVWLLQHEPVFTQGQ-AGDAEHVLFPGDIP
LIPB_ERWT9      -----------------------------------DETPDEIWLVEHLPVFTQGQ-AGKSEHLLMPGDIP
LIPB_ECOUT      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOSE      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOLI      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOLC      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOL6      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOL5      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOK1      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOHS      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOBW      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECO8A      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECO81      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECO5E      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECO57      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECO55      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECO45      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECO27      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECO24      -----------------------------------DSTLDEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB2_PICTO     -------------ETPMEYKPVLYFQRKLVDLRNNDKIDDTFIFLEHNDVYTAGVHYRGND--------D
LIPB_YERPY      -----------------------------------DTTPDEIWLVEHQHVFTQGQ-AGKTEHVLMPGDIP
LIPB_YERP3      -----------------------------------DTTPDEIWLVEHQHVFTQGQ-AGKAEHVLMPGDIP
LIPB_PERMH      ------------------YQEALEIQNRIFERKLTGEDQDNYFFIEHHPVYTAGKTTKP-EHILNTEDIP
LIPB_NITEU      ------------------YLTAWQAMKNFTAQRTCE-TPDEIWLLEHPPVYTQGIAGKP-EHLLFPNQIP
LIPB_HAES1      ------------------YQQVWQQMREFTDTRNA-LTPDEIWLVQHPAVFTQGQAGKP-EHLLNPTDIP
LIPB_ACTSZ      ------------------YNQVWRQMQDFTDQR-NENTPDEIWLVQHPPVFTQGQAGKP--EHLLNPGAP
LIPB_YERPS      -----------------------------------DTTPDEIWLVEHQHVFTQGQ-AGKAEHVLMPGDIP
LIPB_YERPP      -----------------------------------DTTPDEIWLVEHQHVFTQGQ-AGKAEHVLMPGDIP
LIPB_YERPN      -----------------------------------DTTPDEIWLVEHQHVFTQGQ-AGKAEHVLMPGDIP
LIPB_YERPE      -----------------------------------DTTPDEIWLVEHQHVFTQGQ-AGKAEHVLMPGDIP
LIPB_YERPB      -----------------------------------DTTPDEIWLVEHQHVFTQGQ-AGKAEHVLMPGDIP
LIPB_YERPA      -----------------------------------DTTPDEIWLVEHQHVFTQGQ-AGKAEHVLMPGDIP
LIPB_PSEFS      ------------------YEPVWHAMQRFTNER-GTSAEDEIWLVEHPPVFTQGQ-AGKAEHLLLPGDIP
LIPB_KLEP3      ---------------------------------------DEIWLVEHHPVFTQGQ-AGKAEHVLVPGDIP
LIPB_SHIFL      ---------------------------------------DEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_SHIF8      ---------------------------------------DEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_SALTY      ---------------------------------------DEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_SALTI      ---------------------------------------DEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_SALPA      ---------------------------------------DEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_SALCH      ---------------------------------------DEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOSM      ---------------------------------------DEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECOLU      ---------------------------------------DEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_ECO7I      ---------------------------------------DEIWLVEHYPVFTQGQ-AGKAEHILMPGDIP
LIPB_COLP3      ------------------YSQVWHAMKDFTDNR-DDTTADELWLVEHPAVFTQGQ-AGKAEHLLVPGDIE
LIPB_VIBF1      ---------------------------------------DEVWLVEHNPVFTQGQ-AGKEEHVLAAGDIP
LIPB_CHRVO      ----------------VDYEPTWRAMQAFTDSRGAE-TRDELWVVEHPPVFTQGLAGKP-EHLLQQNDVP
LIPB_PROMP      -----------------------------------------IWLGEHQLCYTVGRGSNMDNLLFSADEQD
LIPB_KLEP7      ---------------------------------------DEIWLVEHHPVFTQGQ-AGKAEHVLVPGDIP
LIPB_PASMU      MSNLSPLLVRQLGIQD--YQTVWQQMQTFTDSRDVD-TQDEIWLVQHPAVFTQGQ-AGKAEHLLQQTTIP
LIPB_HAEDU      -----------------PYERIWHQMQDFTDQR-DEHSADEIWLVQHPAVFTQGS-AGKSEHLLTSSHIP
LIPB_COXBU      ----------------IPYQPLWEAMQTFTARRQS-QTTDEIWFLEHEPVFTQGLAGKP-EHVLNSGNIP
LIPB_ANAMM      ---------------------------------------EMVWLLEHPSVYTAGVSAKDGEL-LSENKFQ
LIPB_ANAMF      ---------------------------------------EMVWLLEHPSVYTAGVSAKDGEL-LSENKFQ
LIPB_VIBCH      ----NQLLVRRLGRQD--YTPVWQAMHQFTDQRDST-TRDEVWLVEHNPVFTQGQ-AGKAEHLLNTGDIP
LIPB_VIBC3      ----NQLLVRRLGRQD--YTPVWQAMHQFTDQRDST-TRDEVWLVEHNPVFTQGQ-AGKAEHLLNTGDIP
LIPB_THICR      -----------------PYESTWEAMQRFTNERT-EHTPDELWVVEHPPVFTQGLQAKHLQAFALEQNIP
LIPB_COXBR      ----------------IPYQPLWEAMQTFTARRQS-QTTDEIWFLEHEPVFTQGLAGKP-EHVLNSGNIP
LIPB_COXB2      ----------------IPYQPLWEAMQTFTARRQS-QTTDEIWFLEHEPVFTQGLAGKP-EHVLNSGNIP
LIPB_ACICJ      -----------------------------------------VWLVEHPPLYTAG--TSARDADLLHPGAQ
LIPB_PSEAE      -----ELGFRELGE--VPYEPTWHAMQRFVAER-DKSVMDEAWLLQHPAVFTQGQ-AGKAEHVLFPGDIP
LIPB_PSEAB      -----ELGFRELGE--VPYEPTWHAMQRFVAER-DKSVMDEAWLLQHPAVFTQGQ-AGKAEHVLFPGDIP
LIPB_PSEA8      -----ELGFRELGE--VPYEPTWHAMQRFVAER-DKSVMDEAWLLQHPAVFTQGQ-AGKAEHVLFPGDIP
LIPB_PSEA7      -----ELGFRELGE--VPYEPTWHAMQRFVAER-DKSVMDEAWLLQHPAVFTQGQ-AGKAEHVLFPGDIP
LIPB_PSEA6      MNDTTPVIIRQLGRQA--YFPIWQAMQDFTDSRDSSS-QDEIWLVEHDPVFTQGQ-AGKEEHLLAPGDIP
LIPB_PECCP      -----------------------------------DKTPDEIWLVQHPRVFTQGQ-AGKAEHVLMPGDIP
LIPB_COXBN      ----------------IPYQPLWEAMQTFTARRQS-QTTDEIWFLEHEPVFTQGLAGKP-EHILNSGNIP
LIPB_ERWCT      -----------------------------------DKTPDEIWLVQHPRVFTQGQ-AGKEEHVLMPGDIP
LIPB_RHIE6      ---------------------------------------ELVWLVEHPPLYTAGTSANAGD--LVQPDRP
LIPB_VIBSL      ------------------YEPVWKAMHKFTDERTDEDV-DQIWLVEHNPVFTQGQ-AGKAEHVLNAGDIP
LIPB_PSEPK      -----------------PYEPVLEAMRRFTEQRSPDS-QDEIWLVEHPAVFTQGQ-AGKAEHLLVPGDIP
LIPB_PSEP1      -----------------PYEPVLEAMRRFTEQRSPDS-QDEIWLVEHPAVFTQGQ-AGKAEHLLVPGDIP
LIPB_HAES2      ------------------YQQVWQQMREFTDTRNV-LTADEIWLVQHPAVFTQGQAGKP-EHLLNPTDIP
LIPB_BDEBA      ----------------INYDEALKKQNDLVEKVHTEDLPGFLVFCTHPPVVTVGRATQAGD--VFSWNGP
LIPB1_PICTO     ------------------YKKCLDIQYRLVSMRKNDLIGNTIIFVEHDPVYTIGRKADPRNYSNVN----
LIPB_HAEIG      ------------------YQEIWHKMQDFTDTRNAE-TQDEIWLVQHYPVFTQGQAGKP-EHLLQRSEIP
LIPB_HAEIE      ------------------YQEIWHKMQDFTDTRNAE-TQDEIWLVQHYPVFTQGQAGKP-EHLLQRSEIP
LIPB_HAEI8      ------------------YQEIWHKMQDFTDTRNAE-TQDEIWLVQHYPVFTQGQAGKP-EHLLQRSEIP
LIPB_ACTPJ      ---MNQLIVRQLGVQP--YEEIWHQMQDFTDNR-NENTADEIWLVQHPSVFTQGSAGKP-EHLLNPTNIP
LIPB_ACTP7      ---MNQLIVRQLGVQP--YEEIWHQMQDFTDNR-NENTADEIWLVQHPSVFTQGSAGKP-EHLLNPTNIP
LIPB_ACTP2      ---MNQLIVRQLGVQP--YEEIWHQMQDFTDNR-NENTADEIWLVQHPSVFTQGSAGKP-EHLLNPTNIP
LIPB_PSEPG      -----------------PYEPVLEAMRRFTEQRSPDS-QDEIWLVEHPAVFTQGQ-AGKAEHLLVPGDIP
LIPB_PHOLL      --------------------------------------PDEIWLVQHPKVFTQGQ-AGKAEHLLSLGDIP
LIPB_COXB1      ----------------IPYQPLWEAMQTFTALRQS-QTTDEIWFLEHEPVFTQGLAGKP-EHVLNSGNIP
LIPB_YERE8      -----------------------------------DTSADEIWLVEHQHVFTQGQ-AGKAEHVLMPGDIP
LIPB_MANSM      ------------------YQKTWHEMQEFTDNRT-DKSADEIWLVQHPSVFTQGQ-AGKAEHLLRSTAIP
LIPB_HERAR      ------------------------------------QTADELWIVEHPPVFTLGLAADP-THVLDAHDIP
LIPB_BUCAI      ---------------------------------------DEIWFVEHYPIFTQGQ-SNEQKNLIVSNDIP
LIPB_ACIAD      --------------------------------------PDQLWILQHHPVLTQGQAGKP-EHILIPSDLP
LIPB_RHOS1      -------------------------------------------LLEHPPLYTAGTSARPED--LVEPERP
LIPB_JANMA      -------------------------------------------IVEHPPVFTLGLAADP-SHVLDPHQIP
LIPB_KLULA      -----------------------EIQLNFHEQMILDNINQMVLTFQFEPTYTGGKRV---KKQITDEQIA
LIPB_NITOC      ----------------------WQAMRDFTVRRDSATV-DELWWVEHPPVFTLG--LNGQECHLRDVGIP
LIPB_HAEIN      ------------------YQEIWHKMQDFTDTRNAE-TQDEIWLVQHYPVFTQGQAGKP-EHLLQRSEIP
LIPB_RHOS4      -------------------------------------------LLEHPPLYTAGTSARPED--LVEPERP
LIPB_PSEHT      -----------------------------------------IWLVEHESVFTQGQAGK--DEHLLAPGIE
LIPB_METFK      ------------------YLATWQAMQAYTQSR-DEHSHDELWLTEHAPIYTLGNRKGV--RLPSRHDIP
LIPB_RUTMC      ------------------YLNVWE-QMKIFTNARNKNTQDELWTVEHNPVFTQGXXXXXXXXXXXXXX-P
LIPB_PROM9      ----------------------YKLQKEYQEALILDNSPDFIWIGEHQLCYTLGRGSN-YDNSLNDEKYD
LIPB_PROM2      ----------------------YKLQKEYQESLILDNSPDFIWIGEHQLCYTLGRGSN-YDNSLNDDNYD
LIPB_BUCBP      --------------------------------------PDEIWLVQHYPVFTIGV-SGTKHDVLVSNNIP
LIPB_BAUCH      ------------------------------ERRKANTI-DEIWLVQHPPVFTQGNASESEYLLLIPGDIP
LIPB_PROMS      ----------------------YKLQKEYQDALILDNSPDFIWIGEHQLCYTLGRGSN-YDNSLNDAKYD
LIPB_PROM0      ----------------------YKLQKEYQEALILDNSPDFIWIGEHQLCYTLGRGSN-YDNSLNDAKYD
LIPB_YEAST      -----------------------------NEKRILDKVPNPIILFEFEPTYTGGKRIKKTMTPKDNPRPK
LIPB_FRATW      ---------------------------------------DEIWLVEHPAVFTQGKHGKP-EHILNSHNIP
LIPB_FRATT      ---------------------------------------DEIWLVEHPAVFTQGKHGKP-EHILNSHNIP
LIPB_FRATO      ---------------------------------------DEIWLVEHPAVFTQGKHGKP-EHILNSHNIP
LIPB_FRATN      ---------------------------------------DEIWLVEHPAVFTQGKHGKP-EHILNSHNIP
LIPB_FRATM      ---------------------------------------DEIWLVEHPAVFTQGKHGKP-EHILNSHNIP
LIPB_FRATH      ---------------------------------------DEIWLVEHPAVFTQGKHGKP-EHILNSHNIP
LIPB_FRATF      ---------------------------------------DEIWLVEHPAVFTQGKHGKP-EHILNSHNIP
LIPB_FRAT1      ---------------------------------------DEIWLVEHPAVFTQGKHGKP-EHILNSHNIP
LIPB_PROMA      ----------------IDFKIAWDWQRKWQEKLLAEPSKQAVWMLEHFDCYTLGRGASE-DNLLFDVEKP
LIPB_SODGM      ---------------------------------------DEIWLVQHPQVFTQGQ-AGKAEHLLQPGAIP
LIPB_PROM4      ----------------IDFRVAWDWQKQ--RQKLLFEKPGSVWLLEHSECYTLGRSNSPWD---------
LIPB_BUCAP      ---------------------------------------DEIWFLEHYPIFTQGLNTITYNNDILHD-IP
LIPB_VESOH      ------------------YLNIWDKMKTFTNTRDKN-TKDELWIVEHNPVFTQGVSSKP-EHILSNTDIP
LIPB_PSYCK      ------------------------LERISLKKEQGLRTPDELWIVDHNDVYTLGQ-AGKEEHILQRTNTP
LIPB_PSYA2      ------------------------LARIALKKEQGLRTPDELWIVDHNDVYTLGQ-AGKEEHILQRTNTP
LIPB_LEPBL      ----------------IPYLRYLEMQEKLRKFR-----RECILFLEHAPIITGGINYNPENEFLESQGIQ
LIPB_LEPBJ      ----------------IPYLRYLEMQEKLRKFR-----RECILFLEHAPIITGGINYNPENEFLESQGIQ
LIPB_WIGBR      -----------------------------------------IWLLEHYPVFTQGNSDNFNKKYIFN--IP
LIPB_LEPIN      ----------------IPYLRYLEMQEKLRKFR-----KECILFLEHAPTITGGINYNPENKPLESMGIQ
LIPB_LEPIC      ----------------IPYLRYLEMQEKLRKFR-----KECILFLEHAPTITGGINYNPENKPLESMGIQ
LIPB_PROHO      ---------------------------------------DTLLLLEHPPVYTLGRGSSPSSRAEPTPPQP
LIPB_CYACA      ------------------------------------------IYLKHPQVYTLGHRANKEYISFCSNNTL


                         .         .         *         .         .         .         .:140
query           VIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLAAAPD
LIPB_THEFY      VIDIDRGGKITWHGPGQLTAYPIVKLPAPLDVVAYVRMLEEAIIRVIGDFGLSGMRVEGRTGVWLAAAPD
LIPB_SALAI      VIDVDRGGKITWHGPGQLVGYPILRLPDPVDVVAYVRRVEQMLIDVCAEFGLVAGRIEGRSGVWV-PADD
LIPB_SALTO      VIDVDRGGKITWHGPGQLVGYPILRLPNPVDVVAYVRRVEQMLIDVCAEFGLVAGRIEGRSGVWV-PADD
LIPB_STRGG      VVDVDRGGKITWHGPGQLVGYPIQKLPRPVDVVAHVRRLEEALIRTAADFGVETSRIEGRSGVWVLGDPG
LIPB_STRCO      VIDVDRGGKITWHGPGQLVGYPIQKLPRPVDVVAHVRRLEEALIRTCAEFGLETSRVEGRSGVWVLGDPV
LIPB_ACIC1      VIAVDRGGRITWHGPGQLVGYPIVKLPMPIDAVGHVRRIEQALIAVCADLGVTAVRVPGRSGVWITSP--
LIPB_STRAW      VVDVDRGGKITWHGPGQLVGYPIQKLPRPVDVVAHLRRLEEVMIRVCAEFGVATSRVEGRAGVWVLGDPV
LIPB_CORJK      VVDVDRGGRITWHGPGQLVAYPIIKLADPVDVVDYVRRLEQALIQTCEDLGLHGTRVEGRSGVWLPAGVI
LIPB_MYCGI      VIDTDRGGKITWHGPGQLVGYPIIGLAEPLDVVNFVRRLEESLISVCASFGVQTGRVEGRSGVWVAG--D
LIPB_MYCVP      VIDTDRGGKITWHGPGQLVGYPIIGLAEPLDVVNFVRRLEESLITVCAELGLPTGRVEGRSGVWVEA--D
LIPB_LEIXX      VVDVDRGGKITWHGPGQLVGYPILRLREPVDVVGYVRRLESALIRVLGELGIAGERIEGRSGVWLPG--D
LIPB_RHOOB      VIDVDRGGKITWHGPGQLVGYPIVKLAEPVDVVRYVRRLEQALISVCTDLGIDCGRVDGRSGVWLPASLD
LIPB_RHOSR      VIDVDRGGKITWHGPGQLVGYPIVKLAEPVDVVRYVRRLEQALITVCTDLGIVCGRVDGRSGVWLPASFD
LIPB_MYCLE      VVETDRGGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGS--
LIPB_MYCLB      VVETDRGGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEEALIKVCAELGLDTSRVNGRSGIWVPGS--
LIPB_MYCUA      VVDTDRGGKITWHGPGQLVGYPIIRLAQPLDVVNYVRRLEESLIKVSLDLGLETRRVEGRSGVWIPAG--
LIPB_CLAM3      VIDVDRGGRITWHGPGQLVGYPIVRLPEPLDVVAHVRRXXXXXXXXXXXXXVASYRVDGRSGVWIGAAPD
LIPB_CLAMS      VIDVDRGGRITWHGPGQLVGYPIVRLPEPLDVVAHVRRXXXXXXXXXXXXXXXSCRVDGRSGVWIGTAPD
LIPB_MYCA1      VVDTDRGGKITWHGPGQLVGYPIIGLAEPLDVVDYVRRLEEALIKVCADLGLDTVRVPGRSGVWVPG--D
LIPB_CORGL      VINADRGGRITWHGPGQLVIYPIIKLADPIDVVDYVRRLEEALIQVVGDMGVAGARIDGRSGVWVPA--H
LIPB_CORGB      VINADRGGRITWHGPGQLVIYPIIKLADPIDVVDYVRRLEEALIQVVGDMGVAGARIDGRSGVWVPA--H
LIPB_MYCPA      VVDTDRGGKITWHGPGQLVGYPIIGLAEPLDVVDYVRRLEEALIKVCADLGLDTVRVPGRSGVWVPG--D
LIPB_MYCMM      AIDVDRGGKITWHGPGQLVGYPIIGLAQPLDVVNYVRRLEESLIKVCLDLGLETGRVEGRSGVWIPAG--
LIPB_MYCS2      VVDTDRGGKITWHGPGQLVGYPIIGLTEPLDVVNFVRRLEESLITVCAELGLHTERVEGRSGVWVPA--D
LIPB_MYCSS      VVDTDRGGKITWHGPGQLVGYPIVGLAEPLDVVNFVRRIEEALIAVCTGLGLDAGRVEGRSGVWL---PG
LIPB_MYCSK      VVDTDRGGKITWHGPGQLVGYPIVGLAEPLDVVNFVRRIEEALIAVCTGLGLDAGRVEGRSGVWL---PG
LIPB_MYCSJ      VVDTDRGGKITWHGPGQLVGYPIVGLAEPLDVVNFVRRIEEALIAVCTGLGLDAGRVEGRSGVWL---PG
LIPB_MYCTU      VVDTDRGGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEESLIQVCADLGLHAGRVDGRSGVWLP----
LIPB_MYCTA      VVDTDRGGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEESLIQVCADLGLHAGRVDGRSGVWLP----
LIPB_KOCRD      VVPIGRGGKLTYHGPGMLVGYPIVRLPIPLDVVRFVRVLEEVIIAVVRDFGVPATTVEGRSGAWV-LADE
LIPB_COREF      VIEVDRGGRITWHGPGQLVMYPIIKLAEPIDVVDYVRRLEEALIQTVRTFGVEAGRVDGRSGVWVPA--H
LIPB_ARTS2      VVAVDRGGKLTWHGPGQLIAYPILKLKNRSGIRDYVERLEAVMIAVMADYGINAERIKGRAGVWIKA--D
LIPB_MYCBT      VVGTDRGGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEESLIQVCADLGLHAGRVDGRSGVWLP----
LIPB_MYCBP      VVGTDRGGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEESLIQVCADLGLHAGRVDGRSGVWLP----
LIPB_MYCBO      VVGTDRGGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEESLIQVCADLGLHAGRVDGRSGVWLP----
LIPB_NOCFA      VVQVDRGGKITWHGPGQLVGYPIVRLAEPVDVVDYVRRLEEALISVCTELGLTVGRVEGRSGVWLPAT--
LIPB_RENSM      VIPVDRGGKLTWHGPGQLVGYPIIALADPHAIREYVATLEDILIAVLAQFGIKGERVDGRAGIWLLA--D
LIPB_CORDI      VIDVDRGGRITWHGPGQLVMYPIIKLAEPIDVVDYVRRVEEALIHVIRTHGINAGRIDGRSGVWVPGKTP
LIPB_ARTAT      VVPVDRGGKLTWHGPGQLIAYPILKLKNRAGIRDYVERLEAIMIAVMQDYGIKAVTVKGRAGVWI-LADD
LIPB_ARTCA      VVAVDRGGKLTWHGPGQLIAYPILKLKNRAGIRDYVERLEAVMIAVMADYGIRAERIKGRAGVWVKA--D
LIPB_TROWT      VIRVGRGGKITWHGPGQLVGYPILSLGATPDVLRYVRQIEEGLINALQSVGINGFRIAGRSGVWVR----
LIPB_TROW8      VIRVGRGGKITWHGPGQLVGYPILSLGATPDVLRYVRQIEEGLINALQSVGINGFRIAGRSGVWVR----
LIPB_CORA7      VIDVDRGGRITWHGEGQLVVYPIIKLAEPVDVVDYVRRLEEAIIQAVRELGVSAGRIDGRSGVWVAADPA
LIPB_PROAC      VVPVDRGGEITWHGPGQLVGYPIVFLQRGIGVVDYVRRVEEAVIRLVSQYGLRAGRVPGRTGVWF---PS
LIPB_RUBXD      VFWSDRGGDATFHGPGQLVGYPIIRLKVR-DTHRYLRDLEEVVIRALAGYGLEGRRHPRYTGVWVNGS--
LIPB_CHLSY      VVQSDRGGEVTYHAPGQLVAYPIFKLSQHSDVGRYVRGLEESVIRVLAGYGLVGERVAGLTGVWVRNGA-
LIPB_CHLAA      VVQSDRGGEVTYHAPGQLVAYPIFKLSQHSDVGRYVRGLEESVIRVLAGYGLVGERVAGLTGVWVRNGA-
LIPB_CHLAD      VVQSDRGGEVTYHAPGQLVAYPIFKLSQHSDVGRYVRGLEESVIRVLAGYGITGERVNGLTGVWVRGGA-
LIPB_ROSS1      VVQSDRGGGATYHAPGQIVAYPIFKLQHGRDIGRYLRGLEESVIRVLRDDGLIGERVPGLTGVWVRNGA-
LIPB_ACIBL      LIECDRGGDVTFHGPGQLVGYPIFDLRSKIGVIEYVRRIEEVLIRSCGDLGIPTTRVEGLTGVWTVNEP-
LIPB_PELPD      AIRISRGGDVTFHGPGQLVGYPLINLPRGCDLRHYLRFLEELLISVVADFGVSAFRVPGKTGVWT----D
LIPB_CALS8      VFEVTRGGDVTYHGPGQIVGYPIFDLTVGKDIKRFVWLLEEVFINLLKDYGIEAYRDEKQTGVWVGG---
LIPB_BACFR      LYHIDRGGDITYHGPGQLVCYPILNLEEGLGLKEYVHLLEEAVIRVCASYGVVAGRLEKATGVWLEGDTS
LIPB_GLOVI      LYRTERGGEVTYHGPGQLVGYPILDLTGRQDLHWYLRTLEQVLIEVLADFGVQGEREAGFTGVWAGG---
LIPB_BACFN      LYHIDRGGDITYHGPGQLVCYPILNLEEGLGLKEYVHLLEEAVIRVCASYGVVAGRLEKATGVWLEGDTS
LIPB_BACTN      LFHIDRGGDITYHGPGQLVCYPILNLEEHLGLKEYVHLLEEAVIRVCASYGIEAGRLEKATGVWLEGSTP
LIPB_THET8      LYWVERGGDVTYHGPGQLVGYPI--FPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVG----
LIPB_THET2      LYWVERGGDVTYHGPGQLVGYPI--FPVGREVRRFLRQIEEAIVRVAAGYGISAYPTPGYAGVWVG----
LIPB_GEOMG      VVEANRGGDVTFHGPGQLVGYPVIDLGRRRDLHRYLRILEELLINVAAEFGVAARREPGRTGIWT----D
LIPB_NOVAD      VVEAGRGGRYTYHGPGQRVGYVLLDLKRARDVRGFVHALEGWVIETLADFGVESWRAEGRVGIWTRGADG
LIPB_FLAJ1      FYKINRGGDITYHGPGQIVGYPILDLENFFDIHKYLRLLEESMILTLAEYGLESGRSEGETGVWLGV---
LIPB_PORGI      SRDIERGGDITYHGPGQITGYPIFDLEQGIGLRSYIEMLEQCIIDLIAIFGLKGERSAGASGVWLD--PD
LIPB_GEOSL      PVEINRGGDVTWHGPGQLVGYPILDLGCRRDLHRYLRFLEQVLMDAAASLGVQAWRVAGRTGIWTEGG--
LIPB_GRAFK      FYKINRGGDITYHGPGQIVGYPILDLDNFFDIHKYLRLLEEAVILTLSEYGLKSERSPGETGVWL----D
LIPB_ANATD      VFEVSRGGDVTYHGPGQLVGYPIFDLATDRDIKKFVYLLEEVFIRLLKDFGKEAHRDENKTGVWVG----
LIPB_CYTH3      YYEINRGGDITYHGPGQLVGYPIFDLDNFFDIHKYLRYIEEAIILTLADFNIVAGRIDGLTGVWIES--D
LIPB_DANRE      FCRTNRGGLITFHGPGQLVCYPILNLGCKKSVRWYVCELERTVIKMCGKFGIKAS-TSPDTGVWVG----
LIPB_ACIC5      IHEVNRGGDVTYHGPGQLVGYPILDLRSRLGAVEYVRWVEEALIRTCADFGVQTQRVAGRTGVW--TLPG
LIPB_PELCD      VVSINRGGDITYHAPGQLVGYPXXXXXXXXXXXXYLRFLEEVLIAAAADTGVEGFRREGKTGVWTE----
LIPB_MAGSA      VYETGRGGQYTYHGPGQRVAYVLLDLKRRADVRVYVCNLEEWLIRTLARFVVKGERRTGRVGIWVDRGGG
LIPB_NITHX      LFSTGRGGQVTYHGPGQRVAYVMLDLKRRRDVRAFVAGLEEWIIRTLDTFDIKGERREDRVGVWVAR-PD
LIPB_SYNP6      VYRIERGGEVTHHAPGQLVGYPILNLRHHCDLHWYLRQLEAVLILVLANYGLTGERIEGLTGVWVEG---
LIPB_SYNE7      VYRIERGGEVTHHAPGQLVGYPILNLRHHCDLHWYLRQLEAVLILVLANYGLTGERIEGLTGVWVEG---
LIPB_NOSP7      VHRVERGGEVTYHCPGQLVGYPILNLQRRKDLHWYLRQLEEVIIRVLTVYGLQGERIPAFTGVWLQG---
LIPB_GEOUR      VRRINRGGDVTYHGPGQLVGYPVIDLARRCDLHRYLRFIEELLMLVVADFRVAAFRSPGRTGVWT----D
LIPB_THETN      LYKVERGGKITFHGPGQVVAYPIFNLAKQKDVHLFVHNLEEAVIRLLREYGIIAGRKEKYTGVWVG----
LIPB_PARD8      FYHINRGGDITYHGPGQITGYPVFDLEYNLGLKQYIHMLEETIIRFLSLYDLKGERLEGATGVWLPEVPG
LIPB_ANAVT      EFEIERGGEVTYHCPGQLVGYPILNLRRHRDLHWYLRQLEEVIIRVLAVYGLKGDRLPSLTGVWLEG---
LIPB_TRIEI      KYEVERGGEVTYHCPGQLVGYPILNLKHQQDLHWYLRQLEEVLIKVLDIFGLKGERYPGLTGVWLEG---
LIP2P_ARATH     VYRTERGGEVTYHGPGQLVMYPIINLRNEMDLHWYLRMLEEIVIRVLSSFSIKASRLDGLTGVWVG----
LIPB_XENTR      FQRTDRGGLITFHGPGQLVCYPVLHLGARRSLRSYVCGLESAVIRLCRGLGLPGER-QPDTGVWV-----
LIPB_JANSC      VFETRRGGQYTYHGPGQRVAYVMLDLNTRKDVRAFVQRLEAWVIAALDDFNVTGAVREGRVGVWVAPLPD
LIPB_DICT6      FIRVDRGGDITYHGPSQLVGYFIFKVDG---VKNFVLKVEKSIINVLHEYGIEAKESIEYPGVWVE----
LIPB_SOLUE      FFPTNRGGDVTYHGPGQLVGYPILDLRDKRDVGAYVRALEQAIIDTLGDYGIEAGRIPKLTGVWVG----
LIPB_SYNJA      VTEVERGGEVTYHGPGQWVGYALLNLKGQPDLHRYLRHLEEVLIQTVAHFGLQGERIPGLTGVWVQG---
LIPB_ARATH      LHYTQRGGDITFHGPHQAILYPIISLRSGFGARNYVETLERSMIEFASIYGVAGNKCE--TGVWVG----
LIPB_SYNJB      AIHVERGGEVTYHGPGQWVGYAMLNLKRHRDLHEYLRQLEEVVIQTLAHFGLQGERIPGLTGVWVQG---
LIPB_ANASP      EFEIERGGEVTYHCPGQLVGYPILNLHRHRDLHWYLRQLEEVIIRVLAVYDLKGDRLPSLTGVWLEG---
LIPB_THEEB      VLRIERGGDVTYHCPGQLVAYPILNLRRHCDLHWYLHQLEEVIIQTLRHYGIKGERVAGLTGVWVEGY--
LIPB_SPHAL      VYDAGRGGRYTYHGPGQRVGYVQLDLTRRRDVRAYVHALEGWVIDALALLGVKARRAEGRIGIWTDDVRG
LIPB_NEOSM      VFNVGRGGKYTYHGPGQRVIYPILNLRSRCDLHKYIYLLEEVVIVTLDNFGINGCRKEGHIGVWVGTGCQ
LIPB_DROME      FHRTDRGGLITFHGPGQLVAYPILHLGQFVPSIRYVATLERMVVEACHQMGISSAKATKDTGIWVG----
LIPB_ALKMQ      LFNTDRGGDVTYHGPGQIVGYPIVNIKSKIGVKKFVENLEEVLIRLLDEYHITATRSSVNPGVWVGA---
LIPB_RICBR      VIYTGRGGKFTFHGAGQRVIYPILNLALPKDLKLYVRMLEEWIINSLDIFGIKAYIIKNKVGIWVKTNDD
LIPB_RICB8      VIYTGRGGKFTFHGAGQRVIYPILNLALPKDLKLYVRMLEEWIINSLDIFGIKAYIIKNKVGIWVKTNDD
LIPB_NITWN      LFSTGRGGQITYHGPGQRIAYVMLDLKRRRDVREFIACLEEWIIRTLDAFGVKGERREDRVGVWVAR-PD
LIPB_RICPU      VIYTGRGGKFTFHGPGQRVIYPILNLDSPKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKD
LIPB_MESSB      VYQTGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVTALEDWIIASLARFNIRGERRQGRVGVWVARPPD
LIPB_BURPP      LVKVDRGGQITYHGPGQVVAYLLLDLRRKLMVRELVTRIEQAVIDTLAAYNLAGERKAGAPGIYVAPGPD
LIPBL_ARATH     VYRTERGGEVTYHGPGQLVMYPIINLRNKMDLHWYLRKLEEVVIRVLSSFAINASRLDGFTGVWVG----
LIPB_PARL1      VFSTGRGGQYTYHGPGQRVAYVMLDLKRRKDVRAYVQDLERWLIATLAEFNVTGETRPDRVGVWVKR-PE
LIPB_SYNY3      PAELERGGEVTYHCPGQLVGYPILDLNHQKDLHWYLRQLEEVLIITLEKLDLQGERIAGLTGVWLEG---
LIPB_RICCN      VIYTGRGGKFTFHGPGQRVIYPILNLASPKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKD
LIPB_RHORT      VYAAGRGGQYTYHGPGQRVGYVMLDLRRRKDVRCFVHNLEELMIRALAEFNIXXXXXXXXVGIWVARGGG
LIPB_MAGSM      AVYTDRGGQVTYHGPGQLVVYVLWNLRGQLHGVAHVARLEEMVMEVLAHYGVVGQRDGAGPGIWVGDA--
LIPB_SYNPW      LHRIDRGGEVTHHAPGQLVIYPVLDLHRHTDLHWYLRQLEQVVIDVLAALGLRGERIEGLTGVWL-----
LIPB_RICM5      VIYTGRGGKFTFHGPGQRVIYPILNLASPKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWAKVRKD
LIPB_RICAE      VIYTGRGGKFTFHGPGQRVIYPILNLASPKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKD
LIPB_RICRS      VIYTGRGGKFTFHGPGQRVIYPILNLDSPKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKD
LIPB_RICRO      VIYTGRGGKFTFHGPGQRVIYPILNLDSPKDLKLYIKMLEEWIINSLNYFGIKAYIIKDKVGIWVKVRKD
LIPB_GLUDA      TYAAGRGGQWTYHGPGQRVAYVMLDLTAPHGVVAYVHTLEEWLIRTLRRFDVTGERRADRIGVWVVDA--
LIPB_RHOPA      LFTTGRGGQLTYHGPGQRVAYVMLDLKRRRDVRAYVAALEQWIIATLDAFNIRGERREDRVGVWVRR-PD
LIPB_FLAPJ      FYKINRGGDITYHGPGQIVGYPILDLENFFDIHKYXXXXXXXXXXXXXXYNITGTRSEGETGVWLGV---
LIPB_RICPR      VIYTGRGGKFTFHGPGQRVIYPILNLALPKDLKLYIKMLEEWIINSLNYFGIKGYLIKDKVGIWIKV--N
LIPB_SILPO      VYESKRGGQYTYHGPGQRVVYVMLDVKRGHDVRRFVEQLEEWVIAALAEFNIRGEIRPGRVGVWVRREDK
LIPB_SALRD      FHRIGRGGDVTFHGPGQLVGYPLFDLDRFFDLGRYLRTLEEAIIRTCADYXXXXXXXXXXXXXXXX--PD
LIPB_RICFE      VIYTGRGGKFTFHGPGQRVIYPILNLASPKDLKLYIKMLEEWIINSLNYFGIKTYIIKDKVGIWVKV---
LIPB_RICCK      VIYTGRGGKFTFHGPGQRVIYPILNLASPKDLKLYIKMLEEWIINSLNYFGIKAYLIKDKVGIWVKVRKD
LIPB_RHOP5      MYPTGRGGQITYHGPGQRVAYVMLDLKRRRDVRAYVAGLEQWIIATLEHFNVKGERREDRVGVWVKR-PD
LIPB_DESPS      VVSIERGGEITYHGPGQLVLYPILHLKRKMRVTEYVGLLEETMIRLAADFGVRVVRNTRNAGVWTEDG--
LIPB_SYNFM      VVQVERGGDVTYHGPGQAVVYPILHLESGLSLADYVSALESLVIGVLGDFXXXXXXXXXXXXXXXXXD--
LIPB_BRUME      VFNTGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVASLEQWIIETLAAFNIKGERREDRVGVWVVRPED
LIPB_BRUMB      VFNTGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVASLEQWIIETLAAFNIKGERREDRVGVWVVRPED
LIPB_BRUAB      VFNTGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVASLEQWIIETLAAFNIKGERREDRVGVWVVRPED
LIPB_BRUA2      VFNTGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVASLEQWIIETLAAFNIKGERREDRVGVWVVRPED
LIPB_SINMW      VFATGRGGEYTYHGPGQRVVYVMLDLKRRRDVRAFVAALESVIIATLDSMNVKGERREDRVGVWVRRPED
LIPB_RICAH      VIYTGRGGKFTFHGPGQRVIYPILNLASPKDLKLYIRMLEEWIINSLNYFGIKAYLIKDKVGIWVKVRKD
LIPB_PYRCJ      VYVVERGGDATYHGPGQLVAYPVVKLRWPLS--RYLWMLEEAVIRSLRPLGVEAGRVEKHRGVWVGG---
LIPB_ERYLH      VVEAGRGGRYTYHGPGQRVGYALLDLKRGKDVRRFVHAIEDWVIATLRTFGVESWSVDGRVGIW---TKD
LIPB_BRUSU      VFNTGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVASLEQWIIETLAAFNIMGERREDRVGVWVVRPED
LIPB_HYPNA      VFEAGRGGQYTYHGPGQRVAYVMLDVAARRDVRAFVAHLEAWIIQALAAFNVEGGMRDGRVGVWVDRTEP
LIPB_SYNSC      LYRIDRGGEVTHHLPGQLVAYPVLDLQRRTDLHWYLRQLEQVVLDVLAELGLEGQRLPGLTGLW------
LIPB_RICTY      VIYTGRGGKFTFHGPGQRVIYPILNLALPKDLKLYIKMLEEWIINSLNYFGIKGYLIKDKVGIWIKVSKG
LIPB_DINSH      VHTARRGGQYTYHGPGQRVVYVMLDLKRGRDVRQFVCRMEAWVIATLAEFNVTGERREGRVGVWVQRQDK
LIPB_SYNPX      VHRIDRGGEVTHHLPGQLVAYPVLDLRRQPDLHWYLRELEQVLIDVLAQLDLRGERLPGLTGLW------
LIPB_RHOPT      LFTTGRGGQLTYHGPGQRVAYVMLDLKRRRDVRAYVAALEQWIIATLDAFNIRCERREDRVGVWVRR-PD
LIPB_DESRM      IFKSNRGGDVTYHGPGQIVGYPIVDLNGHKSIREYVHKIEETFIQLLKEYDLTASRESKYHGVWLG----
LIPB_PYRAE      VYLVERGGDATYHGPGQAVVYPIVALRWPLK--RYIDAIEDAVIKTLGTYGILAGKKQGHRGVWVG----
LIPB_ORITB      VHHTDRGGKFTYHGPGQIIIYPVINLAANKDIRNYVNNLASLVINSLKFFNIIGITVQDTIGVWI----D
LIPB_HALHL      VVHTDRGGQVTWHGPGQLVAYPLLDLRRGLGVRTLVHALEQSVVSLLAAYGVPSHRREDAPGVYVDGA--
LIPB_BURPS      LVKVDRGGQITYHGPGQIVAYLLVDLRRKLMVRTLVTRIEEAVIETLAAYNLASARKAGAPGIYVESGPH
LIPB_BURP6      LVKVDRGGQITYHGPGQIVAYLLVDLRRKLMVRTLVTRIEEAVIETLAAYNLASARKAGAPGIYVESGPH
LIPB_BURP1      LVKVDRGGQITYHGPGQIVAYLLVDLRRKLMVRTLVTRIEEAVIETLAAYNLASARKAGAPGIYVESGPH
LIPB_BURP0      LVKVDRGGQITYHGPGQIVAYLLVDLRRKLMVRTLVTRIEEAVIETLAAYNLASARKAGAPGIYVESGPH
LIPB_BURMS      LVKVDRGGQITYHGPGQIVAYLLVDLRRKLMVRTLVTRIEEAVIETLAAYNLASARKAGAPGIYVESGPH
LIPB_BURMA      LVKVDRGGQITYHGPGQIVAYLLVDLRRKLMVRTLVTRIEEAVIETLAAYNLASARKAGAPGIYVESGPH
LIPB_BURM9      LVKVDRGGQITYHGPGQIVAYLLVDLRRKLMVRTLVTRIEEAVIETLAAYNLASARKAGAPGIYVESGPH
LIPB_BURM7      LVKVDRGGQITYHGPGQIVAYLLVDLRRKLMVRTLVTRIEEAVIETLAAYNLASARKAGAPGIYVESGPH
LIPB_AZOSE      LVKIDRGGQITYHGPGQLVAYLLIDLRRGLKVRELVTLMEQAVIDCLAGYGVGAERKAGAPGVYVDGA--
LIPB_AZOSB      LVKIDRGGQITYHGPGQLVAYLLLDLRRHLKVRELVALMEQAVIDCLAEYGLHAERKDGAPGVYIDGA--
LIPB_ORITI      VHHTDRGGKFTYHGPGQIIIYPVINLAVNKDIRNYVNNLASLVINSLKFFNITGITVQDTIGVWI----D
LIPB_VARPS      VVQTDRGGQVTFHGPGQVVAYPLIDLRAGYFVKEYVYRIEESVLRTLAHFGVTGHRVAGAPGIYVAGDPF
LIPB_DESDA      HVDITRGGNVTCHFPGQLVAYPVISLKKRSGGIAYVHDLEEAAIRMLARFGVTAARRQGFPGVWTG----
LIPB_BARBK      VYEAGRGGEFTYHGPGQRIAYIMLDLKRKQDIRAFISALEQWIIQTLAQFNIKGERREDRIGVWVVR-PD
LIPB_FRASC      VHETNRGGLLTYHAPGQLVGYVMCHIGAMNAVVPFLRLLEARLVDTVEALGIPAERRDELTGVWTRRT--
LIPB_XYLFA      VVHVDRGGQVTYHGPGQLVVYPLLDLPLGLGVRDYVYGIEQAVINTLAQWNILGERREHAPGVYVGGA--
LIPB_BORPD      VVMCDRGGQVTYHGPGQVVAYTLFDLRAGLFVREYVRLLEDAAIGTLDDFGVPGCRKPGAPGVYVPLGPA
LIPB_PARDP      VHAVGRGGQYTYHGPGQRVVYVMLDLNRRRDVRAFVKALENWVIDALAEFNLRGEIRDGRVGVWIARPPD
LIPB_BARQU      VYEAGRGGEFTYHGPGQRIAYIMLDLKRRRDIRAFIGALEEWIIQTLAKFNIKGERREDRVGVWVKRPTQ
LIPB_SPHWW      VFRSGRGGRYTYHGPGQRVGYVXXXXXXXXXXVCFVAAIENWVIATLGDFGIAGRSEPGRVGIWTGHGPD
LIPB_MOUSE      VRATGRGGLATFHGPGQLLCHPVXXXXXXXXXXTHVAALEACAVRLCELRGLQGARARPPTGVWLG----
LIPB_DICTD      FLRVDRGGDITYHGPLQLVGYLIFRVEG---VKNFVLKIERSIINVLNEYGIEAKENLKYPGVWVG----
LIPB_DESDG      VAQTTRGGNITCHFPGQLVAYPVFRIAGPGGMRALFYSLEEVVIRTLARFGLQAFRSEGRPGVWIE----
LIPB_CLOK5      KYSIDRGGNVTYHGPGQLVGYPILNLNNQKDIHLYLRQLELILINTVREYGIKAGIKPKYTGVWVG----
LIPB_BURTA      LVKVDRGGQITYHGPGQIVAYLLIDLRRKLMVRTLVTRIEQAVIETLAAYNLASVRKAGAPGIYVESGPH
LIPB_MYXXA      VFETNRGGDVTYHGPGQLVGYPIFLLPXXXXXXXXXXXXXXSVMQVLAQWGITAGPIPKWPGVWIGA---
LIPB_BRASO      FIATGRGGQVTYHGPGQRVAYVMLDLKRRRDVRAYVAALEETIIRTLDAFNXXXXXXXXXXXXXXKR-PD
LIPB_XYLFT      VVHVDRGGQVTYHGPGQLVVYPLLDLSRGLGVRDYVYGIEQAVINTLAQWNILGERREHAPGVYVGDA--
LIPB_BURVG      LVKVDRGGQITYHGPGQIVAYLLLDLRRKLMVRTLVTRIEEAVIETLAAYNLASVRKAGAPGIYVASGVH
LIPB_RHIME      VFATGRGGEYTYHGPGQRVVYVMLDLKRRRDVRGFVAALESVIIATLDSMNVKGERREDRVGVWVRRPED
LIPB_BART1      VYEAGRGGEFTYHGPGQRIAYIMLDLKRKQDIRAFISALEEWIIQMLASFNIKGERREDRVGVWVKQSPS
LIPB_DESVM      LVQSSRGGNITCHFPGQLVAYPVFRVAKPGGLRQMFHDLEEVVITTLAHFGLSAARWEGRPGVWIE----
LIPB_MARMM      VYETGRGGEYTYHGPGQRVAYVMLDLTRRRDVRKFIQSLENWLIGAAAQFGIKAGIRDGRVGVWVDRSGG
LIPB_BURS3      LVKVDRGGQITYHGPGQIVAYLLLDLRRKLMVRTLVTKIEEAVIETLAAYNLASVRKAGAPGIYVASGVH
LIPB_EHRRW      VYSTGRGGKYTYHGPGQRIAYVMMDLKAKCNVRLYVETLGEWIVKTLKHFSIRSYFNPNLIGVWV----N
LIPB_EHRRG      VYSTGRGGKYTYHGPGQRIAYVMMDLKAKCNVRLYVETLGEWIVKTLKHFSIRSYFNPNLIGVWV----N
LIPB_CELJU      VVQTDRGGQVTYHGPGQLVAYPLLDLRRKMGVRDLVTAIEQTIVATLAEYGIESYPKPDAPGVYVE----
LIPB_CAUCR      VFESGRGGQFTYHGPGQRVAYVMLDLTQRRDVRAFVAALEAWIIDALAAFNVTGELREGRVGVWVERKGA
LIPB_BURCA      LVKVDRGGQITYHGPGQIVVYLLLDLRRKLMVRALVTKIEEAVIETLAAYNLASVRKAGAPGIYVASGVH
LIPB_MARAV      VIQVDRGGQVTYHGPGQLVIYLLIDLTRKLGVRNLVSAIEQAIVRTLAQGGIEAAPRSDAPGVYVNGA--
LIPB_WOLPP      IYKTGRGGKYTYHGPGQRIIYLMLNLKKKCDIKLYIRDLSNWIINVLKHFNILGEFKEDRIGIWVN---N
LIPB_BRASB      LVPTGRGGQVTYHGPGQRVAYVMLDLKRRRDVRAYVAALEEMIIRTLDAFNXXXXXXXXXXXXXXXX-PD
LIPB_THEPX      XXXVERGGKITFHGPGQIVAYPIFNLAKQKDVHLFVYXXXXXXXXXXXXYGIKAGRKPKYTGVWVG----
LIPB_THEP3      XXXVERGGKITFHGPGQIVAYPIFNLAKQKDVHLFVYXXXXXXXXXXXXYGIKAGRKPKYTGVWVG----
LIPB_DESVV      LAQSSRGGNITCHFPGQLVAYPVFRIERPGGLRSFFHDLEEVVLRTLHTFGLEASRHEGRPGVWI-----
LIPB_DESVH      LAQSSRGGNITCHFPGQLVAYPVFRIERPGGLRSFFHDLEEVVLRTLHTFGLEASRHEGRPGVWI-----
LIPB_DEIRA      VFAVERGGDVTYHGPGQLVAYAI--FPVGRRVRDFLRLLENAVVTALGTLGLPDARPNGYAGVYVDPREI
LIPB_XANOR      VLQVDRGGQVTYHGPGQLVVYPLLDLRRKIGVRDYVCKIEQALIGMLDEWNIVAERRDGAPGVYVGGA--
LIPB_XANOM      VLQVDRGGQVTYHGPGQLVVYPLLDLRRKIGVRDYVCKIEQALIGMLDEWNIVAERRDGAPGVYVGGA--
LIPB_RALEJ      MVQIDRGGQITYHGPGQVVAYLLLDLKRKLMVRELVNDIEQAVLDTLAAYNLAAERKPGAPGIYLSDGPH
LIPB_BURCH      LVKVDRGGQITYHGPGQIVVYLLLDLRRKLMVRTLVTKIEEAVIETLAAYNLASVRKAGAPGIYVASGVH
LIPB_BARHE      VYEAGRGGEFTYHGPGQRIAYIMLDLKRRRDIRAFISALEEWIIQMLAKFNIKGERREDRVGVWVQSTQN
LIPB_AERHH      VVQSDRGGQVTYHGPGQLVLYVLVDVRSKLTVRELVTCLETAIINTLAKSGIEAYAKPDAPGVYVKNQLG
LIPB_RHOP2      LHTTGRGGQLTYHGPGQRVAYVMLDLKRRRDVRAYVAALEQWIIATLDAFXXXXXXXXXXXXXXXAR-PD
LIPB_POLSQ      LVQVDRGGEITYHGPGQIVVYLLLDLKRGIFVKELVSRIEQALINTLADFGLVAERRSGAPGIYVSLQPG
LIPB_POLNA      VVQTNRGGQVTFHGPGQVVVYPLIDLKAGYFVKEYVYRIEESVIRTLAHFGVTGHRVAGSPGIYVPSDPF
LIPB_GEOSM      PVRVNRGGDVTYHGPGQLVCYPILDLSRRRDLHRYLRFLERFLVELCAGLGVACHTVPGRTGVWTGNG--
LIPB_CHRSD      VVATDRGGQVTYHGPGQVVLYPLIDVRGKLGVRELVSALEQAVIDLLAAHGVTARARPDAPGVYVG----
LIPB_BURCM      LVKVDRGGQITYHGPGQIVVYLLLDLRRKLMVRTLVTKIEEAVIETLAAYNLASVRKAGAPGIYVASGVH
LIPB_BURA4      LVKVDRGGQITYHGPGQIVVYLLLDLRRKLMVRTLVTKIEEAVIETLAAYNLASVRKAGAPGIYVASGVH
LIPB_PYRAR      IYVVERGGDATYHGPGQAVVYPVVRLRG--GVRSYLWALEEAVIRTLDKYGISAGRREDHRGVWVGG---
LIPB_DECAR      LVKIDRGGQVTYHGPGQVVIYLLLDLSLKIKVRELVTAIEQSVIDLLAEYGITAERRDGAPGVYVG----
LIPB_XANCB      VLQVDRGGQVTYHGPGQLVVYPLLDLRRRIGVRDYVCKIEQALIDTLGEWNIIAERRDGAPGVYVGGA--
LIPB_NITMU      VVRTDRGGQITYHGPGQIIAYLLLDMRLKLGVRDLVRKMEGAVVDLLDEYRVNACGDEDAPGVYVGGA--
LIPB_BURCC      LVKVDRGGQITYHGPGQIVVYLLLDLRRKLMVRTLVTKIEEAVIETLAAYNLASVRKAGAPGIYVASGVH
LIPB_AERS4      VVQSDRGGQVTYHGPGQLVLYVLVDVRSKLSVRELVTCLETAIINTLAKSDIQAYAKADAPGVYVTN--E
LIPB_XANCP      VLQVDRGGQVTYHGPGQLVVYPLLDLRRKIGVRDYVCKIEQALIDTLDEWNIVAERRDGAPGVYVGGA--
LIPB_XANC8      VLQVDRGGQVTYHGPGQLVVYPLLDLRRKIGVRDYVCKIEQALIDTLDEWNIVAERRDGAPGVYVGGA--
LIPB_AZOVD      VVQVDRGGQVTYHGPGQLVGYLLLDVRSGMGVRELVSRIERSLIELLAGYDVEAHARPDAPGVYVG----
LIPB_SHEDO      VIQVDRGGQVTYHGPGQLVAYPLIDIKAKLGVRQLVNHIEQSIIDMLSPYDIKAYAKTDAPGVYV-----
LIPB_GLUOX      TYSAGRGGQWTYHGPGQRLGYVMMDLTKPRDLRAFVAGLEGWMTDTLARLGVTAFTREGRIGVW-TIDPL
LIPB_BURM1      LVKVDRGGQITYHGPGQIVAYXXXXXXXXXXXXXXXXXIEEAVIETLAAYNLASVRKAGAPGIYVASGVH
LIPB_XANC5      VLQVDRGGQVTYHGPGQLVVYPLLDLRRKIGVRDYVCKIEQALIDTLEEWNIVAERRDGAPGVYVGGA--
LIPB_RALPJ      LVKVDRGGQITYHGPGQVVAYLLLDLRRGLFVKALVDAIEAAVIQTLATYNVASERKAGAPGIYLSSGPH
LIPB_HUMAN      VRVTGRGGLATFHGPGQLLCHPVXXXXXXXXXXXHVASLEACAVRLCELQGLQDARARPPTGVWL-----
LIPB_SHEWM      VIQVDRGGQVTYHGPGQLVAYPLINIKRKIGVRQLVTDIENSIVQMLENYQVKAYAKADAPGVYV-----
LIPB_RHOPS      LHATGRGGQLTYHGPGQRVAYVMLDLKRRRDVRAYVAALEQWIIATLEAFNXXXXXXXXXXXXXXAR-PD
LIPB_RALSO      LVKVDRGGQITYHGPGQVVAYLLLDLRRGLFVKALVDAIEAAVIDTLATYNVASERKAGAPGIYLSAGPH
LIPB_MARMS      VIQVDRGGQVTYHGPGQLVAYVMVDLKRGIGVRDLVSVLENSVVRALALNAIEAYPKPDAPGVYV-----
LIPB_ANAPZ      VIKTTRGGKYSYHGPGQRVVYVMLDLKRRCDIRAYVRDLGVWIVNTLAEFAIDSYFSSENIGVWV----Q
LIPB_ACIAC      VVATNRGGQVTFHGPGQVVAYPLVDLRAGYYVKEYVHRVEEAAIRTLAHFGVTGHRVAGAPGIYVRLDDP
LIPB_XANAC      VLQVDRGGQVTYHGPGQLVVYPLLDLRRKIGVRDYVCKIEQALIDTLDEWNIVAERRDGAPGVYVGGA--
LIPB_SHESH      VIQVDRGGQVTYHGPGQLVAYPLINIKRKIGVRQLVTDIENSIVQM-----LEGYQVKAYAK---ADAPG
LIPB_METCA      VVRTDRGGQVTYHGPGQLVLYTLVDLQRKLGVRRMVSALEQAVIGLLRQYGLEARARGDAPGVYVDGA--
LIPB_ZYMMO      VYPAERGGRYTYHGPGQRIGYLMMDIRKHNDIRRFVHSIEKWVIESLAEFGVTAYSHPERIGIWVDT-PD
LIPB_SYNS9      LHRIDRGGEVTHHLPGQLVAYPVLDLQRHTDLHLYLRQLELVVIDVLRDLGLQGECLPGLTGVWVGRC--
LIPB_WOLTR      IYKTGRGGKYTYHGPGQRIIYLMLNLKKKCDIKLYIRELGSWIINVLKHFNIFGEFKEDRIGVWVN---N
LIPB_PROMM      LHRIDRGGEVTHHLPGQLVVYPVLDLRRQTDLHWYLRQLEQVLIDVLAVLGLAGERLQGLTGLWLEG---
LIPB_PELUB      LVKTNRGGKITYHGPGQLICYFVXXXXXXXXXXXFITLIEETIIDSLSKFNIKTFGDPKNIGIWT----D
LIPB_DELAS      VVATNRGGQVTYHGPGQVVAYPLLDLQLGYFVKEYVFRIEDAVIRTLEHFGITGHRVEGAPGIYLAQRPQ
LIPB_AGRT5      VFATGRGGEYTYHGPGQRVVYVMLDLKRRRDVRAYVAALEDVIIRTLDKMNXXXXXXXXXXXXXXXXPPD
LIPB_RHOPB      LYASGRGGQVTYHGPGQRVAYVMLDLKRRRDVRAYVAALEQWIIGTLAHFNXXXXXXXXXXXXXXAR-PD
LIPB_PSEU5      VVQVDRGGQVTYHGPGQLVGYLLLDVRRGIGVRELVSRIERSLIDLLAGYDVEAVAKPDAPGVYVGGA--
LIPB_METPP      VVASNRGGQVTYHGPGQVVAYPLIDLQAGIFVKEYVFRLEQAVIKTLEGYGVTGHRVTGAPGIYVNLCDP
LIPB_SHEAM      VIQVDRGGQVTYHGPGQLVAYPLLDIKRKIGVRQLVTHIEQSIVDMLKPYGVQAYAKADAPGVYV-----
LIPB_GEOBB      PVRVNRGGDVTYHGPGQLVCYPILDLSRRRDLHRYLRFLERFLVELCAGLGVGCHTVPGRTGVWTGNG--
LIPB_EHRCR      VYATNRGGKYTYHGPGQRIAYVMLNLKTKCNIRLYVETLGNWIVETLSHFSVKSYFNPDLIGVWVT----
LIPB_BORPE      VVHCDRGGQVTYHGPGQVLAYTLFDLRAGLYVREYVDMLEQATLATLRELGLEACRKPGAPGIYV---PQ
LIPB_BORBR      VVHCDRGGQVTYHGPGQVLAYTLFDLRAGLYVREYVDMLEQATLATLRELGLEACRKPGAPGIYV---PQ
LIPB_SHESR      VIQVDRGGQVTYHGPGQLVVYPLLDIKSKIGVRQLVTHIEQSIIDMLAKYDINAYAKADAPGVYV-----
LIPB_SHESM      VIQVDRGGQVTYHGPGQLVVYPLLDIKSKIGVRQLVTHIEQSIIDMLAKYDINAYAKADAPGVYV-----
LIPB_DESAD      VVQTARGGNITCHYPGQMVVYPVMRIEKRRGIKKFFFDMEETAIRTAARFGVQAARSEGRPGVWVGPG--
LIPB_BORPA      VVHCDRGGQVTYHGPGQVLAYTLFDLRAGLYVREYVDMLEQATLATLRELGLEACRKPGAPGIYV---PQ
LIPB_ALHEH      VVETDRGGQVTYHGPGQIVLYPLLDLRRGLGVRSLVSALEHTVISLLAGYGIASEARDDAPGVYVEG---
LIPB_WOLPM      IYKTGRGGKHTYHGPGQRIIYLMLNLKKKCDIKLYIRDLSKWIINVLKQFNILGEFREDRIGIWV----N
LIPB_SHELP      VIQVDRGGQVTYHGPGQLVAYPLLDIKRKIGVRQLVTDIEQSIVKMLALYGIEAYPKADAPGVYVE----
LIPB_SACD2      VVATDRGGQVTYHGPGQLVAYPLLDLRRKIGVRELVTKIEQSVVALLAEYKIDSAPKADAPGVYVNGD--
LIPB_THIDA      VVPIDRGGQITYHGPGQVVAYVLVDLRRGYGIRELVARLEQAVIDLLAASNVEATRRAGAPGVYVDGA--
LIPB_SHESA      VIQVDRGGQVTYHGPGQLVVYPLLDIKSKIGVRQLVTHIEQSIIDMLAKYDINAYAKADAPGVYV-----
LIPB_SHEON      VIQVDRGGQVTYHGPGQLVVYPLLDIKSKIGVRQLVTYIEQSIIDMLAKYTINAYAKADAPGVYV-----
LIPB_SHEFN      VIQVDRGGQVTYHGPGQLVVYPLIDIKRKLGVRQLVNNIEQSIIDMLAYYAINAYAKADAPGVYVT----
LIPB_NEIMB      VVQIDRGGQITYHGPGQLVVYTMIDFKRKTSVRNIVSALENSIIATLAEYGIEAAADPKRPGVYVG----
LIPB_NEIM0      VVQIDRGGQITYHGPGQLVVYTMIDFKRKTSVRNIVSALENSIIATLAEYGIEAAADPKRPGVYVG----
LIPB_NEIG2      VVQIDRGGQITYHGPGQLVVYTMIDFKRKTSVRNIVSALENSIIATLAEYGIEAAADPKRPGIYVG----
LIPB_NEIG1      VVQIDRGGQITYHGPGQLVVYTMIDFKRKTSVRNIVSALENSIIATLAEYGIEAAADPKRPGIYVG----
LIPB_BURXL      LVKVDRGGQITYHGPGQVVAYLLLDLRRKLMVRELVTRIEQAVIDTLAAYNLAGERKAGAPGIYVXXXXX
LIPB_BRAJA      TFATGRGGQLTYHGPGQRVAYIMLDLKRRRDVRAYVASLEELILKTLAAFNXXXXXXXXXXXXXXKR-PD
LIPB_SHESW      VIQVDRGGQVTYHGPGQLVVYPLIDIKSKIGVRQLVTHIEQSIINMLAKYDIQAYAKADAPGVYVN----
LIPB_SHEPC      VIQVDRGGQVTYHGPGQLVVYPLIDIKSKIGVRQLVTHIEQSIINMLAKYDIQAYAKADAPGVYVN----
LIPB_POLSJ      VVQTNRGGQVTYHGPGQVVAYPLIDLQAGYYVKEYVYRIEEAVIRTLSHFGVTGHRVPGAPGIYLRPSPQ
LIPB_PARVE      ---VGRGGQYTYHGPGQRLVYVMLDLNRRRDVRAFVKALESWVIDALAEFNLKGEIRDGRVGVWIASLPD
LIPB_NEIMA      VVQIDRGGQITYHGPGQLVVYTMIDFKRKTSVRNIVSALENSIIATLAEYGIEAAADPKRPGVYVG----
LIPB_LARHH      LVKTDRGGQITYHGPGQLVVYLLMDLRRDYGVRDMVRRIEQAIIDTLADYGIEARGDVNAPGVYVGA---
LIPB_BORA1      VVRSDRGGQVTYHGPGQIVVYCLFDLRAGMYVRDYVALLEETAIAVLGRAGIVAQRKPGAPGVYVEQP--
LIPB_VEREI      VLQSNRGGQVTFHGPGQVVAYPLIDLRAGYYVKEYVYRIEEAVIRCLAQWGVTGHRVAGAPGIYVRPDDP
LIPB_SCHPO      VVKALRGGQTTFHGPGQILAYPIIDLKSGLSPREYVSRLEQAIIATCKSFGIEKAHTTKNTGVWVT----
LIPB_BURP8      LVKVDRGGQITYHGPGQVVGYLLLDLRRKLMVRELVTRIEQAVIDTLAAYNLAGERKAGAPGIYVSEQPN
LIPB_VIBVY      VVQSDRGGQVTYHGPGQLVAYFLINLRRKLGVRDLVTTIENLVINTLKAYNIDSAARPDAPGVYVEG---
LIPB_VIBVU      VVQSDRGGQVTYHGPGQLVAYFLINLRRKLGVRDLVTTIENLVINTLKAYNIDSAARPDAPGVYVEG---
LIPB_NEIMF      IVQIDRGGQITYHGPGQLVVYTMIDFKRKTSVRNIVSALENSIIATLAEYGIEAAADPKRPGVYVG----
LIPB_LEGPL      IVQSDRGGQVTYHGPGQLVAYVLMDIRRRLGIRTLVAKLEEILISVLEHYRIPANIRSGAPGVYVG----
LIPB_LEGPH      IVQSDRGGQVTYHGPGQLVAYVLMDIRRRLGIRTLVAKLEEILISVLEHYRIPANIRSGAPGVYVG----
LIPB_ALCBS      VVNSDRGGQVTYHGPGQTVVYLMLDIKRGLGSRGLVSAIEQGIIDFLASLGITAVNRDDAPGVYVQGA--
LIPB_LEGPA      IVQSDRGGQVTYHGPGQLVAYVLMDIRRRLGIRTLVVKLEEILISVLEHYRIPANIRSGAPGVYVG----
LIPB_EHRCJ      VYSTNRGGKYTYHGPGQRIAYVMLNLKTKCNVRLYVKTLGDWIINTLSHFSIKSYFNPDLIGVWVT---H
LIPB_ENT38      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVDTLAEYDIDAHPRADAPGVYVG----
LIPB_SHEHH      VIQVDRGGQVTYHGPGQLVVYPLLDIKRKIGVRQLVTHIEQSIINMLKRYQIEAYAKADAPGVYVE----
LIPB_RHIL3      VFATGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVAALEDVVIRTL-DMMNXXXXXXXXXXXXXXXXPE
LIPB_PSEMY      VVQVERGGQVTYHGPGQLVAYLMLDLRRDLGVRELVTAMEQSLVDLLASYGIEAAPKADAPGVYVAGD--
LIPB_OLICO      VFPSGRGGQFTYHGPGQRVVYLMLDLKHRRDVRAYVANLEELIITTLAAFNXXXXXXXXXXXXXXKR-PD
LIPB_LEGPC      IVQSDRGGQVTYHGPGQLVAYVLMDIRRRLGIRTLVAKLEEILISVLKHYKIPANIRSGAPGVYVG----
LIPB_SHEPA      VIQVDRGGQVTYHGPGQLVVYPLLDIKRKVGVRQLVTHIEQSIINMLKRYQIEAYAKADAPGVYVE----
LIPB_RHOFD      VVQTNRGGQVTYHGPGQVVAYPLLDLKAGYFIKEYVYRIEEAVIRTLVEFGVTGHRVAGAPGIYV-RLDD
LIPB_PSEF5      VVQVDRGGQVTYHGPGQLVAYLLLDVRRGFGVRDLVNRMEHCLIELLASYGVPAAAKPDAPGVYVNGA--
LIPB_PROM1      VFSIERGGEVTHHMPGQIVGYLVLNLSLKKDLAWYLRELEQVLIDVLDLLGIEGKRVDGLTGVWCE----
LIPB_NITEC      VIKTDRGGQITYHGPGQIIMYLLLDLHRQLGIRQLVRKMEGAVINLMDEYDIVANGSQDAPGVYVNGA--
LIPB_PSEU2      VVQVDRGGQVTYHGPGQLVAYLMLDVRRGFGVRDLVTRIENTLIALLADYGVKAAAKADAPGVYVDGA--
LIPB_PROMT      VFSIERGGEVTHHMPGQIVGYLVLNLSLKKDLSWYLRELEQVLIDVLDLLGMEGKRVDGLTGVWCE----
LIPB_VIBHB      VVQSDRGGQVTYHGPGQLVAYFLINLRRKLGVRDLVTHIENLVINTLKAYNIDSAARPDAPGVYVDG---
LIPB_SHEB9      VIQVDRGGQVTYHGPGQLVVYPLLDIKSKVGVRQLVTHIEQSIVDMLAKYDINAYAKADAPGVYV-----
LIPB_SHEB8      VIQVDRGGQVTYHGPGQLVVYPLLDIKSKVGVRQLVTHIEQSIVDMLAKYDINAYAKADAPGVYV-----
LIPB_SHEB5      VIQVDRGGQVTYHGPGQLVVYPLLDIKSKVGVRQLVTHIEQSIVDMLAKYDINAYAKADAPGVYV-----
LIPB_SHEB2      VIQVDRGGQVTYHGPGQLVVYPLLDIKSKVGVRQLVTHIEQSIVDMLAKYDINAYAKADAPGVYV-----
LIPB_SHEPW      VIQVDRGGQVTYHGPGQLVIYPLLDIKRKVGVRQLVTHIEQSIVNMLKRYDVEAYAKADAPGVYVE----
LIPB_RHOS5      VHVAGRGGQYTYHGPGQRVAYVMXXXXXXXXXXXFVCALEDWVIATLAEFNVKXXXXXXXXXXXXAPGPD
LIPB_PSYIN      IVQSDRGGQITFHAPGQLVVYLLINLRRKLNVRALVTVMEDSIINLLADYNVIAVAKPDAPGVYVNG---
LIPB_PSESM      VVQVDRGGQVTYHGPGQLVAYLMLDVRRGFGVRDLVTRIENTLIALLADYGVTAAAKADAPGVYVDGA--
LIPB_PSEPF      VVQVDRGGQVTYHGPGQLVAYLLLDVRRGFGVRDLVSRMERCLIELLASYGVTAVAKPDAPGVYIDGA--
LIPB_PSE14      VVQVDRGGQVTYHGPGQLVAYLMLDVRRGFGVRDLVTRIENTLIALLADYGVKAAAKADAPGVYVDGA--
LIPB_PROM5      VFKIDRGGEVTCHMPGQLVTYLVLDLHNNKDLNWYLRKIEKIIIKVLSSFNIDSSTKDGFTGVWTG----
LIPB_PHOPR      VIQSDRGGQVTFHGPGQLVAYVLIDLRRKLGVRDLVTHIENTVINTLSQFGVESNARPDAPGVYV-----
LIPB_RHILO      VFSAGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVAALEQWIIGTLAAFNXXXXXXXXXXXXXXXXPPD
LIPB_CITK8      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAERGIDAHPRADAPGVYVG----
LIPB_VIBPA      VVQSDRGGQVTYHGPGQLVAYFLINLRRKLGVRDLVTTIENLVINTLKAYNIDSAARPDAPGVYVDG---
LIPB_RHIEC      VFATGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVAALEEVVIRTLDMMNXXXXXXXXXXXXXXXXPPD
LIPB_RALEH      VVQIDRGGQITYHGPGQXXXXXXXXXXXXXXXXXXXHGIEQAVLDTLAAYNLAAERKPGAPGIYLSDGPH
LIPB_PSEE4      VVQTDRGGQVTYHGPGQLVAYLLLDVRRSIGVRELVSRIEQTLIDLLASYGVQAVAKPDAPGVYVDGA--
LIPB_POLNS      LVQVDRGGEITYHGPGQIVVYLLLDLRRGIFVKELVSRIEQAVIDTLADFGVQAERHPGAPGIYVSQQ-S
LIPB_IDILO      VIQVDRGGQVTYHGPGQLVIYFLLNIRRNYGVRQLVNHIENTVIETLSDYEIDAKARRDAPGVYVDTD--
LIPB_DICNV      VIQIDRGGQITYHGLGQAVIYPLLSLKAAIGIRRFVSLVEETTIALLQDYXXXXXXXXXXPGVYVADG--
LIPB_SERP5      VVQSDRGGQVTYHGPGQQVMYVMIDLKRKVGVRQLVTAIEDTVINTLAHFHIESRARPDAPGVYVG----
LIPB_SHISS      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_SHIDS      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_SHIBS      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_SHIB3      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_PSEPW      VVQTDRGGQVTYHGPGQLVAYLLLDVRRGFGVRELVSRIEQTLIELLASYGVSAAAKPDAPGVYVDGA--
LIPB_HAHCH      VVQVDRGGQVTYHGPGQLMVYXXXXXXXXMGARDLVTMIENTLVDTLAGYGIEAHARKDAPGVYVGDA--
LIPB_ERWT9      VMQSDRGGQVTYHGPGQQVMYVMINLKRRVGVRQLVTAIEQTVVDTLAAFSVSANARSDAPGVYVDG---
LIPB_ECOUT      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECOSE      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECOLI      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECOLC      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECOL6      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECOL5      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECOK1      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECOHS      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECOBW      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECO8A      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECO81      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECO5E      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECO57      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECO55      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECO45      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECO27      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECO24      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB2_PICTO     IIRVERGGYETYHGPGQLVVYFIINLERKMNALDLIKKIQNSVVNTLKYYNIESYMLNEKTGVWHE----
LIPB_YERPY      VIQSDRGGQVTYHGPGQQVMYVMVDLKAKIGVRQLVTAIENTVIETLAHFNIDSHARPDAPGVYVE----
LIPB_YERP3      VIQSDRGGQITYHGPGQQVMYVMVDLKAKIGVRQLVTAIENTVIETLAHFNIDSHARPDAPGVYVE----
LIPB_PERMH      VYYIDRGGSVTFHGEGQIVVYPVLSLKNRISVKRYVFTLEEIVIKTVKEIGINAYRKDRLRGVF------
LIPB_NITEU      VIKTDRGGQITYHGPGQIIXXXXXXXXXXXNIRQLVRKMEGAVIDLLSEYDVVAQGDENAPGVYVDGA--
LIPB_HAES1      VVQSDRGGQITYHGLGQQIMYVLIDIKSELNVRQLVTALEQSVVSTLADYGIKSYPKADAPGVYVN----
LIPB_ACTSZ      VVRSDRGGQITYHGPGQQIMYVLIDIKRDISVRQLVSALEQSVVKTLAGYGVNAYPKAEAPGVYVNTDGQ
LIPB_YERPS      VIQSDRGGQVTYHGPGQQVMYVMVDLKAKIGVRQLVTAIENTVIETLAHFNIDSHARPDAPGVYVE----
LIPB_YERPP      VIQSDRGGQVTYHGPGQQVMYVMVDLKAKIGVRQLVTAIENTVIETLAHFNIDSHARPDAPGVYVE----
LIPB_YERPN      VIQSDRGGQVTYHGPGQQVMYVMVDLKAKIGVRQLVTAIENTVIETLAHFNIDSHARPDAPGVYVE----
LIPB_YERPE      VIQSDRGGQVTYHGPGQQVMYVMVDLKAKIGVRQLVTAIENTVIETLAHFNIDSHARPDAPGVYVE----
LIPB_YERPB      VIQSDRGGQVTYHGPGQQVMYVMVDLKAKIGVRQLVTAIENTVIETLAHFNIDSHARPDAPGVYVE----
LIPB_YERPA      VIQSDRGGQVTYHGPGQQVMYVMVDLKAKIGVRQLVTAIENTVIETLAHFNIDSHARPDAPGVYVE----
LIPB_PSEFS      VVQVDRGGQVTYHGPGQLVAYLLLDVKLGFGVRDLVSRMEACLIELLASYGVTAAAKPDAPGVYVDGA--
LIPB_KLEP3      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAEYGIESHPRADAPGVYVG----
LIPB_SHIFL      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_SHIF8      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_SALTY      VVQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRDLVTLLEQTVVNTLAEIGIEAHPRADAPGVYVG----
LIPB_SALTI      VVQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRDLVTLLEQTVVNTLAEMGIEAHPRADAPGVYVG----
LIPB_SALPA      VVQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRDLVTLLEQTVVNTLAEIGIEAHPRADAPGVYVG----
LIPB_SALCH      VVQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRDLVTLLEQTVVNTLAEIGIEAHPRADAPGVYVG----
LIPB_ECOSM      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECOLU      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_ECO7I      VIQSDRGGQVTYHGPGQQVMYVLLNLKRKLGVRELVTLLEQTVVNTLAELGIEAHPRADAPGVYVG----
LIPB_COLP3      VVKVDRGGQVTYHGPGQLVVYVMINLRRKIGVRQLVTLIENSIVSALTXXXXXXXXXXXXPGVYV-----
LIPB_VIBF1      IVKSDRGGQVTYHGPGQLVAYVLINLRRKIGVRELVTHIENTVINTLSHFNVESAARPDAPGVYV-----
LIPB_CHRVO      VVKTDRGGQITYHGPGQLVVYLLVDFKRMVGVRELVRRIEQAIIDMLAEQGIAANGDVDAPGVYVDGA--
LIPB_PROMP      VFKIDRGGEVTCHMPGQLVTYLVLDLSLNKDLNWYLRKIEKIIIKTLRSFNINCSTKDGFTGVWIG----
LIPB_KLEP7      VIQSDRGGQVTYHGPGQQVMYVLLDLKRKLGVRELVTLLEQTVVNTLAEYSIESHPRADAPGVYVG----
LIPB_PASMU      VVQSDRGGQITYHGLGQQVMYVLVDIKRQFNVRQLVSALEQAVVNTLADYGIHAYPKADAPGVYI-----
LIPB_HAEDU      VVQTDRGGQITYHGEGQQIMYVLIDIKRDISVRELVTALEQCVVRTLEDYGIDGYPKPDAPGVYIEG---
LIPB_COXBU      LIRTDRGGQVTYHGPGQXXXXXXXXXXXXXXSTTFVRTIENTVAESLQEWGIPAQGKETAPGVYV-----
LIPB_ANAMM      VVRTTRGGKYSYHGPGQRVVYVMLHLGRKRDVRLYVRNLGLWVVGTLAEFGIDSHFDDDNTGVWVQYSRQ
LIPB_ANAMF      VVRTTRGGKYSYHGPGQRVVYVMLHLGRKRDVRLYVRNLGLWVVGTLAEFGIDSHFDDDNTGVWVQYSRQ
LIPB_VIBCH      VVQSDRGGQVTYHGPGQLVAYFLIDLRRKLGVRELVTHIENLVIHTLKHYQIESAARPDAPGVYVK----
LIPB_VIBC3      VVQSDRGGQVTYHGPGQLVAYFLIDLRRKLGVRELVTHIENLVIHTLKHYQIESAARPDAPGVYVQ----
LIPB_THICR      IIQTDRGGQVTYHGPGQIIIYVLLDLKAQLGVRDLVHRMEKAIIEFLCDLSISADARPDAPGVYVDG---
LIPB_COXBR      LIRTDRGGQVTYHGPGQXXXXXXXXXXXXXXSTTFVRTIENTVAESLQEWGIPAQGKETAPGVYV-----
LIPB_COXB2      LIRTDRGGQVTYHGPGQXXXXXXXXXXXXXXSTTFVRTIENTVAESLQEWGIPAQGKETAPGVYV-----
LIPB_ACICJ      VFRSGRGGQWTYHGPGQRVAYVMLDLSRPRDVRGFVAGLEAWLIDTLAXXXXXXXXXXXXXXIWVAN-PL
LIPB_PSEAE      VIQVDRGGQVTYHGPGQLVTYXXXXXXXXXXXXXXXXSIEQSLIGLLASYDVQAVAKPDAPGVYVDGA--
LIPB_PSEAB      VIQVDRGGQVTYHGPGQLVTYXXXXXXXXXXXXXXXXSIEQSLIGLLASYDVQAVAKPDAPGVYVDGA--
LIPB_PSEA8      VIQVDRGGQVTYHGPGQLVTYXXXXXXXXXXXXXXXXSIEQSLIGLLASYDVQAVAKPDAPGVYVDGA--
LIPB_PSEA7      VIQVDRGGQVTYHGPGQLVTYXXXXXXXXXXXXXXXXSIEQSLIGLLASYDVQAVAKPDAPGVYVDGA--
LIPB_PSEA6      VVKVDRGGQVTYHGPGQQMMYVLLNLKRHLGVRTLVSALESCIVDTLKEYKVDAYPKADAPGVYV-----
LIPB_PECCP      VIQSDRGGQVTYHGPGQQVMYVLIDLKRKLGVRQLVTAIENTVIGTLAHFHIDAHARPDAPGVYVG----
LIPB_COXBN      LIRTDRGGQVTYHGPGQXXXXXXXXXXXXXXSTTFVRTIENTVAESLQEWGIPAQGKETAPGVYV-----
LIPB_ERWCT      VIQSDRGGQVTYHGPGQQVMYVLIDLKRKLGVRQLVTAIENTVIGTLAHFQIKAHARPDAPGVYVG----
LIPB_RHIE6      VFATGRGGEYTYHGPGQRVAYVMLDLKRRRDVRAFVAALEEVVIRTLDMMNXXXXXXXXXXXXXXXXPED
LIPB_VIBSL      VIQSDRGGQVTYHGPGQLVAYFLINIRRKFGVRDLVTHIENLVINTLKAYNIDSTARPDAPGVYVDG---
LIPB_PSEPK      VVQTDRGGQVTYHGPGQLVAYLLLDVRRGFGVRELVSRIELALIDLLASYAVQASAKPDAPGVYVDGA--
LIPB_PSEP1      VVQTDRGGQVTYHGPGQLVAYLLLDVRRGFGVRELVSRIELALIDLLASYAVQASAKPDAPGVYVDGA--
LIPB_HAES2      VVQSDRGGQITYHGLGQQIMYVLIDIKSELNVRQLVTALEQSVVSTLADYGIKSYPKADAPGVYVN----
LIPB_BDEBA      VVEVTRGGRATYHGPSQLVVYPILNLAKDREINPYLKVFEDAIVDVLKTYGLTGIRSSAKSSFNRADADD
LIPB1_PICTO     VIRTDRGGDITYHGPGQLVSYFIVRINGKKEVKTFLNNIENVYINLLKNLGYSASTGD-EPGIWI----E
LIPB_HAEIG      VVQSDRGGQITYHAPGQQVMYVLIKRHKNLNVRQLVTALEQTVVKTLAEYGIESYPKPDAPGVYVDG---
LIPB_HAEIE      VVQSDRGGQITYHAPGQQVMYVLIKRHKNLNVRQLVTALEQTVVKTLAEYGIESYPKPDAPGVYVDG---
LIPB_HAEI8      VVQSDRGGQITYHAPGQQVMYVLIKRHKNLNVRQLVTALEQTVVKTLAEYGIESYPKPDAPGVYVDG---
LIPB_ACTPJ      VVQTDRGGQITYHGEGQQVMYVLIDIKRDVSVRDLVTALEQCVVKTLADYGIEGYPKPDAPGVYING---
LIPB_ACTP7      VVQTDRGGQITYHGEGQQVMYVLIDIKRDVSVRDLVTALEQCVVKTLADYGIEGYPKPDAPGVYING---
LIPB_ACTP2      VVQTDRGGQITYHGEGQQVMYVLIDIKRDVSVRDLVTALEQCVVKTLADYGIEGYPKPDAPGVYING---
LIPB_PSEPG      VVQTDRGGQVTYHGPGQQVAYLLLDVRRGFGVRELVSRIEQALIGLLASYDVQASAKPDAPGVYVDGA--
LIPB_PHOLL      VIQSDRGGQVTYHGPGQQVMYVMIDIKARIGVRQLVTAIEDTVIKTLAHFGVKAYARPDAPGVYVN----
LIPB_COXB1      LIRTDRGGQVTYHGPGQXXXXXXXXXXXXXXSTTFVRTIENTVAESLQEWGIPAQGKETAPGVYV-----
LIPB_YERE8      VIQSDRGGQVTYHGPGQQVMYIMIDLKAKLGVRQLVTAIENTVIGTLAHLGIESQARPDAPGVYVG----
LIPB_MANSM      VVQSDRGGQITYHGIGQQIMYVLIDIKRDISVRQLVSALEQSVINTLADYGIESYAKADAPGVYIDG---
LIPB_HERAR      VVQTDRGGEVTYHGPGQVVIYLLLDLDARIFARELVNKIEQAVIDTLAAYNLACERKAGAPGIYLSDGPL
LIPB_BUCAI      VVQTNRGGQITYHGPGQQILYFLIDLKRKMNIRQLINIMEQTVIETLNNFSIQAYTKKKMPGVYIN----
LIPB_ACIAD      VVQSDRGGQVTWHGPGQMVIYFMFDLNRKWNVRTLVSFAEQLMIDLIKKYNIDAYAKADAPGVYVA----
LIPB_RHOS1      VHVAGRGGQYTYHGPGQRVAYVMXXXXXXXXXXXFVTALEDWVIATLAEFNXXXXXXXXXXXXXXXX-PD
LIPB_JANMA      VVETDRGGEVTYHGPGQVVIYLLLKADARLFARELVNKIEQSVIDTLAAYNLACERKPGAPGIYMSDGPA
LIPB_KLULA      FVQAERGGQVTFHGPGQIVAYII------LDLKTFQNLPAKCLVSTIDNAAMNALKVVPKTGVWVSN---
LIPB_NITOC      VVRCDRGGQVTYHGPGQSIVYILVDLRRALGVRQLVDALELSVVDLLQSYEIETERRANAPGVYVQG---
LIPB_HAEIN      VVQSVRGGQITYHAPGQQVMYVLIKRHKNLNVRQLVTALEQTVVKTLAEYGIESYPKPDAPGVYVDG---
LIPB_RHOS4      VHVAGRGGQYTYHGPGQRVAYVMXXXXXXXXXXXFVTALEDWVIATLAEFNXXXXXXXXXXXXXXXX-PD
LIPB_PSEHT      VIKVDRGGQVTYHGPGQQMMYVLFNLRRKIGVRELVTWLEECIIESLAEYDIQAYAKADAPGVYVN----
LIPB_METFK      LIEVDRGGKITYHGPGQVVIYVLLDLKRGMSVRSLVSAMEDSMIALLAEHGVTAAARADAPGVYVEGA--
LIPB_RUTMC      IIQTDRGGQITYHGPGQVVIYCLIDLKRGVGVKKMIEIIENSIIDLLKTYAIKAHLKSDAPGVYVDNA--
LIPB_PROM9      VFKIDRGGEVTCHMPGQLVTYLILDLKNNKDLNWYLRXXXXXXXXXLGNFNIDCHLKKGFTGVWIE----
LIPB_PROM2      VFKIDRGGEVTCHMPGQLVTYLVLDLKNNKDLNWYLRXXXXXXXXXLGTFNIDCHSRDGFTGVWIG----
LIPB_BUCBP      IIFSNRGGKITYHAPGQLIIYVLINLRRKLTVRRLILLMQNIIISTLKSFSIDSYILNNFPGVYVN----
LIPB_BAUCH      VVQSDRGGKITYHGPGQQVMYVMXXXXXXXXXXXXITILEKTVITTLYKFAIT-------TAYSKKDAPG
LIPB_PROMS      VFKIDRGGEVTCHMPGQLVTYLVLDLKNNKDLNWYLRXXXXXXXXXLGAFNINCHSREGFTGVWIG----
LIPB_PROM0      VFKIDRGGEVTCHMPGQLVTYLVLDLKNNKDLNWYLRXXXXXXXXXLGAFNIDCHSRKGFTGVWIG----
LIPB_YEAST      FVQVERGGQVTFHGPGQIVIYIILDLKTSFPAKCLVSCIEQATIRTLKNLNLDAMTTKD-TGVWVENG--
LIPB_FRATW      IVATDRGGQVTYHGPGQAVIYFLLDIKRKLGAKKLVTTVEQACINMLDKYNLKAHIIDGAHGIYIN----
LIPB_FRATT      IVATDRGGQVTYHGPGQAVIYFLLDIKRKLGAKKLVTTVEQACINMLDKYNLKAHIIDGAHGIYIN----
LIPB_FRATO      IVATDRGGQVTYHGPGQAVIYFLLDIKRKLGAKKLVTTVEQACINMLDKYNLKAHIIDGAHGIYIN----
LIPB_FRATN      IVATDRGGQVTYHGPGQAVIYFLLDIKRKLGAKKLVTTVEQACINMLDKYNLKAHIIDGAHGIYIN----
LIPB_FRATM      IVATDRGGQVTYHGPGQAVIYFLLDIKRKLGAKKLVTTVEQACINMLDKYNLKAHIIDGAHGIYIN----
LIPB_FRATH      IVATDRGGQVTYHGPGQAVIYFLLDIKRKLGAKKLVTTVEQACINMLDKYNLKAHIIDGAHGIYIN----
LIPB_FRATF      IVATDRGGQVTYHGPGQAVIYFLLDIKRKLGAKKLVTTVEQACINMLDKYNLKAHIIDGAHGIYIN----
LIPB_FRAT1      IVATDRGGQVTYHGPGQAVIYFLLDIKRKLGAKKLVTTVEQACINMLDKYNLKAHIIDGAHGIYIN----
LIPB_PROMA      PIDIDRGGDVTHHLPGQXXXXXXXXXXXXTDLDWYLRQLEXXXXXXXXXXXXXXYRINGMTGVWCNG---
LIPB_SODGM      VVQSDRGGQVTFHGPGQQVMYXXXXXXXXXXXXXXXXXXEQTIVATLACFSISAHARTDAPGVYIGAD--
LIPB_PROM4      VYRIDRGGEVTHHMPGQXXXXXXXXXXXXTDLNWYLRQXXXXXXXXXXXXGIVGKRIDGITGVWIN----
LIPB_BUCAP      IVSTDRGGQITYHGPGQQILYFLIDLKRKITIRDLINIMQNLIIETLNYFSIKSHIKKNSPGVYVN----
LIPB_VESOH      IVQTDRGGQVTYHGPGQVIIYCLFDLKRGMGVKRXXXXXXXXXXDLLRTYTIKAHLKSGAPGVYIDNA--
LIPB_PSYCK      IIKTDRGGQVTWHGHGQLVMYWLFDLDSSWSVRNMVSHAEQAIEDVVNDCHISARARRDAPGVYLYAAPD
LIPB_PSYA2      IIKTDRGGQVTWHGHGQLVMYWLFDLDSGWSVRNMVSHAEQAIEDVVNDIHISARARRDAPGVYIYAKVD
LIPB_LEPBL      VHFVQRGGDFTAHEPGQLVIYPHVDLKKRLPIRFYLENLLQSVISARTTWGLNLITDSDSPGLYLESNSS
LIPB_LEPBJ      VHFVQRGGDFTAHEPGQLVIYPHVDLKKRLPIRFYLENLLQSVISARTTWGLNLITDSDSPGLYLESNSS
LIPB_WIGBR      VVKTDRGGHMTFHGPGQXXXXXXXXXXXXXXXXXXXXFLENIIISTLSYFKINSYSIKNSPGVYV-----
LIPB_LEPIN      IHWTQRGGDFTAHEPGQLVLYSHVDLKKRLSIRFYLENLLRSVISVRSTWDLQLISDSDSPGLYLESNPS
LIPB_LEPIC      IHWTQRGGDFTAHEPGQLVLYSHVDLKKRLSIRFYLENLLRSVISVRSTWDLQLISDSDSPGLYLESNPS
LIPB_PROHO      GPELERGGEVTYHCPGQLVGYPILNLRLSADLHWYLRQLEEYLIRVLDHYGLRGERI-------------
LIPB_CYACA      VNRVDRGGEVTYHDYGQVIIYNITHLQKNRNVNIYIANLEQLGKRILLLYKTKSTKKEKFPGIWIQ----


                         +         .         .         .         .         *         .:210
query           RGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGVTSLTAELDRTVGVGDILEATEH
LIPB_THEFY      RGLPERKIAAIGCRIAKGVTMHGFALNCNNDLSWFDRIVPCGIRDAGVTSLTAELDRTVGVGDILEATEH
LIPB_SALAI      RG-PARKVAAIGIRVARGVTLHGFSLNCDCDLTYYDRIVPCGIRDAGVTSLAAELGRPVTVADALPVVER
LIPB_SALTO      RG-PARKVAAIGIRVARGVTLHGFSLNCDCDLTYYDRIVPCGISDAGVTSLAAELGRPVTVADALPVVER
LIPB_STRGG      QRREDRKLAAIGIRVAKGVTMHGFALNVNPDNTWFDRIVPCGIRDAGVTSLSAELGREVTVEEVLPVAER
LIPB_STRCO      EQRPDRKIAAIGIRVAKGVTMHGFALNVNPDNKWFDKIIPCGIRDAGVASLANELGRDVTIEEVLPVAER
LIPB_ACIC1      -GAPDRKIAAIGVRISRCTTMHGFALNCNPDLSWFRRIVPCGLPDAEVTSLSVELGRNVTVAEV------
LIPB_STRAW      EQRPDRKICAMGIRVAKGVTMHGFALNVNPDTSSFDKIIPCGIRDAGVTSLAYELGREVTIGEVLPVAEK
LIPB_CORJK      NGKPARKIAAIGIRVTRGVTMHGVALNCDNTMEYYDHIVPCGLADAGVTTLTEELGRDVSVSDAYSSLAH
LIPB_MYCGI      GGRPDRKIAAIGIRVARATTLHGFAINCDCDLGAFGSIVPCGIADAGVTSLTAELGRTVGVAEVIDRVSE
LIPB_MYCVP      GVRPARKIAAIGIRVARGTTLHGFALNCDCDLNAFGSIVPCGIRDAGVTSLTAEMGRTVGVGEVID----
LIPB_LEIXX      GTAPDRKLAAIGIRVAEGVTMHGFALNCSNSLEAYDRIVACGIRDAGVSTITEALGRTVTPQDAAPMVVA
LIPB_RHOOB      NGLPERKVAAIGVRVQRGVALHGFSLNCNSVLTGFDAIIPCGIRDAGVTSLSRELGR-------------
LIPB_RHOSR      NGLPERKVAAIGVRVQRGVALHGFSLNCNSVLTGFDAIIPCGIRDAGVTSLSRELGR-------------
LIPB_MYCLE      AGQPARKIAAIGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVAVNDVRSA---
LIPB_MYCLB      AGQPARKIAAIGVRVSRATTMHGFALNCQCDLDAFHAIVPCGISDAGVTSLSAELGRTVAVNDVRSA---
LIPB_MYCUA      SGRPERKIAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISDAGVTSLSAELGRTVGVEEV------
LIPB_CLAM3      GSPRDEKVAAIGVRVAERVTMHGFALNCSNAFDAYDRIVPCGIRDAGVTSISRAIGRTVTPADVVPLLRP
LIPB_CLAMS      GTPRDEKVAAIGVRVAERVTMHGFALNCSNALDAYDRIVPCGIRDAGVTSLSRVLGRTVTPADVVPLLRP
LIPB_MYCA1      AGRPDRKVAAIGVRVSRATTLHGFALNCDCDLGAFSAIVPCGISDAGVTSLTAELRR-------------
LIPB_CORGL      DGWVDSKVAAIGIRITRGVAMHGVAINCNNTLDFYEHIIPCGIADAGLSTLSRELKRDVSVEELVE----
LIPB_CORGB      DGWVDSKVAAIGIRITRGVAMHGVAINCNNTLDFYEHIIPCGIADAGLSTLSRELKRDVSVEELVE----
LIPB_MYCPA      AGRPDRKVAAIGVRVSRATTLHGFALNCDCELGAFNAIVPCGISDAGVTSLTAELRR-------------
LIPB_MYCMM      SGRPERKIAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISDAGVTSLSAELGRTVGVEEV------
LIPB_MYCS2      DLRPARKIGAIGIRVSRATTLHGFALNCDCDLSAFSSIIPCGITDAGVTSLTAEL---------------
LIPB_MYCSS      DGLPERKIGAIGIRVSRGTTLHGFALNCDCDLSAFSAIVPCGIADAGVTSLTAEL---------------
LIPB_MYCSK      DGLPERKIGAIGIRVSRGTTLHGFALNCDCDLSAFSAIVPCGIADAGVTSLTAEL---------------
LIPB_MYCSJ      DGLPERKIGAIGIRVSRGTTLHGFALNCDCDLSAFSAIVPCGIADAGVTSLTAEL---------------
LIPB_MYCTU      -GRPARKVAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISDAAVTSLSAELGRTVTVDE-------
LIPB_MYCTA      -GRPARKVAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISDAAVTSLSAELGRTVTVDE-------
LIPB_KOCRD      RG-PDRKISAIGVQVSKRATMHGFALNCSNDLRPFGKIIPCGITDAGVTSLSAETGNRIDPADVVERMEQ
LIPB_COREF      DGYPDSKVAALGIRVTRGVTMHGLALNCNNTLEFYDHIIACGIEDAGLTTLSRELGRDVPTTELVD----
LIPB_ARTS2      SKGPDRKIAAIGIRVLDGVTMHGIAINCNNDLAPYAQIIACGITDAGVTTMSIEAGRTITPGDIAE----
LIPB_MYCBT      -GRPARKVAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISDAAVTSLSAELGRTVTVDE-------
LIPB_MYCBP      -GRPARKVAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISDAAVTSLSAELGRTVTVDE-------
LIPB_MYCBO      -GRPARKVAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISDAAVTSLSAELGRTVTVDE-------
LIPB_NOCFA      ETLAERKIAAIGIRVQRGVALHGISFNCNSALDGFQAIVPCGIQDAGVTTLTRELGREVTVAEV------
LIPB_RENSM      AKGPTRKIAAIGIRVHNGVTMHGFSLNCDNDLAPYGQIIACGITDAGATTMELETGRNISPAQVL-----
LIPB_CORDI      E--EHRKVAALGIRIAGGVTMHGLALNCDNTVEFYDYIVPCGISDAGVTTMSQEVGNDV-----------
LIPB_ARTAT      KG-PDRKIAAIGIRVLDGVTMHGVAINCSNDLAPYAQIIACGITDASVTTMSLETGRTINPADIVD----
LIPB_ARTCA      ANGPDRKIAAIGIRVLNGVTMHGVAINCSNDLAPYGQIIACGITDAGVTTMSRETGKDIRPADIAE----
LIPB_TROWT      NGVSDEKVAAIGVRVQKNVTLHGFALNCSNDLAPFEKIVPCGISDAGVTTISRILKRTITPKEILDSVFN
LIPB_TROW8      NGVSDEKVAAIGVRVQKNVTLHGFALNCSNDLAPFEKIVPCGISDAGVTTISRILKRTITPKEILDSVFN
LIPB_CORA7      APKRDRKLGALGIRVTRGVTMHGLALNCTNTLEYYEHIVACGIDDADVSTLSLELGREV-----------
LIPB_PROAC      DGMPERKVCAIGIRVSRQTAMHGFALNIDPDTAGFDNIIPCGISDADVTSMARELRRLHG----------
LIPB_RUBXD      ------KICAIGVKFSSGIASHGFALNVNTDLSWFDRITPCGIREYGVTSLERELGREIPLAGVEREIVS
LIPB_CHLSY      -----AKICAIGVKLASGVTTHGLALNVDPDLSGFDLIVPCGITDRSVTSLAFELGQAPALAEVAE----
LIPB_CHLAA      -----AKICAIGVKLASGVTTHGLALNVDPDLSGFDLIVPCGITDRSVTSLAFELGQAPALAEVAE----
LIPB_CHLAD      -----AKICAIGVKLASGVTTHGLALNVDPDLSGFELIVPCGISDRGVTSLAVELGKAPPMAEVADRLIA
LIPB_ROSS1      -----AKICAIGIKVAGGVTTHGLALNVNIDLRGFDLIVPCGVHGRGVTSMSAELGEVVAMSSVAERLIG
LIPB_ACIBL      ----QAKIAAIGVHISRAVTSHGFALNVTTDLDYFKLIVPCGISDKPVTSMQHELGKSLTLEEVM-----
LIPB_PELPD      QG----KLAAIGVGVRHWVTMHGFAMNVNNDLSSFERINPCGIATCPIASL-------------------
LIPB_CALS8      -----EKIVAIGIAVKKWITMHGFAFNVNTNLEHFSWIIPCGLKDRGVTSLEKLLGHKVEFDDVVYKVAK
LIPB_BACFR      RA---RKICAIGVRSSHYVTMHGLALNVNTDLRYFSYIHPCGFIDKGVTSLQQELGRSIDMAEV------
LIPB_GLOVI      -----RKIAALGIKVSRWVTMHGFALNVDPDLDAFARIVPCGL---------------------------
LIPB_BACFN      RA---RKICAIGVRSSHYVTMHGLALNVNTDLRYFSYIHPCGFIDKGVTSLQQELGHSIDMAEV------
LIPB_BACTN      RA---RKICAIGVRSSHYVTMHGLALNVNTDLRYFSYIHPCGFIDKGVTSLRQELKHEVPMDEVKQRLEC
LIPB_THET8      ----EDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVA
LIPB_THET2      ----EDKLCAIGVAVKEGVSFHGFALNVNTDLNDFTVIVPCGLKGKGVTSLEKLLGRKVPMEEAKARVVA
LIPB_GEOMG      GG----KLASIGVGVRRWVTMHGFALNVTNELAPFRSINPCGIVACPITSLSAILGRPVPLGDV------
LIPB_NOVAD      R---EAKIGAIGVRIRRWVTMHGFSVNLSPDLAHFGGIVPCGIEEFGVTSLAA-LGREVTPDQWDEALLS
LIPB_FLAJ1      -GTPARKICAMGVRASRWVTMHGFALNVNVDLGYFDNIIPCGIRGKGVTSLNVEL---------------
LIPB_PORGI      IPGRTRKICAIGVKSSRHITMHGFALNVNTDLDYFKLINPCGFSDRGVTSISRELGR-------------
LIPB_GEOSL      ------KLASIGVGVRRWVTMHGFALNICNDLAPFSRIHPCGIVGCPVTTLSREAGR-------------
LIPB_GRAFK      VGTPARKICAMGVRASRWVTMHGFALNVNADLGYFDNIIPCGIKGKAVTSLNVELQKEINLEEVQEKLLK
LIPB_ANATD      ----NDKIVAIGIAVKKWVTMHGFAFNVNTNLEHFSWIVPCGLKDRGVTSLERLIGSTIRFEDVVDKVQT
LIPB_CYTH3      NPLKARKICAMGVKASRWVTMHGFALNVQPDLTYFKNIVPCGIDDKAVTSIEQELNTTVSMQAVKDYLLK
LIPB_DANRE      ----DNKICAIGIHCGRYITSHGLALNCNTDMSWFDNIVPCGIVGKGVTSLSQELERDV-----------
LIPB_ACIC5      GSVEEKKIAAIGVHISRGITSHGFALNVTTDLRDFDLIVPCGISDRKVTSLELEV---------------
LIPB_PELCD      ----QGKLASIGAGARRWVTMHGFALNVCLDLSGFSRIHPCGIVGCTMTSLQQITGQPVSMAQVKARVVY
LIPB_MAGSA      R---EDKIAAIGVRVRHWVTFHGIALNVDPDLSHFEGIVPCGIREHGVTSL-------------------
LIPB_NITHX      KGPGEDKIAAIGVRLRRWVSFHGISLNVDPDLSHFDAIVPCGITDAGVTSL-ADLGLRVRLSDVDAALRR
LIPB_SYNP6      -----KKLAAIGIQVSRWISLHGFALNVCPDLAGFEAIVPCGISDRAVGSL-------------------
LIPB_SYNE7      -----KKLAAIGIQVSRWISLHGFALNVCPDLAGFEAIVPCGISDRAVGSL-------------------
LIPB_NOSP7      -----RKVAAIGIKVSRWITMHGFALNVCPDMKGFERIVPCGISDKPVGSL-------------------
LIPB_GEOUR      QG----KLASIGVGVRRWVTMHGFALNVTTDLTPFTRINPCGMAGCPVTSLEAEVGGNV-----------
LIPB_THETN      ----DEKICAIGIAVKRWITWHGIALNVNTDLSYFGLINACGITEFGVTSM-------------------
LIPB_PARD8      RA---RKICAIGVKSSRFVTMHGFALNINTDLSYFSLINPCGFTDKGVTSLAMEL----GVPQDFELAKS
LIPB_ANAVT      -----RKVAAIGIKVSRWITMHGFALNVCPDMTGFGRIVPCGITDKPVGSL-------------------
LIPB_TRIEI      -----RKVGAIGIKVSRWITMHGFALNVSPNLEGFQRIVPCGISDKSVGSL-AQFIPSITTDEVLPLVAN
LIP2P_ARATH     ----NQKVAAIGIRVSKWITYHGLALNVTTDLTPFNWIVPCGIRDRKVGNIKGLLE--------------
LIPB_XENTR      RG---NKICAIGVHCARHITSHGLALNCNTDLGWFGHIVPCGIVGKGVTSLTQELGRQVTIDDII-----
LIPB_JANSC      GTPREDKIAAIGVRLRKWVSFHGLSINVEPDLSHFDGIVPCGIEGHGVTSL-VDLGLPVTMADLDVALKR
LIPB_DICT6      ----DRKITAIGIAIKKRVSYHGFALNVNNDLAPFSYIIPCGLKDKKVTSILKEANFSPPMEDV------
LIPB_SOLUE      ----ERKIAAIGVHLSRWVTSHGFALNVSTDLSYFQYIVPCGLTKP-VTSMAA-LGVRASLDEVGERFTR
LIPB_SYNJA      -----HKVAAIGIKVSRWVTYHGFALNVCPDLAAFQAIVPCGIPDRPVGSL-------------------
LIPB_ARATH      ----DRKIGAIGVRISSGITSHGLALNIDPDMKYFEHIVPCGIADKEVTSLRRETDTLLPSEEVIH--EQ
LIPB_SYNJB      -----RKVAAIGIKVSRWVTYHGFALNVCPDLAAFEAIVPCGIPDRPVGSL-------------------
LIPB_ANASP      -----RKVAAIGIKVSRWITMHGFALNVCPDMTGFSRIVPCGITDKPVGSL-------------------
LIPB_THEEB      ------KVAAIGIKVTRWISFHGIALNVVNDLKGFGRIVPCGIGDRPVGNL-------------------
LIPB_SPHAL      R---EAKIGAIGVRVKRWVTLHGFSLNVAPDLTHFTGIVPCGIAEYPVTSLAA-LGKATGFSEVDAALAR
LIPB_NEOSM      ---PPKKIAAIGVRVSKWVSYHGIAVNLYPDLSHYDAIIPCGIKNFGVTS--------------------
LIPB_DROME      ----DNKICAIGIHGSRYVTTHGIGLNCCTDLQWFEHIVPCGIEGKGVTSLSKELDRHFPVEEASGALLN
LIPB_ALKMQ      -----NKIAAIGLAVKRGVSMHGFALNVSTNLAHFKFLVPCGIADRGVTSIEEILGYPV---DFHVANQH
LIPB_RICBR      --IPS-KIAAIGVRVRKWVTYHGIAINISTDLSKFNGIIPCGLENSLVTSL-------------------
LIPB_RICB8      --IPS-KIAAIGVRVRKWVTYHGIAINISTDLSKFNGIIPCGLENSLVTSL-------------------
LIPB_NITWN      KGPGEDKIAAIGVRLRRWVSFHGVSLNVDPDLSHFADIVPCGVSDPGVTSL-ADLGLRVRLTDIDQALKR
LIPB_RICPU      EFA---KIAAIGVRVRKWVTYHGVAINISTDLSKFSGIIPCGLEDSLVTSL-------------------
LIPB_MESSB      GTIMEDKIAAIGIRLRRWVSFHGIAVNVEPELAHFSGIVPCGISGFGVTSL-VDLGLPVTMADFDVALKE
LIPB_BURPP      VGLAGAKIAALGLKIRNGCSYHGVSLNVNMDLRPFLAINPCGY--AGLETVMATLGVAAGWDDVARTFAE
LIPBL_ARATH     ----NKKMAAIGIRVSKWMTYHGLALNVTTDLTPFNSIVPCGIRNRGVGSV-------------------
LIPB_PARL1      KGLTEDKIAAIGVRIRKWVTFHGVSLNVEPDLDHFSGIVPCGISQFGVTSL-ADLGHTATMADVDLALKK
LIPB_SYNY3      -----HKVAAIAIKVSGWVTCHGFALNICPDLEGFSHIVPCGIGDRPVGSL-------------------
LIPB_RICCN      EFA---KIAAIGVRVRKWVTYHGVAINISTDLSKFSGIIPCGLENSLVTSL-------------------
LIPB_RHORT      R---EDKIGAIGVRVRHWITFHGFALNVEPDLSHFSGIVPCGISDHGVTSLW-DLGQTATLQEVDSALMR
LIPB_MAGSM      ------KIASIGVRVTQGVTLHGLSLNRDPDLSHFQGIIPCGQVGRPVTSLAA-----------------
LIPB_SYNPW      ---DQCKVAAIGVGCRRWITQHGVALNVNCALEGFESVVPCGLAGRAVGCLS------------------
LIPB_RICM5      EFA---KIAAIGVRVRKWVTYHGVAINISTDLSKFSGIIPCGLENSLITSL-------------------
LIPB_RICAE      EFA---KIAAIGVRVRKWVTYHGVAINISTDLSKFSGIIPCGLENSLVTSL-------------------
LIPB_RICRS      EFA---KIAAIGVRVRKWVTYHGVAINISTDLSKFSGIIPCGLENSLVTSL-------------------
LIPB_RICRO      EFA---KIAAIGVRVRKWVTYHGVAINISTDLSKFSGIIPCGLENSLVTSL-------------------
LIPB_GLUDA      RTGAENKIAALGVRVSRWTCWHGVALNVAPNLDDFGGIVPCGIREHGVTSLHA-LGHKVSLGDVDEA---
LIPB_RHOPA      KGVGEDKIAAIGVRLKRWVSLHGIAINVEPDLSHFKAIVPCGISDPGVTSL-------------------
LIPB_FLAPJ      -GTPARKICALGVRASRWVTMHGFALNANADLGYFDNIIPCGIKGKAVTS--------------------
LIPB_RICPR      KG-EFAKIAAIGVRVRKWVTYHGIAINISTDLCKFNGIIPCGLESSLVTSL-------------------
LIPB_SILPO      PGQPEDKIAAIGIRLRKWVSFHGISINVEPDLSHFSGIVPCGITEYGVTSL-VDLGLPVTMGDVDVALRQ
LIPB_SALRD      DRGPERKICAMGVRCSRWVTMHGFALNVTTDLDYFDHIVPCGIDDRGVTSLAAETDAPGTVDDVCGPVTE
LIPB_RICFE      RKGEFAKIAAIGVRVRKWVTYHGVAINISTDLSKFSGIIPCGLENSLVTSL-------------------
LIPB_RICCK      EFA---KIAAIGIRVRKWVTYHGVAINISTDLSKFGGIIPCGLENSLVTSL-------------------
LIPB_RHOP5      KGPGEDKIAAIGVRLKRWVSFHGIAINVEPDLTHFSAIVPCGVSDPGVTSL-VDLGLPVTMQDVDVALRA
LIPB_DESPS      ----RSKIGSIGIAIRHGVSFHGFAFNLNTDLEPFSWINPCGLTGVTATSLARE----------------
LIPB_SYNFM      ------KIASVGIAVSRWVSYHGIALNCTTNLEYFGLIDACGLKGVEMTSISRLLGKDVSGSEVHRSIAF
LIPB_BRUME      GSMCEDKIAAIGIRLRRWVSFHGIAINVEPDLSHYGGIVPCGISEHGVTSL-VDLGLPVTMGDVDVALGK
LIPB_BRUMB      GSMCEDKIAAIGIRLRRWVSFHGIAINVEPDLSHYGGIVPCGISEHGVTSL-VDLGLPVTMGDVDVALGK
LIPB_BRUAB      GSMCEDKIAAIGIRLRRWVSFHGIAINVEPDLSHYGGIVPCGISEHGVTSL-VDLGLPVTMGDVDVALGK
LIPB_BRUA2      GSMCEDKIAAIGIRLRRWVSFHGIAINVEPDLSHYGGIVPCGISEHGVTSL-VDLGLPVTMGDVDVALGK
LIPB_SINMW      GTVAEDKIAAIGIRLRRWVSFHGLSLNVDPDLEHFDGIVPCGIRGHGVTSL-VDLGLPVMMADV------
LIPB_RICAH      EFA---KIAAIGVRVRKWVTYHGVSINISTDLSKFRGIIPCGLENSLVTSL-------------------
LIPB_PYRCJ      -----KKVASIGIAVEGGVAYHGVAVNVSTDLSYFYHINPCGLHPSAITSL-------------------
LIPB_ERYLH      IDGAEAKIGAIGVRVRRWVTMHGFSVNLDPDLSHFAGIVPCGIDEFGVTSL-------------------
LIPB_BRUSU      GSMCEDKIAAIGIRLRRWVSFHGIAINVEPDLSHYGGIVPCGISEHGVTSL-VDLGLPVTMGDVDVALGK
LIPB_HYPNA      GGPPEDKIAAIGVRLKRWVSFHGISLNVEPELDHFTGITPCGIADPGVTSL-ADLGRIISM---------
LIPB_SYNSC      --LDNRKVAAIGVGCRRWITQHGLALNVDCSMQGFEQVTPCGL---------------------------
LIPB_RICTY      EFA---KIAAIGVRVRKWITYHGVAINISTDLCKFNGIIPCGLESSLVTSL-------------------
LIPB_DINSH      PRLQEDKIAAIGVRLRKWVSFHGLSINVEPDLDHFSGIVPCGITEHGVTSL-VDLGLPVTMADV------
LIPB_SYNPX      --LDNRKVAAIGVGCRRWITQHGLALNIDCELAGFDQVTPCGLSGRAVGRL-------------------
LIPB_RHOPT      KGVGEDKIAAIGVRLKRWVSLHGIAINVEPDLSHFKAIVPCGISDPGVTSL-------------------
LIPB_DESRM      ----NEKITAIGCAVKRWVTMHGFAFNVNTNLSHFNLINPCGITDRGVTSL-------------------
LIPB_PYRAE      ----DRKIASIGIAVENNVAYHGVAINVTIDPREFARINPCGLPASTMISM-KELGVVAEVRDVGIETAK
LIPB_ORITB      SEFGRKKIASIGVRIHKWITYHGVAINVCPDLKKFKGIIPCGDRDTIVTSINELLDQKI-----------
LIPB_HALHL      ------KVAALGIRVRRGCSYHGLSLNVCNDPAPFERIHPCGVHDLGITTPLDRLEVELGI---------
LIPB_BURPS      RG---AKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCG----------------------------
LIPB_BURP6      RG---AKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCG----------------------------
LIPB_BURP1      RG---AKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCG----------------------------
LIPB_BURP0      RG---AKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCG----------------------------
LIPB_BURMS      RG---AKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCG----------------------------
LIPB_BURMA      RG---AKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCG----------------------------
LIPB_BURM9      RG---AKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCG----------------------------
LIPB_BURM7      RG---AKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCG----------------------------
LIPB_AZOSE      ------KIGALGLRVRNGRSYHGLALNVDVDLAPFSSINPCGYEGLRTVRM-----KDFGIADDVASVGE
LIPB_AZOSB      ------KIAALGLRVRNGCSYHGLALNVDADLAPFGWINPCGYEGLQTIRL-----KDFGVGDDVAA---
LIPB_ORITI      SEFGRKKIASIGVRIHKWITYHGVAINVCPDLKKFKGIIPCGDRDTIVTSISELLDQKI-----------
LIPB_VARPS      RGL--GKIAALGIKVSRHATYHGVALNVAMDLEPFSRINPCGYAGLQTVDLS-----TIGVQTTWEEAAR
LIPB_DESDA      ----ERKIASLGIAVSRYVTMHGMALNVAEDLSLFNIISPCGLEGVAATSIARE----------------
LIPB_BARBK      RGIPEDKIAAIGIRVRKWISFHGISINVDTDLTHYSGIVPCGITNHGVTSL-LDLGLPITIHDVDNALKK
LIPB_FRASC      ----NRKIASIGLRCTRKVTSHGFALNVDCDMRPWTWATPCGMPEVEMTSVQRELDAGHAVPSMAEVRE-
LIPB_XYLFA      ------KIAALGIRVRHGCSFHGVAFNVAMDLEPFHRIHPCGYRGLQVTSV-------------------
LIPB_BORPD      GEL--AKIAALGIKIRNGYAYHGVALNVDMDLSPFLGINPCG----------------------------
LIPB_PARDP      GSMREDKIAAIGVKLRRWVSFHGIAINVEPDLNHYAGIVPCGISGHGVTSL-VDMGLPVGMDDL------
LIPB_BARQU      SGFPEDKIAAIGIRVRKWVSFHGVSINVNPNLAHYSGIVPCGITEHGVTSF-LDLGFSVTMHDIDIALKQ
LIPB_SPHWW      ----EAKIGAIGVRVRRWVSFHGFSLNVDPDLSHFSGIVPCGLGEFAVTSM-ARLGIPAEMAAVDAALRR
LIPB_MOUSE      ----ERKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSEALQRLVTVDEVM-----
LIPB_DICTD      ----DRXXXXXXXXXXXXVSYHGFALNVSNDLTPFSYIIPCGLKDKKVTSILKEADFSPSMEDVKKKVCL
LIPB_DESDG      ----NRKICSIGIAMRRWTSYHGLALNVCRDVSLFDMITLCGLTDARATSLQAE----------------
LIPB_CLOK5      ----DRKIAAIGVGIRKWITRHGFAINISVNKEHFKLIVPCGIKEFGVCSL-EDFTANVDYNDVVQKIEN
LIPB_BURTA      HG---AKIAALGLKIRNGCSYHGLSVNVKMDLRPFLAINPCGLETVDMASLGATAD--------------
LIPB_MYXXA      EGAPDRKIAAIGVHLSRWLTTHGFALNVNTNLDHFQLIVPCGIREAGVTSMQRELGRALPMAEVEEAIAN
LIPB_BRASO      KGEGEDKIAAIGVRLKRWVTFHGIAINVEPDLSHFQAIVPCGVTDPGVTSL-VDLGLPVTMADVDVALRQ
LIPB_XYLFT      ------KIAALGIRVRRGCSFHGVAFNVAMDLEPFHRIHPCGYRGLQVTSV-------------------
LIPB_BURVG      GG---AKIAALGLKIRNGCSYHGLSLNVKMDLRPFLAINPCGY--AGLETVMASLEVAADWNDVARTLVG
LIPB_RHIME      GSMAEDKIAAIGIRLRKWVSFHGLSLNVDPDLEHFGGIVPCGIRGYGVTSL-VDLGLPVMMADV------
LIPB_BART1      KKSSEDKIAAIGIRVRKWISFHGVSINVNPNLAHYSGIVPCGITNHGVTSF-LNLGCPVTMHDIDIALKH
LIPB_DESVM      ----NRKICSIGMAVRRWTSYHGFALNVGRDLSLFEMITLCGLPDAQATSLYREL---------------
LIPB_MARMM      R---EDKIAAIGVRLRRWVSFHGIAFNVDPDLSHFGGITPCGISDPGVTSL-ADLGHTVDMADF--DTAL
LIPB_BURS3      EG---AKIAALGLKIRNGCSYHGLSLNVKMDLRPFLAINPCGY--AGLETVMASLEVAADWNDVAHTLVR
LIPB_EHRRW      HNGSEKKIAAFGIRIRKWITYHGVSINVFTDLSHYSGIIPCGIKEYGITSL-----KTLGVNILYE----
LIPB_EHRRG      HNGSEKKIAAFGIRIRKWITYHGVSINVFTDLSHYSGIIPCGIKEYGITSL-----KTLGVNILYE----
LIPB_CELJU      ----NHKIASLGLRVRRGCSFHGLALNVDMDLSPFLRINPCGYQGLAMTQMRDLMPETPSLVQVQEQLVC
LIPB_CAUCR      GWSREDKIAAIGVKLRRWVSFHGISLNVEPDLSHFSGIVPCGQTEHGVTSL-VDLGLPVTLDDADAALRA
LIPB_BURCA      EG---AKIAALGLKIRNGCSYHGLSLNVKMDLRPFLAINPCGY--AGLETVMASLEVAADWNDVAHTLVG
LIPB_MARAV      ------KIASLGLRVRRGCSFHGLALNVNMDMEPFSRINPCGYAGMSMCQV-SDFEAGASVYDLERRLVS
LIPB_WOLPP      KGV-EEKIAAFGIRLRKWVTYHGIALNVSPNLSHYEGIIPCGLKDYGVTSM-------------------
LIPB_BRASB      KGEGEDKIAAIGVRLKRWVSFHGIAINVEPDLTHFQAIVPCGVTDPGVTSL-VDLGLPVTLTDVDLALRQ
LIPB_THEPX      ----DEKICAIGIAVRRWITWHGIAFNVNTDLSYFGLINACGITEFGVTSM-----QKLGINEDIEKVKE
LIPB_THEP3      ----DEKICAIGIAVRRWITWHGIAFNVNTDLSYFGLINACGITEFGVTSM-----QKLGINEDIEKVKE
LIPB_DESVV      ---DNRKICSIGVAVRRWTTYHGLALNVGRDLSLFNLITLCGLPDAEATSLHRELD--------------
LIPB_DESVH      ---DNRKICSIGVAVRRWTTYHGLALNVGRDLSLFNLITLCGLPDAEATSLHRELD--------------
LIPB_DEIRA      NGKTDQKICSIGVAIKQNVALHGIGLNVCTNLDHFDLIVPCGLTDTQMTSVQREYDLR-GLGSV------
LIPB_XANOR      ------KIAALGIRVRRGCTFHGLSLNVDMDLEPFHRINPCGYQGLQVTSV-------------------
LIPB_XANOM      ------KIAALGIRVRRGCTFHGLSLNVDMDLEPFHRINPCGYQGLQVTSV-------------------
LIPB_RALEJ      RG---AKIAALGLKIRNGCSYHGVSLNVQMDLAPFLRINPCG----------------------------
LIPB_BURCH      EG---AKIAALGLKIRNGCSYHGLSLNVKMDLRPFLAINPCGY--AGLETVMASLEVAADWNDVAHTLVG
LIPB_BARHE      SLYSEDKIAAIGIRVRKWVSFHGVSINVDPNLAHYSGIVPCGITNHGVTS--------------------
LIPB_AERHH      AALQEAKLASLGLRIRKGCSFHGLALNVNMDMTPFLRINPCGYAGMAMTQ-TSALGGPQSVAEAQAMLVA
LIPB_RHOP2      KGADEDKIAAIGVRLKRWVSLHGIAINVEPDLSHFTAIVPCGISDPGVTSL-VDLGLPVTMADADIALRA
LIPB_POLSQ      IS-PEAKVAALGLKVSKSCSYHGLALNVATDLEAFGRIHPCGYEGLKTVDM-----QTLGIKDNIDTISQ
LIPB_POLNA      RGL--GKIAALGIKVSRHCTYHGVALNVAMDLEPFSRINPCGYAGLKTTDLS-----TIGV----SASWQ
LIPB_GEOSM      ------KLASIGVGVRRWVSMHGFALNVSPDTAPFSRINPCGMPDCRITSLSLELGEELFVDDLKE----
LIPB_CHRSD      ----ETKIASLGLRIRRGASFHGVALNVDGDLAPFQCINPCGHAGMAMTRLVDLVDDCPG----------
LIPB_BURCM      EG---AKIAALGLKIRNGCSYHGLSLNVKMDLRPFLAINPCGY--AGLETVMASLEVAADWNDVAHTLVG
LIPB_BURA4      EG---AKIAALGLKIRNGCSYHGLSLNVKMDLRPFLAINPCGY--AGLETVMASLEVAADWNDVAHTLVG
LIPB_PYRAR      -----KKIASVGIAVERGVAYHGVAVYVNPHMEYFYHINPCGLPPSVITSM-----RQLGVADVFE----
LIPB_DECAR      ----EAKIAALGLRIRNGCSYHGVSLNVDMDLSPFAAINPCG----------------------------
LIPB_XANCB      ------KIAALGIRVRRGCTFHGLSFNVAMDLEPFHRINPCGYQGLQVTSV-------------------
LIPB_NITMU      ------KIAALGLKIKNGCCYHGLALNVSMDLAPFMAINPCGYTGLRVTQ-TSDL----GITDELETLQG
LIPB_BURCC      EG---AKIAALGLKIRNGCSYHGLSLNVKMDLRPFLAINPCG----------------------------
LIPB_AERS4      LGM-EAKLASLGLRIRKGCSFHGLALNINMDMTPFLRINPCGYAGMAMTQ-TSALGGPQSVAEAQAILVA
LIPB_XANCP      ------KIAALGIRVRRGCTFHGLSFNVAMDLEPFHRINPCGYQDLQVTSV-------------------
LIPB_XANC8      ------KIAALGIRVRRGCTFHGLSFNVAMDLEPFHRINPCGYQDLQVTSV-------------------
LIPB_AZOVD      ----EMKIASLGLRIRNGRSFHGLALNVDMDLAPFQRINPCGYAGMLMTQLKDQARGPVEFAEVRSRLRA
LIPB_SHEDO      ---DERKIASLGLRIRKGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_GLUOX      TGL-EAKIGALGIRVSRWVSWHGVSINVSPDLTDFDGIVPCGIREFGVTSL-------------------
LIPB_BURM1      EG---AKIAALGLKIRNGCSYHGLSLNVKMDLRPFLAINPCGY--AGLETVMASLEVAADWNDVARTLVR
LIPB_XANC5      ------KIAALGIRVRRGCTFHGLSFNVAMDLEPFHRINPCGYQGLQVTSV-------------------
LIPB_RALPJ      AG---AKIAALGLKIRNGCSYHGVSLNLAMDLSPFTQINPCG----------------------------
LIPB_HUMAN      ---DDRKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVM-----
LIPB_SHEWM      ---DERKVASLGLRIRKGCSFHGLALNVDMDMSPFQRINPCG----------------------------
LIPB_RHOPS      KGVGEDKIAAIGVRLKRWVSLHGIAINVEPDLGHFAAIVPCGISDPGVTSL-VDLGLPVTMTDVDLALRA
LIPB_RALSO      QG---AKIAALGLKIRNGCSYHGVSLNLAMDLSPFTQINPCG----------------------------
LIPB_MARMS      ---DEQKIASLGLRVRRGCSFHGLALNVDMDLTPFNRINPCGYQGLQMVDM-KRLNKGVILSNVKAQLAN
LIPB_ANAPZ      NDMHSEKIAAFGIRLRRWVTYHGVAINISTDLTHYSGIVPCGILGSGVTSLRA-----------------
LIPB_ACIAC      RSLPQRKIAALGIKVSRHCTYHGVALNVDMDLEPFSRINPCGYAGLPTVDLS-----TIGV----HTTWD
LIPB_XANAC      ------KIAALGIRVRRGCTFHGLSFNVAMDLQPFHRINPCGYQGLQVTSV-------------------
LIPB_SHESH      VYVDERKVASLGLRIRKGCSFHGLALNVDMDMSPFQRINPCG----------------------------
LIPB_METCA      ------KIASLGLRVRRGCCYHGVALNVCPELEAFDRIHPCGHAGLAVTRLT------------------
LIPB_ZYMMO      G---EAKIGAIGIRVRRWISFHGFSLNICPDLEHFSGIIPCGISEFGVTSLHA-LGKKVSMSDVDQA---
LIPB_SYNS9      ------KVAAIGVGCRRWITQHGLALNVDCELQGFAEITPCGL---------------------------
LIPB_WOLTR      NGV-EEKIAAFGIRLRKWITYHGIALNFSPDLSHYKGIIPCGLKGYGVTSI-------------------
LIPB_PROMM      -----RKVAAIGVGCRRWITQHGLALNVDCDLESFSAVVPCGL---------------------------
LIPB_PELUB      HKGKINKVAAIGVRVSKWIAYHGFAININNDLSKYKNIIPCGISDKGVINL-------------------
LIPB_DELAS      LRVPGSKIAALGIKVSRHCTYHGVALNAAMDLEPYERINPCGYAGLQTVDLS-----TIGV----QTTWD
LIPB_AGRT5      GGMAEDKIAALGIRLRKWVSFHGLSINVDPDLSHFSGIVPCGISAYGVTSL-VDLGLPVMIGDV------
LIPB_RHOPB      KGAGEDKIAAIGVRLRRWVSFHGIAINVEPDLTHFSAIVPCGVTDPGVTSL-VDLGLPVTLQDVDVALRQ
LIPB_PSEU5      ------KIASLGLRIRNGRSFHGLALNVDMDLEPFRRINPCGYAGLPMTQL-RDLIGPIDISEVADRLRD
LIPB_METPP      FGXXIGKIAALGIKVSRHCSYHGLALNVAMDLSPYERINPCGLRTVDLSTIGVPVDPERAAADLGDRLES
LIPB_SHEAM      ---DERKVASLGLRIRRGCSFHGLALNVDMDISPFQRINPCG----------------------------
LIPB_GEOBB      ------KLASIGVGVRRWVSMHGFALNVSPDTAPFSRINPCGMPGCSITSLSLELGEELFVDELKE----
LIPB_EHRCR      HGGTEKKIAAFGIRIRKWVTYHGVSINIDTNLSHYSGIVPCGIKDYGITSL-------------------
LIPB_BORPE      PGGELAKIAALGVKVRNGYAYHGLALNIDMDLSPFLGINPCGYEGLRTVDLAACGVRTERAGELLAA---
LIPB_BORBR      PGGELAKIAALGVKVRNGYAYHGLALNIDMDLSPFLGINPCGYEGLRTVDLAACGVRTERAGELLAA---
LIPB_SHESR      ---DERKVASLGLRIRKGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_SHESM      ---DERKVASLGLRIRKGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_DESAD      ------KLCSIGIGVKKWITYHGLSFNVSSDMKLFDAITLCGLHGAHPTSLSREAGKEISTEEV------
LIPB_BORPA      PGGELAKIAALGVKVRNGYAYHGLALNIDMDLSPFLGINPCGYEGLRTVDLAA-----CGVRTSVERAGE
LIPB_ALHEH      -----RKVASVGLRVRRGCSYHGLAVNVDVDLEPFLRINPCGYPGLEVTRL-------------------
LIPB_WOLPM      HNGVEKKIAAFGIRLRKWVTYHGIALNVFPDLSHYKGIIPCGLQGYGVTSM-------------------
LIPB_SHELP      ----ERKIASLGLRIRKGCSFHGLALNVDMDMSPFQRINPCG----------------------------
LIPB_SACD2      ------KIASLGLRVRKGCSFHGVAINVDVDLAPFNQINPCGYAGLNMTRLVDLVDTTVVFSDVAKRYTR
LIPB_THIDA      ------KIAALGLRVKHGCTYHGLAFNVDMDLEPFAAINPCGYPGMAVTQC-----RDLGLNWSVEQTER
LIPB_SHESA      ---DQRKVASLGLRIRKGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_SHEON      ---DERKVASLGLRIRKGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_SHEFN      ----EQKIASLGLRIRKGCSFHGLALNVDMDLAPFQRINPCG----------------------------
LIPB_NEIMB      ----ERKIASLGLRIKNGSVYHGLALNVNMDLSPFTHINPCGYAGMEMTQI-------------------
LIPB_NEIM0      ----ERKIASLGLRIKNGSVYHGLALNVNMDLSPFTHINPCGYAGMEMTQI-------------------
LIPB_NEIG2      ----ERKIASLGLRIKNGSVYHGLALNVNMDLSPFTQINPCGYAGMEMTQI-------------------
LIPB_NEIG1      ----ERKIASLGLRIKNGSVYHGLALNVNMDLSPFTQINPCGYAGMEMTQI-------------------
LIPB_BURXL      XXXXXXXXXXLGLKIRNGCSYHGVSLNVNMDLRPFLAINPCGY--AGLETVMATLGVTAGWNDVARTFAA
LIPB_BRAJA      KGDGEDKIAAIGVRLKRWVSFHGIAINVEPELSHFAGIVPCGVADPGVTSL-VDLGQLVTMADV------
LIPB_SHESW      ----ERKIASLGLRIRRGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_SHEPC      ----ERKIASLGLRIRRGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_POLSJ      PSPKGRKIAALGIKVSRHCTYHGVALNVAMDLEPFSRINPCGYAGLKTVDL-----RTIGV----SVTWQ
LIPB_PARVE      GSMREDKIAAIGVKLRRWVSFHGISINVEPDLGHYAGIVPCGIQGHGVTSL-VDMGLPVGMGDL------
LIPB_NEIMA      ----ERKIASLGLRIKNGSVYHGLALNVNMDLSPFTHINPCGYAGMEMTQI-------------------
LIPB_LARHH      -----RKIASLGLRIKNHATYHGLSLNVSMDLAPFGWINPCGYAGLEVTRMT------------------
LIPB_BORA1      -GQTLAKIAALGIKIRKGCAYHGLSLNVAMDLTPFHGINPCGYEGLQTTDM-ASCGLSCSVHEVGQALAD
LIPB_VEREI      GGLPLRKIAALGVKVSRHCSYHGVALNVAMDLEPFARINPCGYAGLRTVDLS-----TIGV---------
LIPB_SCHPO      ---ENDKIAAIGIHLRRNITSHGLALNVSTDLKYFNYIVGCGLYGKNTTS--------------------
LIPB_BURP8      AGLAGAKIAALGLKIRNGCSYHGVSLNVKMDLQPFLAINPCGY--AGLETVDM---ATLGVA----AGWD
LIPB_VIBVY      -----RKICSLGLRIRKGCSFHGLALNVNMDLSPFLRINPCG----------------------------
LIPB_VIBVU      -----RKICSLGLRIRKGCSFHGLALNVNMDLSPFLRINPCG----------------------------
LIPB_NEIMF      ----ERKIASLGLRIKGGSVYHGLALNVNMDLSPFTHINPCGYAGMEMTQI-------------------
LIPB_LEGPL      ----EKKIASIGLRVKNGCTYHGIALNVNMDLSPFLGINPCGFAKMEMTQMS------------------
LIPB_LEGPH      ----EKKIASIGLRVKNGCTYHGIALNVNMDLSPFLGINPCGFAKMEMTQMS------------------
LIPB_ALCBS      ------KIASLGLRIRRGATYHGLAINRDMDLSPWHRINPCGHVDQPMTTLKADLDR-------------
LIPB_LEGPA      ----EKKVASIGLRVKNGCTYHGIALNVNMDLSPFLGINPCGFAKMEMTQMS------------------
LIPB_EHRCJ      NGI-EKKIAAFGIRIRKWITYHGVSVNIYTDLSHYLGIVPCGIKEYGVTS--------------------
LIPB_ENT38      ----EMKICSLGLRIRKGCSFHGLALNINMDLSPFLRINPCGYAGMEMTQM-------------------
LIPB_SHEHH      ----ERKIASLGLRIRKGCSFHGLALNVDMDMSPFQRINPCG----------------------------
LIPB_RHIL3      KPLAEDKIAALGIRLRKWVTFHGLSLNVDPDLDHFGGIVPCGISAYGVTSL-VDLGLPVMMADVDIRLRT
LIPB_PSEMY      ------KIASLGLRVSRGCSFHGLALNVDMDMTPFLRINPCGYAGLKMVQMRDLLPSPPAFDEVSQRLEQ
LIPB_OLICO      KGDGEDKIAAIGVRLKRWVSMHGIAINVEPELSHFAGIVPCGIEDSGVTSL-ADLGLPVTMHDVDIALRQ
LIPB_LEGPC      ----EKKIASIGLRVKNGCTYHGIALNVNMDLSPFLGINPCGFAKMEMTQMS------------------
LIPB_SHEPA      ----ERKIASLGLRIRKGCSFHGLALNVDMDMSPFQRINPCG----------------------------
LIPB_RHOFD      PGLPQRPMKSXXXXVSRNCTYHGVALNVAMDLEPYTRINPCGYAGLQTVDLS-----TIGV---------
LIPB_PSEF5      ------KIASLGLRIRHGCSFHGLALNVDMDLQPFRRINPCGYAGLAMTQLS------------------
LIPB_PROM1      ----DKKVGSIGIGCKRWVTQHGFSLNVDCDLIGFEKIIPCGLDKVKVGKLS------------------
LIPB_NITEC      ------KIASLGLKIRRGACYHGIAFNADMDLAPFVAINPCGYPGLRVTQA-----KELGISDNKEVLAG
LIPB_PSEU2      ------KIASLGLRIRNGCSFHGLALNVDMDLEPFRRINPCGYAGLAMTQLS------------------
LIPB_PROMT      ----DKKVGSIGIGCKRWVTQHGFSLNVDCDLIGFEKIIPCGLDKVKVGKLS------------------
LIPB_VIBHB      -----KKICSLGLRIRKGCSFHGLALNVNMDLGPFLRINPCGYEGMEMVQVS-----QVGGPEDIEAVEK
LIPB_SHEB9      ---DERKIASLGLRIRKGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_SHEB8      ---DERKIASLGLRIRKGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_SHEB5      ---DERKIASLGLRIRKGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_SHEB2      ---DERKIASLGLRIRKGCSFHGLALNVDMDLAPFRRINPCG----------------------------
LIPB_SHEPW      ----ERKVASLGLRIRKGCSFHGLALNVDMDMSPFQRINPCG----------------------------
LIPB_RHOS5      GQPREDKIAAIGVKLRRWVSFHGLSINLEPDLSHFEGIVPCGIREHGVTSL-------------------
LIPB_PSYIN      -----KKIASLGLKIRKGCSFHGLALNVDMDLSPFLQINPCGYAGLEMTQCKAE----------------
LIPB_PSESM      ------KIASLGLRIRNGCSFHGLALNVDMDLEPFRRINPCGYAGLAMTQLS------------------
LIPB_PSEPF      ------KIASLGLRIRHGCSFHGLALNVDMNLEPFRRINPCGYAGLAMTQLS------------------
LIPB_PSE14      ------KIASLGLRIRNGCSFHGLALNVDMDLEPFRRINPCGYAGLAMTQLS------------------
LIPB_PROM5      ----ERKIASIGIGCKRWVTIHGFSINVNCKLENFDKIVPCGIQGCQMANMS------------------
LIPB_PHOPR      ---DNKKICSLGLRIRRGCSFHGLALNINMDLTPFLRINPCGYAGMEMTQL-------------------
LIPB_RHILO      GSPAEDKI