[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55194.1

[Show Plain Result]


## Summary of Sequence Search
    1::256
    1::256     e-132 100%  256 aa  HIS6_THEFY RecName: Full=Imidazole glycerol phosphate synthase
    1::251     e-104  80%  251 aa  HIS6_STRCO RecName: Full=Imidazole glycerol phosphate synthase
    1::251     e-103  79%  251 aa  HIS6_STRAW RecName: Full=Imidazole glycerol phosphate synthase
    1::257     e-103  79%  257 aa  HIS6_KINRD RecName: Full=Imidazole glycerol phosphate synthase
    1::251     e-101  73%  251 aa  HIS6_STRGG RecName: Full=Imidazole glycerol phosphate synthase
    7::261     e-101  79%  261 aa  HIS6_MYCVP RecName: Full=Imidazole glycerol phosphate synthase
    1::257     e-101  77%  257 aa  HIS6_RHOOB RecName: Full=Imidazole glycerol phosphate synthase
    1::257     e-100  76%  257 aa  HIS6_RHOSR RecName: Full=Imidazole glycerol phosphate synthase
    1::257     8e-99  76%  257 aa  HIS6_RHOE4 RecName: Full=Imidazole glycerol phosphate synthase
    1::257     2e-98  75%  257 aa  HIS6_NOCFA RecName: Full=Imidazole glycerol phosphate synthase
    8::262     2e-98  71%  265 aa  HIS6_MYCPA RecName: Full=Imidazole glycerol phosphate synthase
    8::262     2e-98  71%  265 aa  HIS6_MYCA1 RecName: Full=Imidazole glycerol phosphate synthase
    7::261     3e-97  76%  261 aa  HIS6_MYCGI RecName: Full=Imidazole glycerol phosphate synthase
    1::257     1e-96  75%  257 aa  HIS6_MYCA9 RecName: Full=Imidazole glycerol phosphate synthase
    1::258     1e-96  74%  258 aa  HIS6_ARTS2 RecName: Full=Imidazole glycerol phosphate synthase
    7::261     3e-96  76%  261 aa  HIS6_MYCMM RecName: Full=Imidazole glycerol phosphate synthase
    7::261     5e-96  75%  261 aa  HIS6_MYCUA RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-95  75%  256 aa  HIS6_MICLC RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-95  68%  256 aa  HIS6_BIFLI RecName: Full=Imidazole glycerol phosphate synthase
    1::257     2e-95  70%  258 aa  HIS6_CORGL RecName: Full=Imidazole glycerol phosphate synthase
    1::257     2e-95  70%  258 aa  HIS6_CORGB RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-95  72%  256 aa  HIS6_BEUC1 RecName: Full=Imidazole glycerol phosphate synthase
    1::257     3e-95  71%  258 aa  HIS6_COREF RecName: Full=Imidazole glycerol phosphate synthase
    1::259     4e-95  71%  260 aa  HIS6_CORJK RecName: Full=Imidazole glycerol phosphate synthase
    1::258     7e-95  75%  258 aa  HIS6_ARTAT RecName: Full=Imidazole glycerol phosphate synthase
    1::256     9e-95  68%  256 aa  HIS6_BIFLO RecName: Full=Imidazole glycerol phosphate synthase
    1::256     9e-95  68%  256 aa  HIS6_BIFLD RecName: Full=Imidazole glycerol phosphate synthase
    1::257     1e-94  67%  258 aa  HIS6_CORDI RecName: Full=Imidazole glycerol phosphate synthase
    1::256     8e-94  66%  256 aa  HIS6_BIFAA RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-93  71%  256 aa  HIS6_BIFA0 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-93  73%  256 aa  HIS6_RENSM RecName: Full=Imidazole glycerol phosphate synthase
    1::254     6e-93  73%  254 aa  HIS6_FRASC RecName: Full=Imidazole glycerol phosphate synthase
    1::258     2e-91  73%  258 aa  HIS6_ARTCA RecName: Full=Imidazole glycerol phosphate synthase
    1::258     4e-91  71%  258 aa  HIS6_NOCSJ RecName: Full=Imidazole glycerol phosphate synthase
   13::267     5e-91  73%  267 aa  HIS6_MYCTU RecName: Full=Imidazole glycerol phosphate synthase
   13::267     5e-91  73%  267 aa  HIS6_MYCTA RecName: Full=Imidazole glycerol phosphate synthase
    7::261     1e-90  73%  261 aa  HIS6_MYCLE RecName: Full=Imidazole glycerol phosphate synthase
    7::261     1e-90  73%  261 aa  HIS6_MYCLB RecName: Full=Imidazole glycerol phosphate synthase
    7::261     1e-90  72%  261 aa  HIS6_MYCS2 RecName: Full=Imidazole glycerol phosphate synthase
   13::267     7e-90  72%  267 aa  HIS6_MYCBT RecName: Full=Imidazole glycerol phosphate synthase
   13::267     7e-90  72%  267 aa  HIS6_MYCBP RecName: Full=Imidazole glycerol phosphate synthase
   13::267     7e-90  72%  267 aa  HIS6_MYCBO RecName: Full=Imidazole glycerol phosphate synthase
    1::254     3e-89  72%  254 aa  HIS6_KOCRD RecName: Full=Imidazole glycerol phosphate synthase
    1::252     7e-89  69%  253 aa  HIS6_CORU7 RecName: Full=Imidazole glycerol phosphate synthase
    1::255     1e-88  71%  255 aa  HIS6_SALTO RecName: Full=Imidazole glycerol phosphate synthase
    1::253     1e-88  72%  254 aa  HIS6_LEIXX RecName: Full=Imidazole glycerol phosphate synthase
    1::253     2e-87  69%  254 aa  HIS6_CORA7 RecName: Full=Imidazole glycerol phosphate synthase
    7::261     7e-87  71%  261 aa  HIS6_MYCSS RecName: Full=Imidazole glycerol phosphate synthase
    7::261     7e-87  71%  261 aa  HIS6_MYCSK RecName: Full=Imidazole glycerol phosphate synthase
    7::261     7e-87  71%  261 aa  HIS6_MYCSJ RecName: Full=Imidazole glycerol phosphate synthase
    5::251     3e-82  63%  260 aa  HIS6_THERP RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-82  62%  252 aa  HIS6_MAGSA RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-81  59%  257 aa  HIS6_NITOC RecName: Full=Imidazole glycerol phosphate synthase
    1::255     3e-81  68%  255 aa  HIS6_SALAI RecName: Full=Imidazole glycerol phosphate synthase
    2::252     3e-81  61%  253 aa  HIS6_GEOSF RecName: Full=Imidazole glycerol phosphate synthase
    1::256     4e-81  59%  256 aa  HIS6_PSEMY RecName: Full=Imidazole glycerol phosphate synthase
    1::256     4e-81  59%  257 aa  HIS6_MARAV RecName: Full=Imidazole glycerol phosphate synthase
    2::251     4e-81  61%  261 aa  HIS6_AZOBR RecName: Full=Imidazole glycerol phosphate synthase
    1::256     6e-81  59%  256 aa  HIS6_PSEA7 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-80  59%  256 aa  HIS6_PSEAB RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-80  59%  256 aa  HIS6_PSEA8 RecName: Full=Imidazole glycerol phosphate synthase
    2::252     1e-80  61%  253 aa  HIS6_GEOUR RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-80  59%  256 aa  HIS61_PSEAE RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-80  58%  256 aa  HIS6_PSEU5 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-80  58%  257 aa  HIS6_BURPS RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-80  58%  257 aa  HIS6_BURP6 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-80  58%  257 aa  HIS6_BURP1 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-80  58%  257 aa  HIS6_BURP0 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-80  60%  252 aa  HIS6_AZOSB RecName: Full=Imidazole glycerol phosphate synthase
    1::256     3e-80  58%  256 aa  HIS6_PSEFS RecName: Full=Imidazole glycerol phosphate synthase
    1::256     6e-80  58%  257 aa  HIS6_BURMS RecName: Full=Imidazole glycerol phosphate synthase
    1::256     6e-80  58%  257 aa  HIS6_BURMA RecName: Full=Imidazole glycerol phosphate synthase
    1::256     6e-80  58%  257 aa  HIS6_BURM9 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     6e-80  58%  257 aa  HIS6_BURM7 RecName: Full=Imidazole glycerol phosphate synthase
    2::255     8e-80  59%  256 aa  HIS6_THISH RecName: Full=Imidazole glycerol phosphate synthase
    1::256     8e-80  58%  256 aa  HIS6_PSEF5 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     8e-80  58%  253 aa  HIS6_GLUOX RecName: Full=Imidazole glycerol phosphate synthase
    2::252     1e-79  60%  253 aa  HIS6_GEOSL RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-79  57%  257 aa  HIS6_BURTA RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-79  58%  256 aa  HIS6_PSESM RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-79  57%  256 aa  HIS6_PSEPF RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-79  57%  256 aa  HIS6_PSEPK RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-79  57%  256 aa  HIS6_PSEP1 RecName: Full=Imidazole glycerol phosphate synthase
    3::253     2e-79  65%  254 aa  HIS6_HALHL RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-79  58%  256 aa  HIS6_AZOVD RecName: Full=Imidazole glycerol phosphate synthase
    2::252     2e-79  60%  253 aa  HIS6_GEOMG RecName: Full=Imidazole glycerol phosphate synthase
    1::256     3e-79  57%  256 aa  HIS6_PSEU2 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     3e-79  57%  256 aa  HIS6_PSE14 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     4e-79  60%  252 aa  HIS6_PELTS RecName: Full=Imidazole glycerol phosphate synthase
    1::256     5e-79  57%  257 aa  HIS6_MARMS RecName: Full=Imidazole glycerol phosphate synthase
    1::256     5e-79  57%  257 aa  HIS6_BURS3 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     5e-79  57%  257 aa  HIS6_BURCM RecName: Full=Imidazole glycerol phosphate synthase
    1::256     5e-79  57%  257 aa  HIS6_BURCH RecName: Full=Imidazole glycerol phosphate synthase
    1::256     5e-79  57%  257 aa  HIS6_BURCC RecName: Full=Imidazole glycerol phosphate synthase
    1::256     5e-79  57%  257 aa  HIS6_BURCA RecName: Full=Imidazole glycerol phosphate synthase
    1::256     5e-79  57%  257 aa  HIS6_BURA4 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     7e-79  57%  256 aa  HIS6_PSEPG RecName: Full=Imidazole glycerol phosphate synthase
    1::256     7e-79  57%  256 aa  HIS6_PSEE4 RecName: Full=Imidazole glycerol phosphate synthase
    1::251     1e-78  59%  255 aa  HIS6_IGNH4 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-78  59%  252 aa  HIS6_DESAP RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-78  57%  256 aa  HIS6_PSEPW RecName: Full=Imidazole glycerol phosphate synthase
    1::252     3e-78  58%  254 aa  HIS6_DESHY RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-78  59%  252 aa  HIS6_MOOTA RecName: Full=Imidazole glycerol phosphate synthase
    2::252     3e-78  58%  254 aa  HIS6_GEOLS RecName: Full=Imidazole glycerol phosphate synthase
    1::256     6e-78  56%  257 aa  HIS6_BURP8 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     6e-78  56%  257 aa  HIS6_BURM1 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     8e-78  58%  253 aa  HIS6_DESHD RecName: Full=Imidazole glycerol phosphate synthase
    2::251     8e-78  59%  255 aa  HIS6_AKKM8 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     1e-77  63%  258 aa  HIS6_GLUDA RecName: Full=Imidazole glycerol phosphate synthase
    2::253     1e-77  58%  254 aa  HIS6_CHRVO RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-77  56%  257 aa  HIS6_BURCJ RecName: Full=Imidazole glycerol phosphate synthase
    5::257     2e-77  60%  258 aa  HIS6_ROSS1 RecName: Full=Imidazole glycerol phosphate synthase
    2::253     2e-77  58%  254 aa  HIS6_METCA RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-77  57%  258 aa  HIS6_RHOCS RecName: Full=Imidazole glycerol phosphate synthase
    1::257     2e-77  56%  258 aa  HIS6_NITEC RecName: Full=Imidazole glycerol phosphate synthase
    2::252     2e-77  58%  253 aa  HIS6_METPP RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-77  59%  252 aa  HIS6_SULSY RecName: Full=Imidazole glycerol phosphate synthase
    1::256     3e-77  55%  257 aa  HIS6_BURPP RecName: Full=Imidazole glycerol phosphate synthase
    1::254     4e-77  60%  255 aa  HIS6_NEIM0 RecName: Full=Imidazole glycerol phosphate synthase
    1::254     4e-77  60%  255 aa  HIS6_NEIG2 RecName: Full=Imidazole glycerol phosphate synthase
    1::254     4e-77  60%  255 aa  HIS6_NEIG1 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     4e-77  59%  252 aa  HIS6_DESRM RecName: Full=Imidazole glycerol phosphate synthase
    1::254     5e-77  60%  255 aa  HIS6_NEIMF RecName: Full=Imidazole glycerol phosphate synthase
    1::256     5e-77  56%  257 aa  HIS6_CHRSD RecName: Full=Imidazole glycerol phosphate synthase
    1::257     6e-77  56%  258 aa  HIS6_NITEU RecName: Full=Imidazole glycerol phosphate synthase
    1::256     6e-77  56%  257 aa  HIS6_BURVG RecName: Full=Imidazole glycerol phosphate synthase
    2::255     8e-77  59%  258 aa  HIS6_AZOC5 RecName: Full=Imidazole glycerol phosphate synthase
    2::252     1e-76  56%  253 aa  HIS6_THETN RecName: Full=Imidazole glycerol phosphate synthase
    1::250     1e-76  66%  252 aa  HIS6_THET2 RecName: Full=Imidazole glycerol phosphate synthase
    1::254     1e-76  60%  255 aa  HIS6_NEIMA RecName: Full=Imidazole glycerol phosphate synthase
    2::253     1e-76  58%  254 aa  HIS6_LARHH RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-76  55%  257 aa  HIS6_BURXL RecName: Full=Imidazole glycerol phosphate synthase
    3::252     1e-76  55%  253 aa  HIS6_ARCB4 RecName: Full=Imidazole glycerol phosphate synthase
    2::255     1e-76  55%  256 aa  HIS6_RALME RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-76  55%  257 aa  HIS6_TERTT RecName: Full=Imidazole glycerol phosphate synthase
    2::258     2e-76  56%  259 aa  HIS6_VARPS RecName: Full=Imidazole glycerol phosphate synthase
    1::250     2e-76  66%  252 aa  HIS6_THET8 RecName: Full=Imidazole glycerol phosphate synthase
    2::252     2e-76  56%  253 aa  HIS6_THEPX RecName: Full=Imidazole glycerol phosphate synthase
    5::252     2e-76  58%  253 aa  HIS6_CLOTH RecName: Full=Imidazole glycerol phosphate synthase
    2::250     3e-76  56%  251 aa  HIS6_THIDA RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-76  58%  252 aa  HIS6_PERMH RecName: Full=Imidazole glycerol phosphate synthase
    2::255     4e-76  55%  256 aa  HIS6_RALEJ RecName: Full=Imidazole glycerol phosphate synthase
    1::251     4e-76  56%  252 aa  HIS6_NITMU RecName: Full=Imidazole glycerol phosphate synthase
    5::251     5e-76  55%  252 aa  HIS6_SULDN RecName: Full=Imidazole glycerol phosphate synthase
    2::255     5e-76  55%  256 aa  HIS6_PSYWF RecName: Full=Imidazole glycerol phosphate synthase
    2::252     5e-76  56%  253 aa  HIS6_CLOAB RecName: Full=Imidazole glycerol phosphate synthase
    2::259     7e-76  55%  260 aa  HIS6_PSYA2 RecName: Full=Imidazole glycerol phosphate synthase
    2::257     7e-76  57%  258 aa  HIS6_MAGSM RecName: Full=Imidazole glycerol phosphate synthase
   13::262     7e-76  59%  263 aa  HIS6_CLAM3 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     9e-76  56%  257 aa  HIS6_HAHCH RecName: Full=Imidazole glycerol phosphate synthase
   13::267     9e-76  56%  269 aa  HIS6_BORPE RecName: Full=Imidazole glycerol phosphate synthase
   13::267     9e-76  56%  269 aa  HIS6_BORBR RecName: Full=Imidazole glycerol phosphate synthase
    5::253     1e-75  56%  254 aa  HIS6_SULNB RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-75  57%  254 aa  HIS6_SOLUE RecName: Full=Imidazole glycerol phosphate synthase
    1::251     1e-75  57%  252 aa  HIS6_METFK RecName: Full=Imidazole glycerol phosphate synthase
    2::255     2e-75  55%  256 aa  HIS6_RALEH RecName: Full=Imidazole glycerol phosphate synthase
    2::254     2e-75  56%  255 aa  HIS6_PELCD RecName: Full=Imidazole glycerol phosphate synthase
    2::252     2e-75  56%  253 aa  HIS6_OPITP RecName: Full=Imidazole glycerol phosphate synthase
    2::257     2e-75  56%  261 aa  HIS6_HELMI RecName: Full=Imidazole glycerol phosphate synthase
    2::258     2e-75  54%  259 aa  HIS6_DIAST RecName: Full=Imidazole glycerol phosphate synthase
   11::265     2e-75  56%  267 aa  HIS6_BORA1 RecName: Full=Imidazole glycerol phosphate synthase
    2::258     2e-75  54%  259 aa  HIS6_ACISJ RecName: Full=Imidazole glycerol phosphate synthase
    2::272     3e-75  61%  273 aa  HIS6_UNCMA RecName: Full=Imidazole glycerol phosphate synthase
    1::256     3e-75  54%  257 aa  HIS6_THICR RecName: Full=Imidazole glycerol phosphate synthase
    1::267     4e-75  54%  268 aa  HIS6_METMJ RecName: Full=Imidazole glycerol phosphate synthase
   13::267     4e-75  56%  269 aa  HIS6_BORPA RecName: Full=Imidazole glycerol phosphate synthase
    2::259     5e-75  55%  260 aa  HIS6_PSYCK RecName: Full=Imidazole glycerol phosphate synthase
    2::251     5e-75  55%  252 aa  HIS6_ACIAD RecName: Full=Imidazole glycerol phosphate synthase
    1::267     6e-75  54%  268 aa  HIS6_METB6 RecName: Full=Imidazole glycerol phosphate synthase
    2::255     6e-75  54%  256 aa  HIS6_CUPTR RecName: Full=Imidazole glycerol phosphate synthase
    2::250     6e-75  58%  253 aa  HIS6_ACIF5 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     6e-75  58%  253 aa  HIS6_ACIF2 RecName: Full=Imidazole glycerol phosphate synthase
    5::253     8e-75  58%  254 aa  HIS6_THEP3 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     8e-75  57%  252 aa  HIS6_RHORT RecName: Full=Imidazole glycerol phosphate synthase
    2::255     8e-75  54%  258 aa  HIS6_RALPJ RecName: Full=Imidazole glycerol phosphate synthase
    1::267     8e-75  54%  271 aa  HIS6_METHJ RecName: Full=Imidazole glycerol phosphate synthase
    2::251     8e-75  55%  252 aa  HIS6_DECAR RecName: Full=Imidazole glycerol phosphate synthase
    2::270     8e-75  57%  271 aa  HIS6_ARCFU RecName: Full=Imidazole glycerol phosphate synthase
    2::249     1e-74  60%  252 aa  HIS6_PYRKO RecName: Full=Imidazole glycerol phosphate synthase
    2::252     1e-74  57%  253 aa  HIS6_CLOCE RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-74  55%  252 aa  HIS6_ACIBT RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-74  55%  252 aa  HIS6_ACIBC RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-74  55%  252 aa  HIS6_ACIB5 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-74  55%  252 aa  HIS6_ACIB3 RecName: Full=Imidazole glycerol phosphate synthase
    2::265     1e-74  54%  266 aa  HIS6_DELAS RecName: Full=Imidazole glycerol phosphate synthase
    2::254     2e-74  54%  257 aa  HIS6_ANAVT RecName: Full=Imidazole glycerol phosphate synthase
    2::255     2e-74  54%  256 aa  HIS6_RALSO RecName: Full=Imidazole glycerol phosphate synthase
    2::254     2e-74  55%  254 aa  HIS6_MICAN RecName: Full=Imidazole glycerol phosphate synthase
    4::253     3e-74  60%  254 aa  HIS6_WOLSU RecName: Full=Imidazole glycerol phosphate synthase
    2::258     4e-74  54%  259 aa  HIS6_POLNA RecName: Full=Imidazole glycerol phosphate synthase
    2::251     5e-74  57%  253 aa  HIS6_DINSH RecName: Full=Imidazole glycerol phosphate synthase
    2::254     5e-74  53%  259 aa  HIS6_ANASP RecName: Full=Imidazole glycerol phosphate synthase
    2::258     9e-74  54%  259 aa  HIS6_POLSJ RecName: Full=Imidazole glycerol phosphate synthase
    1::254     9e-74  58%  255 aa  HIS6_NEIMB RecName: Full=Imidazole glycerol phosphate synthase
    2::257     9e-74  60%  261 aa  HIS6_HELMO RecName: Full=Imidazole glycerol phosphate synthase
    5::252     9e-74  58%  253 aa  HIS6_CLOBK RecName: Full=Imidazole glycerol phosphate synthase
    2::251     9e-74  57%  252 aa  HIS6_AZOSE RecName: Full=Imidazole glycerol phosphate synthase
    2::249     1e-73  59%  252 aa  HIS6_THEGJ RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-73  53%  251 aa  HIS6_STRMU RecName: Full=Imidazole glycerol phosphate synthase
    6::253     2e-73  55%  254 aa  HIS6_NITSB RecName: Full=Imidazole glycerol phosphate synthase
    5::252     2e-73  58%  253 aa  HIS6_CLOBJ RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-73  56%  261 aa  HIS6_BRUSU RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-73  56%  261 aa  HIS6_BRUSI RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-73  56%  261 aa  HIS6_BRUO2 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-73  56%  261 aa  HIS6_BRUME RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-73  56%  261 aa  HIS6_BRUMB RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-73  56%  261 aa  HIS6_BRUC2 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-73  56%  261 aa  HIS6_BRUAB RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-73  56%  261 aa  HIS6_BRUA2 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-73  56%  261 aa  HIS6_BRUA1 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     3e-73  56%  261 aa  HIS6_OCHA4 RecName: Full=Imidazole glycerol phosphate synthase
    1::267     3e-73  55%  268 aa  HIS6_METPE RecName: Full=Imidazole glycerol phosphate synthase
    1::267     3e-73  54%  268 aa  HIS6_METLZ RecName: Full=Imidazole glycerol phosphate synthase
    2::252     3e-73  57%  260 aa  HIS6_CAUCR RecName: Full=Imidazole glycerol phosphate synthase
    2::252     3e-73  57%  260 aa  HIS6_CAUCN RecName: Full=Imidazole glycerol phosphate synthase
    2::250     3e-73  55%  251 aa  HIS6_LISIN RecName: Full=Imidazole glycerol phosphate synthase
    5::252     3e-73  58%  253 aa  HIS6_CLOBH RecName: Full=Imidazole glycerol phosphate synthase
    5::252     3e-73  58%  253 aa  HIS6_CLOB1 RecName: Full=Imidazole glycerol phosphate synthase
    2::249     4e-73  52%  252 aa  HIS6_THEON RecName: Full=Imidazole glycerol phosphate synthase
    2::270     4e-73  56%  272 aa  HIS6_METJA RecName: Full=Imidazole glycerol phosphate synthase
    1::257     7e-73  52%  281 aa  HIS6_THEEB RecName: Full=Imidazole glycerol phosphate synthase
    2::254     7e-73  56%  262 aa  HIS6_RHOBA RecName: Full=Imidazole glycerol phosphate synthase
    2::250     7e-73  55%  251 aa  HIS6_LISMO RecName: Full=Imidazole glycerol phosphate synthase
    2::249     1e-72  54%  251 aa  HIS6_PYRFU RecName: Full=Imidazole glycerol phosphate synthase
    2::250     1e-72  57%  252 aa  HIS6_HALOH RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-72  59%  253 aa  HIS6_CLOB6 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-72  55%  252 aa  HIS6_BACC0 RecName: Full=Imidazole glycerol phosphate synthase
    2::255     2e-72  55%  263 aa  HIS6_RHILO RecName: Full=Imidazole glycerol phosphate synthase
    2::271     2e-72  54%  272 aa  HIS6_METM7 RecName: Full=Imidazole glycerol phosphate synthase
    2::271     2e-72  54%  272 aa  HIS6_METM5 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-72  55%  252 aa  HIS6_BACC3 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-72  55%  252 aa  HIS6_BACAH RecName: Full=Imidazole glycerol phosphate synthase
    3::251     4e-72  54%  252 aa  HIS6_SYNWW RecName: Full=Imidazole glycerol phosphate synthase
    1::252     4e-72  60%  253 aa  HIS6_PYRAE RecName: Full=Imidazole glycerol phosphate synthase
    2::271     4e-72  54%  272 aa  HIS6_METM6 RecName: Full=Imidazole glycerol phosphate synthase
    2::272     4e-72  54%  273 aa  HIS6_METBU RecName: Full=Imidazole glycerol phosphate synthase
    2::250     4e-72  55%  251 aa  HIS6_LISW6 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     4e-72  56%  252 aa  HIS6_GEOSM RecName: Full=Imidazole glycerol phosphate synthase
    2::251     4e-72  56%  259 aa  HIS6_CARHZ RecName: Full=Imidazole glycerol phosphate synthase
    2::250     4e-72  56%  253 aa  HIS6_AQUAE RecName: Full=Imidazole glycerol phosphate synthase
    2::271     5e-72  52%  272 aa  HIS6_METVS RecName: Full=Imidazole glycerol phosphate synthase
    5::252     5e-72  57%  253 aa  HIS6_CLOBL RecName: Full=Imidazole glycerol phosphate synthase
    2::257     5e-72  55%  259 aa  HIS6_CHLSY RecName: Full=Imidazole glycerol phosphate synthase
    2::257     5e-72  55%  259 aa  HIS6_CHLAA RecName: Full=Imidazole glycerol phosphate synthase
    2::251     6e-72  56%  252 aa  HIS6_GEOBB RecName: Full=Imidazole glycerol phosphate synthase
    2::271     8e-72  54%  272 aa  HIS6_METMP RecName: Full=Imidazole glycerol phosphate synthase
    1::256     8e-72  52%  257 aa  HIS6_CELJU RecName: Full=Imidazole glycerol phosphate synthase
    2::252     8e-72  56%  260 aa  HIS6_CAUSK RecName: Full=Imidazole glycerol phosphate synthase
    2::251     8e-72  54%  252 aa  HIS6_BACCR RecName: Full=Imidazole glycerol phosphate synthase
    1::255     1e-71  50%  261 aa  HIS6_SYNY3 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-71  54%  258 aa  HIS6_RHISN RecName: Full=Imidazole glycerol phosphate synthase
    1::256     1e-71  54%  258 aa  HIS6_RHIME RecName: Full=Imidazole glycerol phosphate synthase
    2::272     1e-71  53%  273 aa  HIS6_METMA RecName: Full=Imidazole glycerol phosphate synthase
    2::257     1e-71  55%  263 aa  HIS6_HERA2 RecName: Full=Imidazole glycerol phosphate synthase
    5::251     1e-71  59%  252 aa  HIS6_CAMFF RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-71  55%  252 aa  HIS6_BREBN RecName: Full=Imidazole glycerol phosphate synthase
    3::251     2e-71  57%  252 aa  HIS6_CAMHC RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-71  55%  252 aa  HIS6_BACCQ RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-71  56%  256 aa  HIS6_METSB RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-71  55%  252 aa  HIS6_BACWK RecName: Full=Imidazole glycerol phosphate synthase
    5::252     3e-71  53%  254 aa  HIS6_NAUPA RecName: Full=Imidazole glycerol phosphate synthase
    5::252     3e-71  57%  252 aa  HIS6_GEOKA RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-71  55%  252 aa  HIS6_BACHK RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-71  55%  252 aa  HIS6_BACAN RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-71  55%  252 aa  HIS6_BACAC RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-71  55%  252 aa  HIS6_BACAA RecName: Full=Imidazole glycerol phosphate synthase
    2::251     4e-71  56%  253 aa  HIS6_RHOS5 RecName: Full=Imidazole glycerol phosphate synthase
    1::250     4e-71  53%  251 aa  HIS6_HELHP RecName: Full=Imidazole glycerol phosphate synthase
    2::277     5e-71  62%  278 aa  HIS6_THEYD RecName: Full=Imidazole glycerol phosphate synthase
    2::251     7e-71  51%  252 aa  HIS6_STRSV RecName: Full=Imidazole glycerol phosphate synthase
    2::252     7e-71  61%  254 aa  HIS6_GLOVI RecName: Full=Imidazole glycerol phosphate synthase
    2::251     7e-71  55%  252 aa  HIS6_BACCZ RecName: Full=Imidazole glycerol phosphate synthase
    2::251     7e-71  54%  252 aa  HIS6_BACC4 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     7e-71  55%  252 aa  HIS6_BACC1 RecName: Full=Imidazole glycerol phosphate synthase
    5::251     7e-71  51%  252 aa  HIS6_ALKMQ RecName: Full=Imidazole glycerol phosphate synthase
    5::250     9e-71  54%  253 aa  HIS6_DEHSB RecName: Full=Imidazole glycerol phosphate synthase
    4::254     9e-71  55%  257 aa  HIS6_BRAJA RecName: Full=Imidazole glycerol phosphate synthase
    2::251     9e-71  55%  252 aa  HIS6_BACC7 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     9e-71  52%  258 aa  HIS6_ALCBS RecName: Full=Imidazole glycerol phosphate synthase
    2::254     1e-70  56%  255 aa  HIS6_SYNP6 RecName: Full=Imidazole glycerol phosphate synthase
    5::250     1e-70  54%  253 aa  HIS6_DEHSC RecName: Full=Imidazole glycerol phosphate synthase
    2::265     1e-70  58%  266 aa  HIS6_ACIAC RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-70  53%  258 aa  HIS6_SINMW RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-70  55%  253 aa  HIS6_SILST RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-70  53%  252 aa  HIS6_POLNS RecName: Full=Imidazole glycerol phosphate synthase
    2::272     2e-70  52%  273 aa  HIS6_METAC RecName: Full=Imidazole glycerol phosphate synthase
    1::254     3e-70  54%  255 aa  HIS6_VESOH RecName: Full=Imidazole glycerol phosphate synthase
    1::251     3e-70  59%  251 aa  HIS6_PROAC RecName: Full=Imidazole glycerol phosphate synthase
    5::250     3e-70  53%  251 aa  HIS6_PELUB RecName: Full=Imidazole glycerol phosphate synthase
    5::252     3e-70  55%  252 aa  HIS6_GEOTN RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-70  51%  252 aa  HIS6_STRGC RecName: Full=Imidazole glycerol phosphate synthase
    2::250     3e-70  52%  254 aa  HIS6_OCEIH RecName: Full=Imidazole glycerol phosphate synthase
    2::272     3e-70  52%  273 aa  HIS6_METBF RecName: Full=Imidazole glycerol phosphate synthase
    4::255     3e-70  55%  258 aa  HIS6_BRASO RecName: Full=Imidazole glycerol phosphate synthase
    2::259     4e-70  55%  261 aa  HIS6_JANSC RecName: Full=Imidazole glycerol phosphate synthase
    5::250     4e-70  54%  253 aa  HIS6_DEHE1 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     4e-70  53%  252 aa  HIS6_BACC2 RecName: Full=Imidazole glycerol phosphate synthase
    1::256     6e-70  51%  257 aa  HIS6_SACD2 RecName: Full=Imidazole glycerol phosphate synthase
    2::253     6e-70  60%  253 aa  HIS6_LYSSC RecName: Full=Imidazole glycerol phosphate synthase
    4::255     6e-70  56%  258 aa  HIS6_BRASB RecName: Full=Imidazole glycerol phosphate synthase
    4::252     8e-70  54%  255 aa  HIS6_RHOP5 RecName: Full=Imidazole glycerol phosphate synthase
    4::255     8e-70  55%  258 aa  HIS6_NITWN RecName: Full=Imidazole glycerol phosphate synthase
    5::252     8e-70  55%  258 aa  HIS6_CLOPH RecName: Full=Imidazole glycerol phosphate synthase
    1::254     1e-69  53%  255 aa  HIS6_RUTMC RecName: Full=Imidazole glycerol phosphate synthase
    4::255     2e-69  53%  258 aa  HIS6_RHOPB RecName: Full=Imidazole glycerol phosphate synthase
    2::253     2e-69  56%  256 aa  HIS6_PROM9 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-69  56%  253 aa  HIS6_PARDP RecName: Full=Imidazole glycerol phosphate synthase
    1::256     2e-69  53%  268 aa  HIS6_MESSB RecName: Full=Imidazole glycerol phosphate synthase
    2::253     2e-69  55%  256 aa  HIS6_PROM0 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     3e-69  55%  253 aa  HIS6_RHOSK RecName: Full=Imidazole glycerol phosphate synthase
    3::248     4e-69  53%  249 aa  HIS6_SULTO RecName: Full=Imidazole glycerol phosphate synthase
    1::256     4e-69  52%  265 aa  HIS6_ALHEH RecName: Full=Imidazole glycerol phosphate synthase
    2::253     5e-69  56%  256 aa  HIS6_PROMS RecName: Full=Imidazole glycerol phosphate synthase
    2::265     6e-69  52%  266 aa  HIS6_VEREI RecName: Full=Imidazole glycerol phosphate synthase
    2::257     6e-69  54%  270 aa  HIS6_CHLAD RecName: Full=Imidazole glycerol phosphate synthase
    1::251     8e-69  55%  255 aa  HIS6_ZYMMO RecName: Full=Imidazole glycerol phosphate synthase
    2::251     8e-69  55%  253 aa  HIS6_RHOS4 RecName: Full=Imidazole glycerol phosphate synthase
    2::253     8e-69  54%  256 aa  HIS6_PROM1 RecName: Full=Imidazole glycerol phosphate synthase
    5::251     8e-69  53%  252 aa  HIS6_CAMC5 RecName: Full=Imidazole glycerol phosphate synthase
    1::270     1e-68  56%  272 aa  HIS6_METKA RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-68  51%  252 aa  HIS6_HYDS0 RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-68  53%  252 aa  HIS6_GEOSW RecName: Full=Imidazole glycerol phosphate synthase
    2::234     1e-68  63%  254 aa  HIS6_ACICJ RecName: Full=Imidazole glycerol phosphate synthase
    2::255     1e-68  56%  258 aa  HIS6_METPB RecName: Full=Imidazole glycerol phosphate synthase
    1::252     1e-68  49%  254 aa  HIS6_JANMA RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-68  58%  252 aa  HIS6_ANOFW RecName: Full=Imidazole glycerol phosphate synthase
    2::255     2e-68  55%  258 aa  HIS6_XANP2 RecName: Full=Imidazole glycerol phosphate synthase
    1::254     2e-68  54%  268 aa  HIS6_SALRD RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-68  54%  253 aa  HIS6_RHOS1 RecName: Full=Imidazole glycerol phosphate synthase
    2::253     2e-68  55%  256 aa  HIS6_PROM2 RecName: Full=Imidazole glycerol phosphate synthase
    5::252     2e-68  53%  253 aa  HIS6_CLOB8 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-68  52%  252 aa  HIS6_BACCN RecName: Full=Imidazole glycerol phosphate synthase
    2::253     3e-68  54%  256 aa  HIS6_PROMT RecName: Full=Imidazole glycerol phosphate synthase
    2::253     3e-68  55%  257 aa  HIS6_PROM5 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     4e-68  51%  260 aa  HIS6_UNCTG RecName: Full=Imidazole glycerol phosphate synthase
    2::265     4e-68  50%  266 aa  HIS6_RHOFD RecName: Full=Imidazole glycerol phosphate synthase
    2::209     4e-68  59%  232 aa  HIS6_LISMH RecName: Full=Imidazole glycerol phosphate synthase
    2::253     5e-68  54%  255 aa  HIS6_PROMP RecName: Full=Imidazole glycerol phosphate synthase
    2::253     5e-68  56%  261 aa  HIS6_DEIRA RecName: Full=Imidazole glycerol phosphate synthase
    2::274     9e-68  51%  275 aa  HIS6_META3 RecName: Full=Imidazole glycerol phosphate synthase
    2::252     2e-67  54%  252 aa  HIS6_BACHD RecName: Full=Imidazole glycerol phosphate synthase
    4::255     2e-67  53%  258 aa  HIS6_NITHX RecName: Full=Imidazole glycerol phosphate synthase
    5::252     3e-67  53%  252 aa  HIS6_BACLD RecName: Full=Imidazole glycerol phosphate synthase
    2::251     5e-67  51%  252 aa  HIS6_POLSQ RecName: Full=Imidazole glycerol phosphate synthase
    2::252     5e-67  52%  252 aa  HIS6_LACPL RecName: Full=Imidazole glycerol phosphate synthase
    1::252     6e-67  53%  253 aa  HIS6_PARL1 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     6e-67  53%  252 aa  HIS6_DICTD RecName: Full=Imidazole glycerol phosphate synthase
    2::255     8e-67  56%  256 aa  HIS6_SYNSC RecName: Full=Imidazole glycerol phosphate synthase
    2::250     8e-67  52%  252 aa  HIS6_DICT6 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     8e-67  47%  259 aa  HIS6_DESVM RecName: Full=Imidazole glycerol phosphate synthase
    2::252     8e-67  54%  252 aa  HIS6_BACSK RecName: Full=Imidazole glycerol phosphate synthase
    2::249     1e-66  58%  253 aa  HIS6_THEMA RecName: Full=Imidazole glycerol phosphate synthase
    5::248     1e-66  52%  249 aa  HIS6_SULAC RecName: Full=Imidazole glycerol phosphate synthase
    2::250     1e-66  52%  251 aa  HIS6_LISMF RecName: Full=Imidazole glycerol phosphate synthase
    2::250     1e-66  52%  251 aa  HIS6_LISMC RecName: Full=Imidazole glycerol phosphate synthase
    1::270     1e-66  50%  271 aa  HIS6_HALMA RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-66  48%  259 aa  HIS6_DESDG RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-66  51%  253 aa  HIS6_CLOBA RecName: Full=Imidazole glycerol phosphate synthase
    2::255     1e-66  55%  256 aa  HIS61_SYNPX RecName: Full=Imidazole glycerol phosphate synthase
    2::249     1e-66  55%  249 aa  HIS6_EXIS2 RecName: Full=Imidazole glycerol phosphate synthase
    1::252     2e-66  55%  255 aa  HIS6_SPHAL RecName: Full=Imidazole glycerol phosphate synthase
    2::249     2e-66  58%  253 aa  HIS6_THESQ RecName: Full=Imidazole glycerol phosphate synthase
    2::206     2e-66  61%  267 aa  HIS6_METRJ RecName: Full=Imidazole glycerol phosphate synthase
    2::250     3e-66  54%  252 aa  HIS6_RHOCA RecName: Full=Imidazole glycerol phosphate synthase
    1::269     4e-66  57%  273 aa  HIS6_HALSA RecName: Full=Imidazole glycerol phosphate synthase
    1::269     4e-66  57%  273 aa  HIS6_HALS3 RecName: Full=Imidazole glycerol phosphate synthase
    5::250     4e-66  52%  251 aa  HIS6_CAMC1 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     5e-66  47%  259 aa  HIS6_DESVV RecName: Full=Imidazole glycerol phosphate synthase
    2::256     5e-66  47%  259 aa  HIS6_DESVH RecName: Full=Imidazole glycerol phosphate synthase
    1::256     5e-66  51%  258 aa  HIS6_AGRT5 RecName: Full=Imidazole glycerol phosphate synthase
    2::257     7e-66  55%  258 aa  HIS6_SYNS9 RecName: Full=Imidazole glycerol phosphate synthase
    2::206     7e-66  61%  258 aa  HIS6_METC4 RecName: Full=Imidazole glycerol phosphate synthase
    5::252     7e-66  53%  252 aa  HIS6_BACP2 RecName: Full=Imidazole glycerol phosphate synthase
    2::252     7e-66  55%  256 aa  HIS61_PROMM RecName: Full=Imidazole glycerol phosphate synthase
    1::270     1e-65  55%  271 aa  HIS6_NATPD RecName: Full=Imidazole glycerol phosphate synthase
    2::206     1e-65  61%  258 aa  HIS6_METEP RecName: Full=Imidazole glycerol phosphate synthase
    5::248     2e-65  51%  255 aa  HIS6_EXISA RecName: Full=Imidazole glycerol phosphate synthase
    2::255     3e-65  55%  263 aa  HIS6_SYNS3 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     3e-65  51%  251 aa  HIS6_PROA2 RecName: Full=Imidazole glycerol phosphate synthase
    2::206     3e-65  60%  258 aa  HIS6_METNO RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-65  48%  259 aa  HIS6_SYNFM RecName: Full=Imidazole glycerol phosphate synthase
    2::252     4e-65  49%  259 aa  HIS6_LACLS RecName: Full=Imidazole glycerol phosphate synthase
    1::252     4e-65  50%  254 aa  HIS6_HERAR RecName: Full=Imidazole glycerol phosphate synthase
    1::252     6e-65  54%  254 aa  HIS6_SPHWW RecName: Full=Imidazole glycerol phosphate synthase
    2::250     6e-65  51%  251 aa  HIS6_GRAFK RecName: Full=Imidazole glycerol phosphate synthase
    2::256     6e-65  54%  259 aa  HIS6_DESDA RecName: Full=Imidazole glycerol phosphate synthase
    2::250     6e-65  50%  250 aa  HIS6_BACFN RecName: Full=Imidazole glycerol phosphate synthase
    4::252     7e-65  52%  255 aa  HIS6_RHOPT RecName: Full=Imidazole glycerol phosphate synthase
    4::252     7e-65  52%  255 aa  HIS6_RHOPA RecName: Full=Imidazole glycerol phosphate synthase
    2::250     7e-65  50%  250 aa  HIS6_BACFR RecName: Full=Imidazole glycerol phosphate synthase
    3::254     1e-64  50%  256 aa  HIS6_LEPIC RecName: Full=Imidazole glycerol phosphate synthase
    3::254     1e-64  50%  256 aa  HIS61_LEPIN RecName: Full=Imidazole glycerol phosphate synthase
    2::242     2e-64  56%  258 aa  HIS6_PROM4 RecName: Full=Imidazole glycerol phosphate synthase
    2::252     2e-64  51%  261 aa  HIS6_LACF3 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     2e-64  53%  250 aa  HIS6_ELUMP RecName: Full=Imidazole glycerol phosphate synthase
    2::250     2e-64  50%  251 aa  HIS6_BACTN RecName: Full=Imidazole glycerol phosphate synthase
    5::250     2e-64  56%  251 aa  HIS6_SULSO RecName: Full=Imidazole glycerol phosphate synthase
    4::252     2e-64  52%  255 aa  HIS6_RHOP2 RecName: Full=Imidazole glycerol phosphate synthase
    2::257     3e-64  52%  263 aa  HIS6_DEIGD RecName: Full=Imidazole glycerol phosphate synthase
    2::273     4e-64  50%  274 aa  HIS6_METTH RecName: Full=Imidazole glycerol phosphate synthase
    2::252     4e-64  48%  259 aa  HIS6_LACLM RecName: Full=Imidazole glycerol phosphate synthase
    2::252     4e-64  50%  252 aa  HIS6_LACCB RecName: Full=Imidazole glycerol phosphate synthase
    2::252     4e-64  50%  252 aa  HIS6_LACC3 RecName: Full=Imidazole glycerol phosphate synthase
    2::269     4e-64  51%  270 aa  HIS6_HALWD RecName: Full=Imidazole glycerol phosphate synthase
    2::250     4e-64  51%  251 aa  HIS6_FLAJ1 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-64  48%  259 aa  HIS6_DESOH RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-64  47%  260 aa  HIS6_DESAA RecName: Full=Imidazole glycerol phosphate synthase
    2::250     4e-64  51%  253 aa  HIS6_ACIC5 RecName: Full=Imidazole glycerol phosphate synthase
    1::253     1e-63  48%  254 aa  HIS6_LEUMM RecName: Full=Imidazole glycerol phosphate synthase
    2::250     1e-63  48%  251 aa  HIS6_FLAPJ RecName: Full=Imidazole glycerol phosphate synthase
    2::253     1e-63  53%  257 aa  HIS6_PROMA RecName: Full=Imidazole glycerol phosphate synthase
    2::250     1e-63  50%  251 aa  HIS6_PELLD RecName: Full=Imidazole glycerol phosphate synthase
    4::254     1e-63  50%  257 aa  HIS6_OLICO RecName: Full=Imidazole glycerol phosphate synthase
    2::265     1e-63  47%  266 aa  HIS6_NITMS RecName: Full=Imidazole glycerol phosphate synthase
    2::250     1e-63  49%  251 aa  HIS6_CYTH3 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     1e-63  50%  251 aa  HIS6_CHLPB RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-63  51%  276 aa  HIS6_BEII9 RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-63  51%  252 aa  HIS6_BACSU RecName: Full=Imidazole glycerol phosphate synthase
    2::250     2e-63  51%  253 aa  HIS6_MYXXD RecName: Full=Imidazole glycerol phosphate synthase
    2::252     2e-63  47%  259 aa  HIS6_LACLA RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-63  46%  259 aa  HIS6_DESAH RecName: Full=Imidazole glycerol phosphate synthase
    2::250     2e-63  49%  251 aa  HIS6_CHLT3 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     2e-63  49%  251 aa  HIS6_CHLPD RecName: Full=Imidazole glycerol phosphate synthase
    5::252     3e-63  51%  252 aa  HIS6_BACA2 RecName: Full=Imidazole glycerol phosphate synthase
    3::254     9e-63  49%  256 aa  HIS6_LEPBL RecName: Full=Imidazole glycerol phosphate synthase
    3::254     9e-63  49%  256 aa  HIS6_LEPBJ RecName: Full=Imidazole glycerol phosphate synthase
    2::250     2e-62  49%  251 aa  HIS6_PROVI RecName: Full=Imidazole glycerol phosphate synthase
    2::273     2e-62  49%  274 aa  HIS6_METS3 RecName: Full=Imidazole glycerol phosphate synthase
    1::253     3e-62  52%  254 aa  HIS6_SYMTH RecName: Full=Imidazole glycerol phosphate synthase
    2::210     3e-62  58%  252 aa  HIS6_HYPNA RecName: Full=Imidazole glycerol phosphate synthase
    2::250     3e-62  50%  251 aa  HIS6_CHLP8 RecName: Full=Imidazole glycerol phosphate synthase
    4::254     3e-62  48%  255 aa  HIS6_LEPBP RecName: Full=Imidazole glycerol phosphate synthase
    4::254     3e-62  48%  255 aa  HIS6_LEPBA RecName: Full=Imidazole glycerol phosphate synthase
    2::250     3e-62  53%  251 aa  HIS6_BACV8 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     4e-62  45%  252 aa  HIS6_PETMO RecName: Full=Imidazole glycerol phosphate synthase
    5::252     6e-62  47%  254 aa  HIS6_STACT RecName: Full=Imidazole glycerol phosphate synthase
    2::250     6e-62  49%  251 aa  HIS6_CHLCH RecName: Full=Imidazole glycerol phosphate synthase
    5::250     6e-62  49%  253 aa  HIS6_ACIBL RecName: Full=Imidazole glycerol phosphate synthase
    2::250     8e-62  48%  251 aa  HIS6_NATTJ RecName: Full=Imidazole glycerol phosphate synthase
    2::273     8e-62  49%  274 aa  HIS6_METST RecName: Full=Imidazole glycerol phosphate synthase
    2::249     1e-61  55%  254 aa  HIS6_THEP1 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     1e-61  48%  251 aa  HIS6_PELPB RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-61  46%  259 aa  HIS6_DESMR RecName: Full=Imidazole glycerol phosphate synthase
    2::251     1e-61  49%  252 aa  HIS6_CLOD6 RecName: Full=Imidazole glycerol phosphate synthase
    2::250     4e-61  48%  251 aa  HIS6_CHLL2 RecName: Full=Imidazole glycerol phosphate synthase
    4::252     1e-60  51%  255 aa  HIS6_RHOPS RecName: Full=Imidazole glycerol phosphate synthase
    4::211     1e-60  53%  212 aa  HIS6_LEGPN RecName: Full=Imidazole glycerol phosphate synthase
    2::250     2e-60  49%  251 aa  HIS6_PARD8 RecName: Full=Imidazole glycerol phosphate synthase
    5::252     5e-60  44%  252 aa  HIS6_STAEQ RecName: Full=Imidazole glycerol phosphate synthase
    2::251     5e-60  51%  253 aa  HIS6_SILPO RecName: Full=Imidazole glycerol phosphate synthase
    2::246     7e-60  50%  270 aa  HIS6_SORC5 RecName: Full=Imidazole glycerol phosphate synthase
    2::206     7e-60  57%  258 aa  HIS6_METS4 RecName: Full=Imidazole glycerol phosphate synthase
    5::252     2e-59  44%  252 aa  HIS6_STAES RecName: Full=Imidazole glycerol phosphate synthase
    2::251     2e-59  47%  252 aa  HIS6_AZOPC RecName: Full=Imidazole glycerol phosphate synthase
    5::252     5e-59  44%  252 aa  HIS6_STAS1 RecName: Full=Imidazole glycerol phosphate synthase
    2::251     5e-59  49%  253 aa  HIS6_ROSDO RecName: Full=Imidazole glycerol phosphate synthase
    2::250     5e-59  48%  251 aa  HIS6_CHLTE RecName: Full=Imidazole glycerol phosphate synthase
    5::252     7e-58  44%  252 aa  HIS6_STAAR RecName: Full=Imidazole glycerol phosphate synthase
    5::252     7e-58  44%  252 aa  HIS6_STAAB RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-57  44%  252 aa  HIS6_STAAN RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-57  44%  252 aa  HIS6_STAAM RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-57  44%  252 aa  HIS6_STAA9 RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-57  44%  252 aa  HIS6_STAA2 RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-57  44%  252 aa  HIS6_STAA1 RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-56  43%  252 aa  HIS6_STAAW RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-56  43%  252 aa  HIS6_STAAT RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-56  43%  252 aa  HIS6_STAAS RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-56  43%  252 aa  HIS6_STAAE RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-56  43%  252 aa  HIS6_STAAC RecName: Full=Imidazole glycerol phosphate synthase
    5::252     1e-56  43%  252 aa  HIS6_STAA3 RecName: Full=Imidazole glycerol phosphate synthase
    5::250     1e-56  50%  251 aa  HIS6_METS5 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-53  45%  257 aa  HIS61_VIBVY RecName: Full=Imidazole glycerol phosphate synthase
    2::256     5e-53  45%  257 aa  HIS6_VIBPA RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-52  45%  257 aa  HIS6_VIBHB RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-52  45%  257 aa  HIS6_VIBVU RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-52  45%  257 aa  HIS6_VIBSL RecName: Full=Imidazole glycerol phosphate synthase
    2::254     2e-52  44%  255 aa  HIS6_CAMJ8 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-52  45%  257 aa  HIS6_VIBCM RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-52  45%  257 aa  HIS6_VIBCH RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-52  45%  257 aa  HIS6_VIBC3 RecName: Full=Imidazole glycerol phosphate synthase
    2::255     5e-52  47%  258 aa  HIS6_XANCP RecName: Full=Imidazole glycerol phosphate synthase
    2::255     5e-52  47%  258 aa  HIS6_XANC8 RecName: Full=Imidazole glycerol phosphate synthase
    2::254     5e-52  43%  255 aa  HIS6_CAMJD RecName: Full=Imidazole glycerol phosphate synthase
    2::255     7e-52  47%  258 aa  HIS6_XANOR RecName: Full=Imidazole glycerol phosphate synthase
    2::255     7e-52  47%  258 aa  HIS6_XANOM RecName: Full=Imidazole glycerol phosphate synthase
    2::255     7e-52  47%  258 aa  HIS6_XANC5 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     7e-52  44%  258 aa  HIS6_ECO81 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     7e-52  45%  258 aa  HIS6_CITK8 RecName: Full=Imidazole glycerol phosphate synthase
    2::255     9e-52  47%  258 aa  HIS6_XANCB RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ESCF3 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ECOSM RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ECOLI RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ECODH RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ECOBW RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ECO7I RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ECO5E RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ECO57 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ECO45 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-52  44%  258 aa  HIS6_ECO27 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-51  44%  258 aa  HIS6_SHIDS RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-51  44%  258 aa  HIS6_SHIBS RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-51  44%  258 aa  HIS6_ECOLU RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-51  44%  258 aa  HIS6_PECCP RecName: Full=Imidazole glycerol phosphate synthase
    2::255     2e-51  47%  258 aa  HIS6_XANAC RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-51  45%  258 aa  HIS6_ENT38 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-51  44%  258 aa  HIS6_ECOK1 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-51  44%  258 aa  HIS6_SHISS RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-51  44%  258 aa  HIS6_ECOUT RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-51  44%  258 aa  HIS6_ECOL6 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-51  44%  258 aa  HIS6_ECOL5 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-51  44%  258 aa  HIS6_ECOHS RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-51  44%  258 aa  HIS6_ECO55 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-51  44%  258 aa  HIS6_SERP5 RecName: Full=Imidazole glycerol phosphate synthase
    2::254     5e-51  43%  255 aa  HIS6_CAMJR RecName: Full=Imidazole glycerol phosphate synthase
    2::254     5e-51  43%  255 aa  HIS61_CAMJE RecName: Full=Imidazole glycerol phosphate synthase
    2::256     6e-51  44%  258 aa  HIS6_SHIB3 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     6e-51  44%  258 aa  HIS6_ECOSE RecName: Full=Imidazole glycerol phosphate synthase
    2::256     6e-51  44%  258 aa  HIS6_ECOLC RecName: Full=Imidazole glycerol phosphate synthase
    2::256     6e-51  44%  258 aa  HIS6_ECO8A RecName: Full=Imidazole glycerol phosphate synthase
    2::256     8e-51  44%  258 aa  HIS6_ERWCT RecName: Full=Imidazole glycerol phosphate synthase
    2::254     8e-51  43%  255 aa  HIS6_CAMLR RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  44%  258 aa  HIS6_ECO24 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALTY RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALTI RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALPK RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALPC RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALPB RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALPA RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALNS RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALHS RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALG2 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALEP RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  45%  258 aa  HIS6_SALDC RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-50  44%  258 aa  HIS6_KLEP7 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-50  44%  258 aa  HIS6_SALCH RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-50  44%  258 aa  HIS6_SALAR RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-50  44%  258 aa  HIS6_KLEOX RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-50  43%  258 aa  HIS6_COLP3 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-50  44%  258 aa  HIS6_SHIFL RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-50  44%  258 aa  HIS6_SHIF8 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-50  44%  258 aa  HIS6_KLEP3 RecName: Full=Imidazole glycerol phosphate synthase
    2::216     3e-50  49%  257 aa  HIS6_VIBFM RecName: Full=Imidazole glycerol phosphate synthase
    2::216     3e-50  49%  257 aa  HIS6_ALISL RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-50  45%  258 aa  HIS6_SALSV RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-50  43%  270 aa  HIS6_ALTMD RecName: Full=Imidazole glycerol phosphate synthase
    2::216     5e-50  49%  257 aa  HIS6_VIBF1 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     7e-50  44%  257 aa  HIS6_TOLAT RecName: Full=Imidazole glycerol phosphate synthase
    2::256     7e-50  43%  257 aa  HIS6_PHOPR RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-49  44%  258 aa  HIS6_SALA4 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-49  43%  258 aa  HIS6_ENTS8 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-49  43%  257 aa  HIS6_ACTP7 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     7e-49  43%  257 aa  HIS6_PROMH RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-48  44%  258 aa  HIS6_EDWI9 RecName: Full=Imidazole glycerol phosphate synthase
    2::255     1e-48  43%  257 aa  HIS6_XYLFT RecName: Full=Imidazole glycerol phosphate synthase
    2::255     1e-48  43%  257 aa  HIS6_XYLFM RecName: Full=Imidazole glycerol phosphate synthase
    2::255     1e-48  43%  257 aa  HIS6_XYLF2 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-48  41%  258 aa  HIS6_BAUCH RecName: Full=Imidazole glycerol phosphate synthase
    2::255     5e-48  43%  257 aa  HIS6_XYLFA RecName: Full=Imidazole glycerol phosphate synthase
    2::256     6e-48  42%  258 aa  HIS6_PHOLL RecName: Full=Imidazole glycerol phosphate synthase
    2::256     6e-48  42%  265 aa  HIS6_IDILO RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-47  43%  258 aa  HIS6_YERPS RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-47  43%  258 aa  HIS6_YERPB RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-47  44%  256 aa  HIS6_PASMU RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-47  45%  257 aa  HIS6_ACTSZ RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-47  43%  258 aa  HIS6_YERPP RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-47  43%  258 aa  HIS6_YERPN RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-47  43%  258 aa  HIS6_YERPE RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-47  43%  258 aa  HIS6_YERPA RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-47  43%  258 aa  HIS6_YERP3 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-47  42%  258 aa  HIS6_YERE8 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-47  42%  257 aa  HIS6_SHEFN RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-47  43%  257 aa  HIS6_PSEA6 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-47  43%  258 aa  HIS6_YERPY RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-47  45%  257 aa  HIS6_MANSM RecName: Full=Imidazole glycerol phosphate synthase
    2::256     5e-47  40%  258 aa  HIS6_BUCAP RecName: Full=Imidazole glycerol phosphate synthase
    2::256     7e-47  41%  257 aa  HIS6_SHEON RecName: Full=Imidazole glycerol phosphate synthase
    2::256     7e-47  42%  257 aa  HIS6_PSYIN RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-47  41%  257 aa  HIS6_SHESR RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-47  41%  257 aa  HIS6_SHESM RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-47  41%  257 aa  HIS6_SHESA RecName: Full=Imidazole glycerol phosphate synthase
    2::256     9e-47  44%  258 aa  HIS6_BUCBP RecName: Full=Imidazole glycerol phosphate synthase
    2::216     2e-46  50%  258 aa  HIS6_HAEIN RecName: Full=Imidazole glycerol phosphate synthase
    2::216     2e-46  50%  258 aa  HIS6_HAEI8 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-46  42%  257 aa  HIS6_SHEWM RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-46  42%  257 aa  HIS6_SHELP RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-46  42%  257 aa  HIS6_AERHH RecName: Full=Imidazole glycerol phosphate synthase
    2::216     6e-46  49%  258 aa  HIS6_HAEIE RecName: Full=Imidazole glycerol phosphate synthase
    2::256     8e-46  47%  257 aa  HIS6_SHEPW RecName: Full=Imidazole glycerol phosphate synthase
    2::256     8e-46  42%  257 aa  HIS6_AERS4 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-45  39%  257 aa  HIS6_SHEPA RecName: Full=Imidazole glycerol phosphate synthase
    2::254     2e-45  40%  257 aa  HIS6_FRAP2 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     2e-45  41%  257 aa  HIS6_SHESH RecName: Full=Imidazole glycerol phosphate synthase
    2::256     5e-45  42%  257 aa  HIS6_SHEHH RecName: Full=Imidazole glycerol phosphate synthase
    2::256     5e-45  39%  258 aa  HIS6_BLOPB RecName: Full=Imidazole glycerol phosphate synthase
    2::256     5e-45  40%  258 aa  HIS6_BLOFL RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-44  43%  258 aa  HIS6_SODGM RecName: Full=Imidazole glycerol phosphate synthase
    2::216     3e-43  42%  258 aa  HIS6_BUCAI RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-42  39%  257 aa  HIS6_SHEPC RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-42  39%  257 aa  HIS6_SHEB9 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-42  39%  257 aa  HIS6_SHEB8 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     4e-42  39%  257 aa  HIS6_SHEB2 RecName: Full=Imidazole glycerol phosphate synthase
    2::254     7e-42  40%  255 aa  HIS6_MARMM RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-41  38%  257 aa  HIS6_SHESW RecName: Full=Imidazole glycerol phosphate synthase
    2::255     3e-41  39%  258 aa  HIS6_STRMK RecName: Full=Imidazole glycerol phosphate synthase
    2::256     3e-41  38%  257 aa  HIS6_SHEB5 RecName: Full=Imidazole glycerol phosphate synthase
    5::208     3e-41  41%  251 aa  HIS62_PSEAE RecName: Full=Putative imidazole glycerol phosphate
    2::255     4e-41  39%  258 aa  HIS6_STRM5 RecName: Full=Imidazole glycerol phosphate synthase
    2::256     7e-41  38%  259 aa  HIS6_SHEAM RecName: Full=Imidazole glycerol phosphate synthase
    2::246     2e-40  40%  248 aa  HIS62_CAMJJ RecName: Full=Putative imidazole glycerol phosphate
    2::210     3e-40  37%  254 aa  HIS62_LEPIN RecName: Full=Putative imidazole glycerol phosphate
  232::547     6e-40  43%  553 aa  HIS5_EMENI RecName: Full=Imidazole glycerol phosphate synthase
    2::256     1e-39  37%  257 aa  HIS6_SHEDO RecName: Full=Imidazole glycerol phosphate synthase
    2::246     2e-39  40%  248 aa  HIS62_CAMJE RecName: Full=Putative imidazole glycerol phosphate
    2::216     4e-39  39%  257 aa  HIS6_PSEHT RecName: Full=Imidazole glycerol phosphate synthase
    7::215     5e-39  38%  260 aa  HIS63_VIBVY RecName: Full=Putative imidazole glycerol phosphate
  228::500     2e-38  47%  541 aa  HIS5_SCHPO RecName: Full=Imidazole glycerol phosphate synthase
    2::211     3e-38  34%  254 aa  HIS6_LEPBO RecName: Full=Putative imidazole glycerol phosphate
  280::591     6e-38  43%  592 aa  HIS5_ARATH RecName: Full=Imidazole glycerol phosphate synthase
  236::548     1e-36  43%  552 aa  HIS5_YEAST RecName: Full=Imidazole glycerol phosphate synthase
    5::208     2e-34  38%  272 aa  HIS62_VIBVY RecName: Full=Putative imidazole glycerol phosphate
   31::258     2e-33  34%  261 aa  HIS62_PROMM RecName: Full=Putative imidazole glycerol phosphate
    8::211     8e-32  38%  244 aa  HIS4_DEHSC RecName:
    1::204     4e-31  37%  237 aa  HIS4_DEHE1 RecName:
    1::197     2e-29  34%  236 aa  HIS4_METLZ RecName:
    5::206     2e-28  34%  242 aa  HIS4_METTP RecName:
    3::231     2e-28  30%  237 aa  HIS4_METST RecName:
    1::209     2e-28  36%  246 aa  HIS4_METBU RecName:
    8::238     6e-28  39%  242 aa  HIS4_HALSA RecName:
    1::202     2e-27  34%  256 aa  HIS4_SYNY3 RecName:
    1::206     4e-27  31%  240 aa  HIS4_UNCMA RecName:
    3::204     5e-26  30%  238 aa  HIS4_METM7 RecName:
    3::202     7e-26  31%  239 aa  HIS4_METTH RecName:
    3::204     9e-26  30%  238 aa  HIS4_METM6 RecName:
    3::204     9e-26  29%  238 aa  HIS4_METM5 RecName:
    5::208     1e-25  35%  261 aa  HIS4_SYNJB RecName:
    1::236     2e-25  30%  236 aa  HIS4_METB6 RecName:
    2::206     2e-25  32%  245 aa  HIS4_ERWCT RecName:
    2::206     3e-25  32%  245 aa  HIS4_PECCP RecName:
    3::204     3e-25  29%  241 aa  HIS4_METMP RecName:
    3::202     3e-25  32%  257 aa  HIS4_ACAM1 RecName:
    3::203     6e-25  36%  259 aa  HIS4_PELTS RecName:
    1::209     6e-25  31%  245 aa  HIS4_METAC RecName:
    1::199     1e-24  32%  237 aa  HIS4_HALOH RecName:
    3::202     1e-24  35%  255 aa  HIS4_GLOVI RecName:
    1::195     1e-24  33%  257 aa  HIS4_CYAP7 RecName:
    3::202     1e-24  30%  257 aa  HIS4_ANASP RecName:
    3::198     2e-24  31%  240 aa  HIS4_OCEIH RecName:
    3::202     2e-24  30%  257 aa  HIS4_ANAVT RecName:
    1::209     2e-24  31%  246 aa  HIS4_METMA RecName:
    4::203     3e-24  31%  258 aa  HIS4_SALRD RecName:
    3::202     3e-24  30%  255 aa  HIS4_PROMS RecName:
    1::200     4e-24  35%  252 aa  HIS4_SYNR3 RecName:
    2::209     4e-24  31%  245 aa  HIS4_SALAR RecName:
    1::232     5e-24  28%  240 aa  HIS4_LISW6 RecName:
    1::202     6e-24  32%  235 aa  HIS4_THET8 RecName:
    1::237     6e-24  29%  237 aa  HIS4_ROSS1 RecName:
    1::202     8e-24  29%  255 aa  HIS4_PROM0 RecName:
    1::204     8e-24  33%  241 aa  HIS4_CHLAD RecName:
    2::208     8e-24  31%  245 aa  HIS41_PHOLL RecName:
    1::202     1e-23  31%  257 aa  HIS4_TRIEI RecName:
    1::202     1e-23  29%  255 aa  HIS4_PROM9 RecName:
    7::237     1e-23  34%  239 aa  HIS4_NATPD RecName:
    3::204     1e-23  27%  242 aa  HIS4_METVO RecName:
    2::208     1e-23  30%  245 aa  HIS4_ALTMD RecName:
    1::202     2e-23  29%  255 aa  HIS4_PROMP RecName:
    3::198     2e-23  31%  257 aa  HIS4_NOSP7 RecName:
    1::202     4e-23  29%  255 aa  HIS4_PROM5 RecName:
    1::202     4e-23  31%  255 aa  HIS4_PROM4 RecName:
    1::200     4e-23  28%  236 aa  HIS4_METPE RecName:
    2::209     5e-23  32%  245 aa  HIS4_ERWT9 RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERPY RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERPS RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERPP RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERPN RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERPG RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERPE RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERPB RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERPA RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERP3 RecName:
    2::209     7e-23  31%  245 aa  HIS4_YERE8 RecName:
    3::194     7e-23  33%  257 aa  HIS4_CYAA5 RecName:
    3::203     1e-22  30%  256 aa  HIS4_SYNFM RecName:
    1::204     1e-22  31%  237 aa  HIS4_ROSCS RecName:
    1::202     1e-22  28%  249 aa  HIS4_MAGSM RecName:
    2::209     2e-22  30%  245 aa  HIS4_SERP5 RecName:
    2::209     2e-22  30%  245 aa  HIS4_PROMH RecName:
    1::195     2e-22  31%  253 aa  HIS4_MICAN RecName:
    1::201     2e-22  29%  240 aa  HIS4_LISMF RecName:
    3::204     2e-22  34%  246 aa  HIS4_HALHL RecName:
    1::202     2e-22  32%  236 aa  HIS4_NITMS RecName:
    1::204     2e-22  30%  248 aa  HIS4_ALHEH RecName:
    1::201     3e-22  29%  240 aa  HIS4_LISMC RecName:
   42::212     5e-22  35%  269 aa  HIS62_SYNPX RecName: Full=Putative imidazole glycerol phosphate
    2::209     5e-22  29%  245 aa  HIS4_VIBF1 RecName:
    4::205     5e-22  31%  249 aa  HIS4_NITWN RecName:
    1::245     5e-22  24%  246 aa  HIS4_LACLS RecName:
    5::206     5e-22  30%  246 aa  HIS4_COREF RecName:
    1::197     5e-22  36%  234 aa  HIS4_CENSY RecName:
    3::183     6e-22  36%  256 aa  HIS4_SYNP6 RecName:
    3::183     6e-22  36%  256 aa  HIS4_SYNE7 RecName:
    6::212     6e-22  28%  249 aa  HIS4_ACTSZ RecName:
    3::203     8e-22  29%  237 aa  HIS4_THEP3 RecName:
    5::204     8e-22  32%  261 aa  HIS4_SYNJA RecName:
    3::203     8e-22  28%  244 aa  HIS4_GEOSL RecName:
    2::209     8e-22  30%  245 aa  HIS4_ALISL RecName:
    2::209     1e-21  29%  245 aa  HIS4_VIBFM RecName:
    2::208     1e-21  29%  261 aa  HIS4_COLP3 RecName:
    3::209     1e-21  30%  243 aa  HIS4_CAMJJ RecName:
    3::203     1e-21  29%  237 aa  HIS4_CLOTH RecName:
    1::202     2e-21  32%  235 aa  HIS4_THET2 RecName:
    1::202     2e-21  31%  256 aa  HIS4_SYNS3 RecName:
    3::204     2e-21  26%  238 aa  HIS4_METVA RecName:
   12::212     2e-21  30%  243 aa  HIS4_DEIGD RecName:
    5::206     2e-21  30%  246 aa  HIS4_CORGL RecName:
    3::203     2e-21  27%  236 aa  HIS4_CLOCE RecName:
    3::209     2e-21  30%  243 aa  HIS4_CAMJE RecName:
    2::208     2e-21  30%  245 aa  HIS4_VIBCH RecName:
    3::204     2e-21  26%  238 aa  HIS4_METVS RecName:
    3::197     2e-21  33%  236 aa  HIS4_METHJ RecName:
    1::232     2e-21  25%  240 aa  HIS4_LISIN RecName:
    7::203     2e-21  32%  238 aa  HIS4_DEIRA RecName:
    1::204     2e-21  26%  239 aa  HIS4_CLOPH RecName:
    3::209     2e-21  30%  244 aa  HIS4_CAMJ8 RecName:
    1::203     2e-21  30%  239 aa  HIS4_BACCR RecName:
    2::208     3e-21  29%  245 aa  HIS4_VIBPA RecName:
    1::203     3e-21  28%  244 aa  HIS4_THEYD RecName:
    3::199     3e-21  31%  245 aa  HIS4_TERTT RecName:
    3::203     3e-21  31%  243 aa  HIS4_PELCD RecName:
    3::202     3e-21  29%  246 aa  HIS4_NITHX RecName:
    3::203     3e-21  27%  238 aa  HIS4_CLOK5 RecName:
    3::203     3e-21  27%  238 aa  HIS4_CLOK1 RecName:
    1::176     3e-21  33%  241 aa  HIS4_CHLSY RecName:
    1::176     3e-21  33%  241 aa  HIS4_CHLAA RecName:
    1::202     4e-21  27%  256 aa  HIS4_PROM1 RecName:
    1::201     4e-21  29%  240 aa  HIS4_LISMO RecName:
    1::245     4e-21  23%  246 aa  HIS4_LACLM RecName:
    3::195     4e-21  32%  257 aa  HIS4_CYAP8 RecName:
    6::213     5e-21  28%  249 aa  HIS4_MANSM RecName:
    1::203     5e-21  29%  239 aa  HIS4_BACHK RecName:
    1::203     5e-21  29%  239 aa  HIS4_BACC2 RecName:
    1::203     5e-21  29%  239 aa  HIS4_BACAN RecName:
    1::203     5e-21  29%  239 aa  HIS4_BACAC RecName:
    1::203     5e-21  29%  239 aa  HIS4_BACAA RecName:
    1::202     7e-21  26%  256 aa  HIS4_PROMT RecName:
    5::212     7e-21  27%  249 aa  HIS4_PASMU RecName:
    1::200     7e-21  26%  239 aa  HIS4_LACLA RecName:
    3::203     7e-21  28%  244 aa  HIS4_GEOMG RecName:
    2::209     7e-21  30%  247 aa  HIS4_AERHH RecName:
    7::206     9e-21  29%  242 aa  HIS4_GRABC RecName:
    3::202     9e-21  28%  245 aa  HIS4_GEOSF RecName:
    3::203     9e-21  27%  245 aa  HIS4_DESDG RecName:
    3::205     9e-21  30%  251 aa  HIS4_BURM1 RecName:
    1::203     9e-21  29%  239 aa  HIS4_BACC7 RecName:
    1::203     9e-21  29%  239 aa  HIS4_BACC0 RecName:
    2::208     1e-20  29%  245 aa  HIS4_VIBVY RecName:
    2::208     1e-20  29%  245 aa  HIS4_VIBVU RecName:
    3::203     1e-20  28%  245 aa  HIS4_PELPD RecName:
    3::202     1e-20  28%  237 aa  HIS4_METJA RecName:
    1::201     1e-20  28%  240 aa  HIS4_LISMH RecName:
    3::203     1e-20  30%  245 aa  HIS4_HELMI RecName:
    3::203     1e-20  28%  243 aa  HIS4_GEOBB RecName:
    2::209     1e-20  31%  245 aa  HIS4_EDWI9 RecName:
    3::203     1e-20  28%  250 aa  HIS4_DESAA RecName:
    2::235     1e-20  25%  239 aa  HIS4_BACV8 RecName:
    1::203     1e-20  29%  239 aa  HIS4_BACC4 RecName:
    2::208     1e-20  29%  245 aa  HIS4_VIBHB RecName:
    3::199     1e-20  30%  243 aa  HIS4_SACD2 RecName:
    3::199     1e-20  29%  256 aa  HIS4_PELLD RecName:
    3::203     1e-20  27%  245 aa  HIS4_GEOUR RecName:
    1::202     2e-20  30%  256 aa  HIS4_SYNPW RecName:
    1::202     2e-20  29%  256 aa  HIS4_SYNP2 RecName:
    2::209     2e-20  30%  244 aa  HIS4_PSEA6 RecName:
    7::207     2e-20  32%  246 aa  HIS4_HALMA RecName:
    1::203     2e-20  28%  239 aa  HIS4_BACCQ RecName:
    3::198     2e-20  28%  237 aa  HIS4_ALKMQ RecName:
   14::203     2e-20  31%  245 aa  HIS4_RHOPS RecName:
    3::200     2e-20  30%  248 aa  HIS4_METPP RecName:
    3::202     2e-20  29%  257 aa  HIS4_CYAP4 RecName:
    3::200     2e-20  31%  251 aa  HIS4_BURCM RecName:
    3::200     2e-20  31%  251 aa  HIS4_BURA4 RecName:
    1::203     2e-20  28%  239 aa  HIS4_BACWK RecName:
    2::209     3e-20  30%  245 aa  HIS4_SHEAM RecName:
    3::204     3e-20  29%  243 aa  HIS4_RUTMC RecName:
    2::206     3e-20  29%  244 aa  HIS4_PHOPR RecName:
    3::203     3e-20  32%  262 aa  HIS4_DESAP RecName:
    3::200     3e-20  31%  251 aa  HIS4_BURTA RecName:
    2::208     3e-20  29%  248 aa  HIS4_AERS4 RecName:
    7::214     3e-20  27%  250 aa  HIS4_ACTPJ RecName:
    3::203     4e-20  31%  243 aa  HIS4_MOOTA RecName:
    4::202     4e-20  30%  237 aa  HIS4_GEMAT RecName:
    4::204     4e-20  33%  245 aa  HIS4_FRAAA RecName:
    3::200     4e-20  30%  251 aa  HIS4_BURS3 RecName:
    1::203     4e-20  28%  239 aa  HIS4_BACC3 RecName:
    1::203     4e-20  28%  239 aa  HIS4_BACC1 RecName:
    1::203     4e-20  28%  239 aa  HIS4_BACAH RecName:
    7::214     4e-20  27%  250 aa  HIS4_ACTP7 RecName:
    3::203     6e-20  28%  242 aa  HIS4_SYNAS RecName:
    1::209     6e-20  29%  245 aa  HIS4_METBF RecName:
    3::200     6e-20  30%  250 aa  HIS4_BURPP RecName:
    7::214     6e-20  27%  250 aa  HIS4_ACTP2 RecName:
    3::199     7e-20  33%  246 aa  HIS4_THICR RecName:
    3::199     7e-20  31%  247 aa  HIS4_PSEU5 RecName:
    3::199     7e-20  28%  245 aa  HIS4_PSEE4 RecName:
    3::199     7e-20  30%  245 aa  HIS4_PSEAE RecName:
    3::199     7e-20  30%  245 aa  HIS4_PSEAB RecName:
    3::199     7e-20  30%  245 aa  HIS4_PSEA8 RecName:
    3::199     7e-20  30%  245 aa  HIS4_PSEA7 RecName:
   10::209     7e-20  29%  245 aa  HIS4_HALWD RecName:
    3::204     7e-20  28%  247 aa  HIS4_DIAST RecName:
    1::205     7e-20  26%  250 aa  HIS4_DESHD RecName:
    3::200     7e-20  30%  251 aa  HIS4_BURVG RecName:
    1::203     7e-20  28%  239 aa  HIS4_BACCZ RecName:
    2::208     9e-20  30%  245 aa  HIS4_TOLAT RecName:
    2::209     9e-20  31%  246 aa  HIS4_SODGM RecName:
    6::206     9e-20  29%  245 aa  HIS4_GEOTN RecName:
   14::202     9e-20  29%  241 aa  HIS4_CAUSK RecName:
    3::209     9e-20  29%  244 aa  HIS4_CAMJD RecName:
    3::200     9e-20  31%  250 aa  HIS4_BURP8 RecName:
    1::207     1e-19  29%  239 aa  HIS4_SULSY RecName:
    3::199     1e-19  28%  245 aa  HIS4_PSEPK RecName:
    3::199     1e-19  28%  245 aa  HIS4_PSEP1 RecName:
    3::203     1e-19  29%  245 aa  HIS4_GEOLS RecName:
    5::206     1e-19  29%  242 aa  HIS4_CORDI RecName:
    3::200     1e-19  29%  247 aa  HIS4_ACISJ RecName:
    3::203     2e-19  27%  243 aa  HIS4_GEOSM RecName:
   32::202     2e-19  29%  241 aa  HIS4_CAUCR RecName:
    3::200     2e-19  29%  251 aa  HIS4_BURCJ RecName:
    3::200     2e-19  29%  251 aa  HIS4_BURCH RecName:
    3::200     2e-19  29%  251 aa  HIS4_BURCC RecName:
    3::200     2e-19  29%  251 aa  HIS4_BURCA RecName:
    3::200     2e-19  28%  245 aa  HIS4_VEREI RecName:
    3::199     2e-19  28%  245 aa  HIS4_PSEPG RecName:
    3::199     2e-19  30%  245 aa  HIS4_PSEMY RecName:
    3::203     2e-19  27%  243 aa  HIS4_PARL1 RecName:
    3::198     2e-19  25%  239 aa  HIS4_CLOAB RecName:
    3::209     2e-19  28%  243 aa  HIS4_CAMJR RecName:
    5::205     2e-19  29%  249 aa  HIS4_BREBN RecName:
    1::236     3e-19  24%  239 aa  HIS4_STRTD RecName:
    1::201     3e-19  33%  241 aa  HIS4_SALAI RecName:
   14::203     3e-19  29%  245 aa  HIS4_RHOP2 RecName:
    3::199     3e-19  29%  245 aa  HIS4_PSEU2 RecName:
    1::179     3e-19  33%  239 aa  HIS4_METMJ RecName:
    3::200     3e-19  29%  249 aa  HIS4_LEPCP RecName:
    3::204     3e-19  26%  240 aa  HIS4_CLOB8 RecName:
    3::200     3e-19  30%  250 aa  HIS4_BURXL RecName:
    3::200     3e-19  30%  251 aa  HIS4_BURPS RecName:
    3::200     3e-19  30%  251 aa  HIS4_BURP6 RecName:
    3::200     3e-19  30%  251 aa  HIS4_BURP1 RecName:
    3::200     3e-19  30%  251 aa  HIS4_BURP0 RecName:
    3::200     3e-19  30%  251 aa  HIS4_BURMS RecName:
    3::200     3e-19  30%  251 aa  HIS4_BURMA RecName:
    3::200     3e-19  30%  251 aa  HIS4_BURM9 RecName:
    3::200     3e-19  30%  251 aa  HIS4_BURM7 RecName:
   14::203     3e-19  30%  247 aa  HIS4_BRASB RecName:
    5::202     4e-19  29%  236 aa  HIS4_RHOCA RecName:
    3::199     4e-19  28%  245 aa  HIS4_PSEPW RecName:
    3::199     4e-19  29%  245 aa  HIS4_PSE14 RecName:
    3::206     4e-19  28%  245 aa  HIS4_GEOKA RecName:
    7::213     4e-19  27%  258 aa  HIS4_CORJK RecName:
    3::200     4e-19  28%  248 aa  HIS4_ACIAC RecName:
    3::202     5e-19  28%  257 aa  HIS4_THEEB RecName:
    2::209     5e-19  28%  245 aa  HIS4_SALTY RecName:
    2::209     5e-19  28%  245 aa  HIS4_SALSV RecName:
    2::209     5e-19  28%  245 aa  HIS4_SALPB RecName:
    2::209     5e-19  28%  245 aa  HIS4_SALHS RecName:
    3::203     5e-19  27%  248 aa  HIS4_RHIE6 RecName:
    3::202     5e-19  29%  246 aa  HIS4_METSB RecName:
    3::199     5e-19  27%  243 aa  HIS4_CELJU RecName:
    3::203     5e-19  25%  237 aa  HIS4_CALS8 RecName:
    3::206     5e-19  27%  248 aa  HIS4_BRAJA RecName:
    3::202     6e-19  33%  244 aa  HIS4_THERP RecName:
    5::198     6e-19  30%  239 aa  HIS4_ROSDO RecName:
    3::199     6e-19  28%  245 aa  HIS4_PSEF5 RecName:
    3::200     6e-19  29%  246 aa  HIS4_POLNA RecName:
    3::199     6e-19  29%  245 aa  HIS4_MARAV RecName:
    2::209     6e-19  29%  245 aa  HIS4_ESCF3 RecName:
    1::204     6e-19  24%  240 aa  HIS4_BACSK RecName:
    3::199     8e-19  28%  243 aa  HIS4_VESOH RecName:
    1::235     8e-19  23%  239 aa  HIS4_STRMU RecName:
    1::206     8e-19  32%  243 aa  HIS4_SACEN RecName:
   31::203     8e-19  28%  245 aa  HIS4_RHOPB RecName:
    1::204     8e-19  30%  255 aa  HIS4_PROAC RecName:
    3::205     8e-19  28%  257 aa  HIS4_NITMU RecName:
    2::234     8e-19  24%  238 aa  HIS4_LEUMM RecName:
    1::237     1e-18  23%  242 aa  HIS4_STRSV RecName:
    1::199     1e-18  35%  244 aa  HIS4_NOCSJ RecName:
    3::199     1e-18  27%  262 aa  HIS4_CHLT3 RecName:
    5::203     1e-18  28%  240 aa  HIS42_SILST RecName:
    3::205     1e-18  28%  245 aa  HIS4_XANP2 RecName:
    3::200     1e-18  28%  247 aa  HIS4_VARPS RecName:
    3::199     1e-18  28%  245 aa  HIS4_PSESM RecName:
    3::204     1e-18  25%  238 aa  HIS4_METTL RecName:
    3::200     1e-18  26%  241 aa  HIS4_META3 RecName:
    5::202     1e-18  28%  244 aa  HIS4_MESSB RecName:
    1::200     1e-18  26%  241 aa  HIS4_GRAFK RecName:
    2::209     1e-18  28%  245 aa  HIS4_ECOHS RecName:
    2::209     1e-18  28%  245 aa  HIS4_ECO81 RecName:
    2::209     1e-18  28%  245 aa  HIS4_ECO55 RecName:
    2::209     1e-18  28%  245 aa  HIS4_ECO24 RecName:
    3::203     1e-18  30%  242 aa  HIS4_DESAD RecName:
    3::199     1e-18  28%  246 aa  HIS4_ALCBS RecName:
    2::209     2e-18  28%  245 aa  HIS4_SALPK RecName:
    2::209     2e-18  28%  245 aa  HIS4_SALPA RecName:
    2::209     2e-18  28%  245 aa  HIS4_SALNS RecName:
    2::209     2e-18  28%  245 aa  HIS4_SALDC RecName:
    3::200     2e-18  28%  246 aa  HIS4_POLSJ RecName:
    3::206     2e-18  28%  248 aa  HIS4_OLICO RecName:
    2::208     2e-18  29%  245 aa  HIS4_ECOLC RecName:
    3::203     2e-18  32%  238 aa  HIS4_ANADF RecName:
    3::209     2e-18  29%  246 aa  HIS4_SHIDS RecName:
    2::210     2e-18  29%  245 aa  HIS4_SHEFN RecName:
    2::209     2e-18  27%  245 aa  HIS4_SALTI RecName:
    2::209     2e-18  27%  245 aa  HIS4_SALG2 RecName:
    2::209     2e-18  27%  245 aa  HIS4_SALEP RecName:
    3::200     2e-18  30%  246 aa  HIS4_RHOFD RecName:
    3::203     2e-18  26%  248 aa  HIS4_RHIL3 RecName:
    1::235     2e-18  24%  240 aa  HIS4_FLAJ1 RecName:
    2::208     2e-18  29%  245 aa  HIS4_ECOLU RecName:
    2::208     2e-18  29%  245 aa  HIS4_ECO5E RecName:
    2::208     2e-18  29%  245 aa  HIS4_ECO57 RecName:
    2::208     2e-18  29%  245 aa  HIS4_ECO45 RecName:
    2::208     2e-18  29%  245 aa  HIS4_ECO27 RecName:
    3::204     2e-18  24%  237 aa  HIS4_CLOBA RecName:
    6::207     2e-18  26%  244 aa  HIS4_BACHD RecName:
    9::208     2e-18  29%  247 aa  HIS4_ARTAT RecName:
    5::203     2e-18  30%  240 aa  HIS41_SILPO RecName:
    3::203     3e-18  26%  248 aa  HIS4_RHILW RecName:
    3::202     3e-18  27%  248 aa  HIS4_RHIEC RecName:
    3::199     3e-18  28%  245 aa  HIS4_PSEPF RecName:
    3::199     3e-18  27%  256 aa  HIS4_PROVI RecName:
    3::200     3e-18  27%  247 aa  HIS4_METFK RecName:
    3::199     3e-18  28%  244 aa  HIS4_HAHCH RecName:
    3::203     3e-18  27%  249 aa  HIS4_DESVV RecName:
    3::203     3e-18  27%  249 aa  HIS4_DESVH RecName:
    3::200     3e-18  28%  246 aa  HIS4_DECAR RecName:
   14::203     3e-18  29%  244 aa  HIS4_BRASO RecName:
    3::204     3e-18  28%  251 aa  HIS4_AZOSB RecName:
    1::199     4e-18  32%  245 aa  HIS4_THEFY RecName:
    1::202     4e-18  29%  255 aa  HIS4_SYNSC RecName:
    2::204     4e-18  28%  245 aa  HIS4_SHEHH RecName:
    3::205     4e-18  28%  247 aa  HIS4_RALSO RecName:
    3::199     4e-18  28%  245 aa  HIS4_PSEFS RecName:
    3::233     4e-18  24%  235 aa  HIS4_NAUPA RecName:
    2::208     4e-18  28%  245 aa  HIS4_ECO7I RecName:
    2::208     5e-18  28%  245 aa  HIS4_SHIBS RecName:
    2::209     5e-18  28%  245 aa  HIS4_SHESM RecName:
    2::204     5e-18  29%  245 aa  HIS4_SHEPW RecName:
    2::209     5e-18  27%  245 aa  HIS4_SALPC RecName:
    2::209     5e-18  27%  245 aa  HIS4_SALCH RecName:
    7::203     5e-18  28%  246 aa  HIS4_PSYCK RecName:
    7::203     5e-18  28%  246 aa  HIS4_PSYA2 RecName:
    2::209     5e-18  28%  245 aa  HIS4_ECOK1 RecName:
    3::200     5e-18  28%  246 aa  HIS4_DELAS RecName:
    3::203     5e-18  27%  243 aa  HIS4_BRUSU RecName:
    3::199     5e-18  29%  245 aa  HIS4_AZOVD RecName:
   31::202     5e-18  30%  243 aa  HIS4_AZOC5 RecName:
    3::199     5e-18  30%  243 aa  HIS4_ACIBY RecName:
    3::199     5e-18  30%  243 aa  HIS4_ACIBT RecName:
    3::199     5e-18  30%  243 aa  HIS4_ACIBC RecName:
    3::199     5e-18  30%  243 aa  HIS4_ACIB5 RecName:
    3::199     5e-18  30%  243 aa  HIS4_ACIB3 RecName:
    3::200     7e-18  28%  251 aa  HIS4_THIDA RecName:
    3::209     7e-18  29%  246 aa  HIS4_SHISS RecName:
    2::208     7e-18  28%  245 aa  HIS4_SHIFL RecName:
    2::208     7e-18  28%  245 aa  HIS4_SHIF8 RecName:
    2::208     7e-18  28%  245 aa  HIS4_SHIB3 RecName:
    3::204     7e-18  28%  256 aa  HIS4_PELPB RecName:
    5::203     7e-18  27%  238 aa  HIS4_PARDP RecName:
    2::235     7e-18  23%  239 aa  HIS4_PARD8 RecName:
    1::209     7e-18  28%  241 aa  HIS4_FRAP2 RecName:
    2::208     7e-18  29%  245 aa  HIS4_ECOSM RecName:
    2::209     9e-18  30%  245 aa  HIS4_SHEON RecName:
    3::200     9e-18  29%  247 aa  HIS4_RALPJ RecName:
    3::200     9e-18  27%  248 aa  HIS4_RALEH RecName:
    3::200     9e-18  31%  245 aa  HIS4_NEIMF RecName:
    3::200     9e-18  31%  245 aa  HIS4_NEIMA RecName:
    3::200     9e-18  31%  245 aa  HIS4_NEIM0 RecName:
    2::206     9e-18  29%  245 aa  HIS4_ENT38 RecName:
   32::236     9e-18  25%  239 aa  HIS4_BACTN RecName:
    2::208     1e-17  28%  242 aa  HIS4_PSEHT RecName:
    3::200     1e-17  28%  253 aa  HIS4_POLSQ RecName:
    3::203     1e-17  27%  249 aa  HIS4_NITOC RecName:
    3::203     1e-17  27%  243 aa  HIS4_BRUSI RecName:
    3::203     1e-17  27%  243 aa  HIS4_BRUO2 RecName:
    3::203     1e-17  27%  243 aa  HIS4_BRUME RecName:
    3::203     1e-17  27%  243 aa  HIS4_BRUMB RecName:
    3::203     1e-17  27%  243 aa  HIS4_BRUC2 RecName:
    3::203     1e-17  27%  243 aa  HIS4_BRUAB RecName:
    3::203     1e-17  27%  243 aa  HIS4_BRUA2 RecName:
    3::203     1e-17  27%  243 aa  HIS4_BRUA1 RecName:
    1::203     1e-17  26%  239 aa  HIS4_BACCN RecName:
    3::199     2e-17  31%  242 aa  HIS4_THISH RecName:
   31::203     2e-17  28%  245 aa  HIS4_RHOP5 RecName:
    2::209     2e-17  27%  245 aa  HIS4_PSYIN RecName:
    3::199     2e-17  29%  261 aa  HIS4_PROA2 RecName:
    1::207     2e-17  27%  241 aa  HIS4_PERMH RecName:
    1::206     2e-17  30%  244 aa  HIS4_MYCLE RecName: Full=Phosphoribosyl isomerase A;AltName:
    4::206     2e-17  28%  253 aa  HIS4_METNO RecName:
    3::208     2e-17  28%  261 aa  HIS4_JANMA RecName:
    2::211     2e-17  31%  248 aa  HIS4_BAUCH RecName:
    3::203     2e-17  26%  254 aa  HIS4_AZOBR RecName:
    3::199     2e-17  29%  243 aa  HIS4_ACIAD RecName:
    1::207     2e-17  30%  244 aa  HIS4_XANC5 RecName:
    3::200     2e-17  27%  247 aa  HIS4_RALME RecName:
    5::203     2e-17  27%  238 aa  HIS4_JANSC RecName:
    6::212     2e-17  25%  249 aa  HIS4_HAEIN RecName:
    6::212     2e-17  25%  249 aa  HIS4_HAEIG RecName:
    6::212     2e-17  25%  249 aa  HIS4_HAEIE RecName:
    6::212     2e-17  25%  249 aa  HIS4_HAEI8 RecName:
    1::200     2e-17  24%  241 aa  HIS4_FLAPJ RecName:
    3::200     2e-17  27%  248 aa  HIS4_CUPTR RecName:
    3::200     2e-17  30%  246 aa  HIS4_BORA1 RecName:
    4::203     2e-17  32%  241 aa  HIS4_ACIC1 RecName:
    2::209     3e-17  27%  245 aa  HIS4_SHESR RecName:
    2::190     3e-17  28%  245 aa  HIS4_SALA4 RecName:
    3::200     3e-17  27%  248 aa  HIS4_RALEJ RecName:
    1::202     3e-17  28%  255 aa  HIS4_PROMM RecName:
    3::200     3e-17  28%  249 aa  HIS4_NITEU RecName:
    3::200     3e-17  30%  245 aa  HIS4_NEIG2 RecName:
    3::200     3e-17  30%  245 aa  HIS4_NEIG1 RecName:
    2::208     3e-17  28%  245 aa  HIS4_ECOUT RecName:
    2::209     3e-17  27%  245 aa  HIS4_ECOSE RecName:
    2::209     3e-17  27%  245 aa  HIS4_ECOLI RecName:
    2::208     3e-17  28%  245 aa  HIS4_ECOL6 RecName:
    2::208     3e-17  28%  245 aa  HIS4_ECOL5 RecName:
    2::209     3e-17  27%  245 aa  HIS4_ECODH RecName:
    2::209     3e-17  27%  245 aa  HIS4_ECOBW RecName:
    2::209     3e-17  27%  245 aa  HIS4_ECO8A RecName:
    3::203     3e-17  26%  243 aa  HIS4_DESVM RecName:
    3::203     3e-17  25%  248 aa  HIS4_SINMW RecName:
    9::210     3e-17  31%  248 aa  HIS4_MYCSS RecName: Full=Phosphoribosyl isomerase A;AltName:
    9::210     3e-17  31%  248 aa  HIS4_MYCSK RecName: Full=Phosphoribosyl isomerase A;AltName:
    9::210     3e-17  31%  248 aa  HIS4_MYCSJ RecName: Full=Phosphoribosyl isomerase A;AltName:
    3::204     4e-17  27%  244 aa  HIS4_UNCTG RecName:
    2::209     4e-17  27%  245 aa  HIS4_SHESW RecName:
    1::202     4e-17  28%  255 aa  HIS4_PROM3 RecName:
    3::208     4e-17  27%  265 aa  HIS4_HERAR RecName:
    3::203     4e-17  23%  242 aa  HIS4_CLOBH RecName:
    3::203     4e-17  23%  242 aa  HIS4_CLOB1 RecName:
   32::205     4e-17  25%  240 aa  HIS4_AZOPC RecName:
    3::205     6e-17  26%  244 aa  HIS4_SYNWW RecName:
    1::202     6e-17  27%  255 aa  HIS4_SYNPX RecName:
    2::209     6e-17  27%  245 aa  HIS4_SHESA RecName:
    2::209     6e-17  27%  245 aa  HIS4_SHEPC RecName:
    2::209     6e-17  26%  245 aa  HIS4_SHEPA RecName:
    1::206     6e-17  30%  244 aa  HIS4_RHOSR RecName:
    1::206     6e-17  30%  244 aa  HIS4_RHOOB RecName:
    3::200     6e-17  30%  245 aa  HIS4_NEIMB RecName:
    3::198     6e-17  25%  238 aa  HIS4_CLONN RecName:
    3::199     6e-17  28%  249 aa  HIS4_CHRSD RecName:
    3::203     6e-17  27%  243 aa  HIS4_CARHZ RecName:
    3::199     7e-17  26%  260 aa  HIS4_CHLP8 RecName:
    3::205     7e-17  26%  245 aa  HIS4_BACA2 RecName:
   38::209     7e-17  30%  248 aa  HIS4_ARTS2 RecName:
    3::204     7e-17  25%  237 aa  HIS4_ANATD RecName:
    3::180     7e-17  33%  238 aa  HIS4_ANASK RecName:
    3::180     7e-17  33%  238 aa  HIS4_ANAD2 RecName:
    3::199     7e-17  29%  243 aa  HIS4_ACIBS RecName:
    2::205     1e-16  27%  245 aa  HIS4_SHEB9 RecName:
    5::202     1e-16  27%  239 aa  HIS4_RHOS5 RecName:
    4::205     1e-16  27%  244 aa  HIS4_RENSM RecName:
    3::200     1e-16  27%  248 aa  HIS4_NITEC RecName:
   13::217     1e-16  30%  255 aa  HIS4_MYCVP RecName: Full=Phosphoribosyl isomerase A;AltName:
    4::205     1e-16  31%  243 aa  HIS4_MYCA1 RecName: Full=Phosphoribosyl isomerase A;AltName:
    2::206     1e-16  28%  245 aa  HIS4_KLEP3 RecName:
    1::204     1e-16  27%  240 aa  HIS4_HERA2 RecName:
    3::203     1e-16  26%  247 aa  HIS4_RHIME RecName:
    3::202     1e-16  26%  247 aa  HIS4_RHILO RecName:
    3::203     1e-16  23%  242 aa  HIS4_CLOB6 RecName:
    1::204     2e-16  26%  243 aa  HIS4_SPHWW RecName:
    2::205     2e-16  27%  245 aa  HIS4_SHEB8 RecName:
    2::205     2e-16  27%  245 aa  HIS4_SHEB2 RecName:
    3::200     2e-16  27%  246 aa  HIS4_CHRVO RecName:
    1::202     2e-16  28%  250 aa  HIS4_ZYMMO RecName:
    2::209     2e-16  27%  245 aa  HIS4_SHEB5 RecName:
    1::192     2e-16  23%  239 aa  HIS4_PELUB RecName:
    3::203     2e-16  25%  243 aa  HIS4_OCHA4 RecName:
    2::206     2e-16  28%  245 aa  HIS4_KLEP7 RecName:
    3::203     2e-16  22%  242 aa  HIS4_CLOBL RecName:
    3::203     2e-16  22%  242 aa  HIS4_CLOBJ RecName:
    3::200     2e-16  29%  246 aa  HIS4_BORPE RecName:
    3::200     2e-16  29%  246 aa  HIS4_BORPA RecName:
    3::200     2e-16  29%  246 aa  HIS4_BORBR RecName:
    3::180     2e-16  33%  238 aa  HIS4_ANADE RecName:
    3::203     2e-16  26%  244 aa  HIS4_AGRVS RecName:
    1::207     3e-16  29%  244 aa  HIS4_XANAC RecName:
    3::203     3e-16  26%  245 aa  HIS4_RHISN RecName:
    4::203     3e-16  30%  238 aa  HIS4_MYXXD RecName:
   47::203     4e-16  29%  245 aa  HIS4_RHOPT RecName:
   47::203     4e-16  29%  245 aa  HIS4_RHOPA RecName:
    5::206     4e-16  30%  244 aa  HIS4_MYCTU RecName: Full=Phosphoribosyl isomerase A;AltName:
    6::207     4e-16  30%  245 aa  HIS4_MYCTA RecName: Full=Phosphoribosyl isomerase A;AltName:
    6::207     4e-16  30%  245 aa  HIS4_MYCBT RecName: Full=Phosphoribosyl isomerase A;AltName:
    6::207     4e-16  30%  245 aa  HIS4_MYCBP RecName: Full=Phosphoribosyl isomerase A;AltName:
    5::206     4e-16  30%  244 aa  HIS4_MYCBO RecName: Full=Phosphoribosyl isomerase A;AltName:
   33::200     4e-16  28%  241 aa  HIS4_HYPNA RecName:
    3::203     4e-16  25%  240 aa  HIS4_CLOD6 RecName:
    3::200     5e-16  26%  260 aa  HIS4_CHLTE RecName:
    2::239     5e-16  25%  239 aa  HIS4_BACFR RecName:
    1::206     6e-16  29%  243 aa  HIS4_NOCFA RecName:
    2::209     6e-16  26%  245 aa  HIS4_IDILO RecName:
    2::208     6e-16  28%  245 aa  HIS4_BUCCC RecName:
    2::239     6e-16  24%  239 aa  HIS4_BACFN RecName:
    5::208     8e-16  30%  269 aa  HIS4_XYLFM RecName:
    1::201     8e-16  25%  240 aa  HIS4_WOLSU RecName:
    1::202     8e-16  31%  245 aa  HIS4_FRASN RecName:
    3::203     8e-16  22%  242 aa  HIS4_CLOBK RecName:
    3::204     8e-16  25%  260 aa  HIS4_CHLPB RecName:
    2::206     8e-16  23%  246 aa  HIS4_BLOPB RecName:
    1::207     1e-15  28%  244 aa  HIS4_XANOR RecName:
    1::207     1e-15  28%  244 aa  HIS4_XANOP RecName:
    1::207     1e-15  28%  244 aa  HIS4_XANOM RecName:
    3::196     1e-15  23%  237 aa  HIS4_SULNB RecName:
    5::206     1e-15  30%  244 aa  HIS4_MYCUA RecName: Full=Phosphoribosyl isomerase A;AltName:
    3::199     1e-15  27%  256 aa  HIS4_CHLPD RecName:
    5::202     1e-15  27%  239 aa  HIS4_RHOSK RecName:
    5::202     1e-15  27%  239 aa  HIS4_RHOS4 RecName:
    5::202     1e-15  27%  239 aa  HIS4_RHOS1 RecName:
    4::205     1e-15  30%  243 aa  HIS4_MYCPA RecName: Full=Phosphoribosyl isomerase A;AltName:
    1::200     1e-15  24%  236 aa  HIS4_CAMC1 RecName:
    3::198     1e-15  25%  238 aa  HIS4_BRAHW RecName:
    2::206     1e-15  24%  251 aa  HIS4_BLOFL RecName:
    6::205     1e-15  24%  245 aa  HIS4_BACLD RecName:
    1::182     1e-15  27%  246 aa  HIS4_ACICJ RecName:
    5::208     2e-15  30%  265 aa  HIS4_XYLFA RecName:
    5::196     2e-15  24%  236 aa  HIS4_SULDN RecName:
    3::200     2e-15  28%  253 aa  HIS4_POLNS RecName:
    3::201     2e-15  28%  238 aa  HIS4_ARCFU RecName:
    3::203     2e-15  25%  247 aa  HIS4_AGRT5 RecName:
    3::203     2e-15  25%  241 aa  HIS4_RHORT RecName:
   12::212     2e-15  28%  253 aa  HIS4_RHOBA RecName:
    3::204     2e-15  29%  242 aa  HIS4_ACIF5 RecName:
    3::204     2e-15  29%  242 aa  HIS4_ACIF2 RecName:
    2::214     4e-15  26%  250 aa  HIS4_SHEDO RecName:
    4::205     4e-15  27%  253 aa  HIS4_METS4 RecName:
    1::196     5e-15  27%  236 aa  HIS4_CAMC5 RecName:
    8::205     5e-15  24%  245 aa  HIS4_BACP2 RecName:
    3::203     5e-15  25%  249 aa  HIS4_AGRRK RecName:
    1::206     7e-15  28%  242 aa  HIS4_METKA RecName:
    3::199     7e-15  26%  241 aa  HIS4_LEPIN RecName:
    3::199     7e-15  26%  241 aa  HIS4_LEPIC RecName:
    1::203     7e-15  25%  248 aa  HIS4_DESHY RecName:
   17::235     7e-15  23%  240 aa  HIS4_CYTH3 RecName:
    5::208     9e-15  28%  269 aa  HIS4_XYLFT RecName:
    5::208     9e-15  28%  269 aa  HIS4_XYLF2 RecName:
   31::205     9e-15  26%  234 aa  HIS4_STACT RecName:
    1::206     9e-15  29%  243 aa  HIS4_MYCA9 RecName: Full=Phosphoribosyl isomerase A;AltName:
    3::195     9e-15  27%  249 aa  HIS4_AZOSE RecName:
    3::204     1e-14  25%  243 aa  HIS4_METCA RecName:
    3::200     1e-14  28%  246 aa  HIS4_BORPD RecName:
   47::202     1e-14  29%  242 aa  HIS4_BEII9 RecName:
   31::202     2e-14  26%  235 aa  HIS4_THEPX RecName:
   47::202     2e-14  28%  247 aa  HIS4_RHOCS RecName:
    1::201     2e-14  21%  238 aa  HIS4_NITSB RecName:
    2::208     2e-14  24%  244 aa  HIS4_BUCAP RecName:
    1::207     2e-14  27%  238 aa  HIS4_AQUAE RecName:
   12::210     2e-14  28%  248 aa  HIS4_LEIXX RecName:
    1::196     2e-14  24%  236 aa  HIS4_CAMFF RecName:
    3::203     3e-14  24%  242 aa  HIS4_ERYLH RecName:
    3::203     3e-14  26%  241 aa  HIS4_NOVAD RecName:
    1::196     3e-14  24%  236 aa  HIS4_CAMHC RecName:
    3::179     3e-14  25%  245 aa  HIS4_BACSU RecName:
    2::209     5e-14  25%  245 aa  HIS4_SHEWM RecName:
    2::209     5e-14  25%  246 aa  HIS4_SHESH RecName:
    1::206     5e-14  25%  244 aa  HIS4_RHOE4 RecName:
    5::242     5e-14  34%  244 aa  HIS4_MARMM RecName:
    1::204     5e-14  27%  241 aa  HIS4_BIFLI RecName:
    1::202     6e-14  26%  255 aa  HIS4_SYNS9 RecName:
    2::209     6e-14  24%  246 aa  HIS4_BUCAI RecName:
    2::209     6e-14  24%  246 aa  HIS4_BUCA5 RecName:
    1::204     6e-14  27%  241 aa  HIS4_BIFAA RecName:
   31::196     6e-14  32%  247 aa  HIS42_SILPO RecName:
    2::209     8e-14  23%  246 aa  HIS4_BUCAT RecName:
    3::207     1e-13  25%  240 aa  HIS4_ELUMP RecName:
    3::203     1e-13  25%  251 aa  HIS4_DESOH RecName:
    3::201     1e-13  22%  235 aa  HIS4_ARCB4 RecName:
    9::212     1e-13  25%  258 aa  HIS42_PHOLL RecName:
    1::202     1e-13  28%  252 aa  HIS4_FRASC RecName:
    2::209     2e-13  26%  245 aa  HIS4_CITK8 RecName:
    2::208     2e-13  29%  241 aa  HIS4_BUCBP RecName:
    3::203     2e-13  23%  250 aa  HIS4_DESDA RecName:
    3::199     2e-13  26%  257 aa  HIS4_CHLCH RecName:
    1::204     2e-13  27%  241 aa  HIS4_BIFLO RecName:
    1::204     2e-13  27%  242 aa  HIS4_BIFA0 RecName:
    1::204     3e-13  25%  242 aa  HIS4_STRAW RecName: Full=Phosphoribosyl isomerase A;AltName:
    4::201     3e-13  27%  241 aa  HIS4_LACPL RecName:
    1::194     4e-13  30%  229 aa  HIS4_THEON RecName:
    1::199     4e-13  26%  238 aa  HIS4_LACC3 RecName:
    5::207     5e-13  26%  244 aa  HIS4_STRMK RecName:
    4::203     5e-13  25%  241 aa  HIS4_STRGG RecName: Full=Phosphoribosyl isomerase A;AltName:
    3::202     5e-13  22%  239 aa  HIS4_MAGSA RecName:
    4::203     7e-13  24%  240 aa  HIS4_STRCO RecName: Full=Phosphoribosyl isomerase A;AltName:
    1::204     7e-13  28%  241 aa  HIS4_BIFLD RecName:
   31::196     7e-13  31%  247 aa  HIS41_SILST RecName:
    3::197     9e-13  27%  243 aa  HIS4_OPITP RecName:
    3::206     9e-13  28%  239 aa  HIS4_LEGPH RecName:
    3::206     9e-13  28%  239 aa  HIS4_LEGPA RecName:
    5::203     9e-13  26%  240 aa  HIS4_DINSH RecName:
   31::200     1e-12  26%  234 aa  HIS4_STAS1 RecName:
   82::206     1e-12  30%  244 aa  HIS4_SPHAL RecName:
    1::207     2e-12  27%  244 aa  HIS4_XANCP RecName:
    1::207     2e-12  27%  244 aa  HIS4_XANCB RecName:
    1::207     2e-12  27%  244 aa  HIS4_XANC8 RecName:
    3::196     2e-12  27%  241 aa  HIS4_THEP1 RecName:
    2::199     2e-12  28%  230 aa  HIS4_SULTO RecName:
   44::200     2e-12  25%  234 aa  HIS4_STAAR RecName:
   52::200     4e-12  25%  234 aa  HIS4_STAES RecName:
   52::200     4e-12  25%  234 aa  HIS4_STAEQ RecName:
   44::200     7e-12  25%  234 aa  HIS4_STAAN RecName:
   44::200     7e-12  25%  234 aa  HIS4_STAAM RecName:
   44::200     7e-12  25%  234 aa  HIS4_STAA9 RecName:
   44::200     7e-12  25%  234 aa  HIS4_STAA2 RecName:
   44::200     7e-12  25%  234 aa  HIS4_STAA1 RecName:
    3::201     7e-12  25%  242 aa  HIS4_DICT6 RecName:
    3::203     7e-12  25%  247 aa  HIS4_DESMR RecName:
    2::209     9e-12  25%  245 aa  HIS4_SHELP RecName:
    1::197     9e-12  27%  241 aa  HIS4_SALTO RecName:
   44::200     1e-11  24%  234 aa  HIS4_STAAW RecName:
   44::200     1e-11  24%  234 aa  HIS4_STAAT RecName:
   44::200     1e-11  24%  234 aa  HIS4_STAAS RecName:
   44::200     1e-11  24%  234 aa  HIS4_STAAE RecName:
   44::200     1e-11  24%  234 aa  HIS4_STAAC RecName:
   44::200     1e-11  24%  234 aa  HIS4_STAA8 RecName:
   44::200     1e-11  24%  234 aa  HIS4_STAA3 RecName:
    3::206     1e-11  27%  239 aa  HIS4_LEGPC RecName:
    3::196     2e-11  26%  241 aa  HIS4_THESQ RecName:
    3::196     2e-11  26%  241 aa  HIS4_THEMA RecName:
   44::200     2e-11  24%  234 aa  HIS4_STAAB RecName:
    3::206     2e-11  27%  239 aa  HIS4_LEGPL RecName:
    5::207     2e-11  24%  244 aa  HIS4_STRM5 RecName:
    2::206     4e-11  25%  245 aa  HIS4_ENTS8 RecName:
    3::203     4e-11  23%  246 aa  HIS4_DESRM RecName:
    1::203     5e-11  24%  238 aa  HIS4_LACCB RecName:
    2::193     2e-10  22%  256 aa  HIS4_PROMA RecName:
    4::193     5e-10  31%  232 aa  HIS4_SULSO RecName:
    2::205     7e-10  21%  247 aa  HIS4_LEPBP RecName:
    2::205     7e-10  21%  247 aa  HIS4_LEPBA RecName:
    3::201     7e-10  24%  242 aa  HIS4_DICTD RecName:
    3::199     2e-09  22%  241 aa  HIS4_LEPBJ RecName:
   31::196     3e-09  25%  248 aa  HIS4_THENN RecName:
    1::197     4e-09  23%  243 aa  HIS4_HELHP RecName:
    3::187     6e-09  24%  240 aa  HIS4_THETN RecName:
    4::107     1e-08  29%  240 aa  HIS4_PYRFU RecName:
    3::199     1e-08  22%  241 aa  HIS4_LEPBL RecName:
    9::202     6e-08  26%  243 aa  HIS4_RUBXD RecName:
  100::206     8e-08  30%  241 aa  HIS4_SORC5 RecName:
  185::229     8e-06  44%  253 aa  GGGPS_THEAC RecName: Full=Geranylgeranylglyceryl phosphate
  151::225     1e-05  28%  226 aa  Y703_METJA RecName: Full=Uncharacterized protein MJ0703;
  172::279     2e-05  33%  310 aa  PYRD_BACP2 RecName: Full=Dihydroorotate dehydrogenase;       
   43::260     2e-05  25%  304 aa  HIS4_ARATH RecName:
    8::164     3e-05  32%  210 aa  THIE_MOOTA RecName: Full=Thiamine-phosphate pyrophosphorylase;     
  226::280     4e-05  38%  304 aa  PYRD_OCEIH RecName: Full=Dihydroorotate dehydrogenase;       
  164::249     4e-05  24%  324 aa  DUS4L_MOUSE RecName: Full=tRNA-dihydrouridine synthase 4-like;     
  188::228     5e-05  44%  251 aa  GGGPS_PYRFU RecName: Full=Geranylgeranylglyceryl phosphate
  152::237     5e-05  35%  321 aa  DUSB_SALTY RecName: Full=tRNA-dihydrouridine synthase B;       
  152::237     5e-05  35%  321 aa  DUSB_SALTI RecName: Full=tRNA-dihydrouridine synthase B;       
  177::245     7e-05  35%  251 aa  TRPA_PYRKO RecName: Full=Tryptophan synthase alpha chain;       
  135::224     7e-05  30%  256 aa  THIG_FLAPJ RecName: Full=Thiazole biosynthesis protein thiG;
  177::295     9e-05  34%  311 aa  PYRDB_LACLA RecName: Full=Dihydroorotate dehydrogenase B, catalytic
  131::206     1e-04  34%  259 aa  THIG_PROMH RecName: Full=Thiazole biosynthesis protein thiG;
  165::239     1e-04  31%  303 aa  THIG_FRASN RecName: Full=Thiazole biosynthesis protein thiG;
   11::217     1e-04  25%  264 aa  HIS4_SCHPO RecName:
  173::230     1e-04  36%  252 aa  GGGPS_PYRAB RecName: Full=Geranylgeranylglyceryl phosphate
  147::225     1e-04  31%  317 aa  DUS_RHILP RecName: Full=Probable tRNA-dihydrouridine synthase;     
  152::237     1e-04  33%  321 aa  DUSB_YERPE RecName: Full=tRNA-dihydrouridine synthase B;       
  169::281     2e-04  28%  305 aa  PYRD_BACHD RecName: Full=Dihydroorotate dehydrogenase;       
  173::279     2e-04  31%  311 aa  PYRD_BACA2 RecName: Full=Dihydroorotate dehydrogenase;       
  152::237     2e-04  33%  334 aa  DUSB_SERMA RecName: Full=tRNA-dihydrouridine synthase B;       
  169::249     2e-04  25%  317 aa  DUS4L_HUMAN RecName: Full=tRNA-dihydrouridine synthase 4-like;     
  133::206     2e-04  30%  255 aa  THIG_VIBHB RecName: Full=Thiazole biosynthesis protein thiG;
  174::301     2e-04  29%  309 aa  PYRD_EXIS2 RecName: Full=Dihydroorotate dehydrogenase;       
  175::226     2e-04  35%  252 aa  GGGPS_THEVO RecName: Full=Geranylgeranylglyceryl phosphate
  133::229     2e-04  29%  255 aa  GGGPS_THESM RecName: Full=Geranylgeranylglyceryl phosphate
  160::233     2e-04  40%  328 aa  DUS_AZOBR RecName: Full=Probable tRNA-dihydrouridine synthase;     
  183::240     2e-04  39%  337 aa  DUSB_PSESM RecName: Full=tRNA-dihydrouridine synthase B;       
  133::206     3e-04  32%  261 aa  THIG_PECCP RecName: Full=Thiazole biosynthesis protein thiG;
  106::167     3e-04  41%  214 aa  THIE_NATPD RecName: Full=Thiamine-phosphate pyrophosphorylase;     
  174::281     3e-04  32%  313 aa  PYRD_GEOSW RecName: Full=Dihydroorotate dehydrogenase;       
  291::346     3e-04  47%  369 aa  PYRD_DEIRA RecName: Full=Dihydroorotate dehydrogenase;       
   85::187     3e-04  39%  237 aa  NANE_THETN RecName: Full=Putative N-acetylmannosamine-6-phosphate
  171::236     3e-04  33%  255 aa  GGGPS_THEPD RecName: Full=Geranylgeranylglyceryl phosphate
   10::211     3e-04  28%  255 aa  GGGPS_METTP RecName: Full=Geranylgeranylglyceryl phosphate
  152::237     3e-04  33%  321 aa  DUSB_KLEPN RecName: Full=tRNA-dihydrouridine synthase B;       
   28::129     4e-04  25%  227 aa  TRPC_PYRKO RecName: Full=Indole-3-glycerol phosphate synthase;     
  133::206     4e-04  34%  261 aa  THIG_ERWCT RecName: Full=Thiazole biosynthesis protein thiG;
  131::206     4e-04  32%  259 aa  THIG_BAUCH RecName: Full=Thiazole biosynthesis protein thiG;
  135::214     4e-04  29%  258 aa  THIG2_PELCD RecName: Full=Thiazole biosynthesis protein thiG 2;
  135::214     4e-04  29%  258 aa  THIG1_PELCD RecName: Full=Thiazole biosynthesis protein thiG 1;
  211::263     4e-04  34%  270 aa  PYRD_THEP1 RecName: Full=Dihydroorotate dehydrogenase;       
  211::263     4e-04  34%  270 aa  PYRD_THEMA RecName: Full=Dihydroorotate dehydrogenase;       
  225::285     4e-04  34%  311 aa  PYRD_BACSU RecName: Full=Dihydroorotate dehydrogenase, catalytic
  117::208     6e-04  27%  213 aa  TPIS_THEVO RecName: Full=Triosephosphate isomerase;       
  133::206     6e-04  28%  255 aa  THIG_VIBPA RecName: Full=Thiazole biosynthesis protein thiG;
  137::210     6e-04  28%  259 aa  THIG_PORGI RecName: Full=Thiazole biosynthesis protein thiG;
  137::210     6e-04  28%  259 aa  THIG_PORG3 RecName: Full=Thiazole biosynthesis protein thiG;
  133::206     6e-04  31%  256 aa  THIG_IDILO RecName: Full=Thiazole biosynthesis protein thiG;
  268::327     6e-04  33%  359 aa  PYRD_NAUPA RecName: Full=Dihydroorotate dehydrogenase;       
  174::284     6e-04  31%  309 aa  PYRD_BACCN RecName: Full=Dihydroorotate dehydrogenase;       
  177::277     6e-04  34%  311 aa  PYRDB_LACLM RecName: Full=Dihydroorotate dehydrogenase B, catalytic
    2::37      6e-04  50%  229 aa  HIS4_PYRAE RecName:
  188::252     6e-04  32%  252 aa  GGGPS_THEGJ RecName: Full=Geranylgeranylglyceryl phosphate
  201::238     6e-04  39%  254 aa  GGGPS_PYRHO RecName: Full=Geranylgeranylglyceryl phosphate
  153::237     6e-04  34%  321 aa  DUSB_SHIFL RecName: Full=tRNA-dihydrouridine synthase B;       
  153::237     6e-04  34%  321 aa  DUSB_ECOLI RecName: Full=tRNA-dihydrouridine synthase B;       
  153::237     6e-04  34%  321 aa  DUSB_ECOL6 RecName: Full=tRNA-dihydrouridine synthase B;       
  153::237     6e-04  34%  321 aa  DUSB_ECO57 RecName: Full=tRNA-dihydrouridine synthase B;       
  133::206     7e-04  30%  254 aa  THIG_SHESW RecName: Full=Thiazole biosynthesis protein thiG;
  133::206     7e-04  30%  254 aa  THIG_SHEPC RecName: Full=Thiazole biosynthesis protein thiG;
  133::206     7e-04  30%  254 aa  THIG_SHEB9 RecName: Full=Thiazole biosynthesis protein thiG;
  133::206     7e-04  30%  254 aa  THIG_SHEB8 RecName: Full=Thiazole biosynthesis protein thiG;
  133::206     7e-04  30%  254 aa  THIG_SHEB5 RecName: Full=Thiazole biosynthesis protein thiG;
  133::206     7e-04  30%  254 aa  THIG_SHEB2 RecName: Full=Thiazole biosynthesis protein thiG;
  131::220     7e-04  31%  255 aa  THIG_PHOLL RecName: Full=Thiazole biosynthesis protein thiG;
  229::284     7e-04  38%  304 aa  PYRD_SOLUE RecName: Full=Dihydroorotate dehydrogenase;       
  290::337     7e-04  40%  341 aa  PYRD_HAHCH RecName: Full=Dihydroorotate dehydrogenase;       
  173::281     7e-04  33%  304 aa  PYRD_GEOLS RecName: Full=Dihydroorotate dehydrogenase;       
  227::272     7e-04  35%  304 aa  PYRD_BACSK RecName: Full=Dihydroorotate dehydrogenase;       
  295::388     7e-04  30%  514 aa  IMDH2_MOUSE RecName: Full=Inosine-5'-monophosphate dehydrogenase 2;
  127::208     7e-04  29%  320 aa  GUAC_MESFL RecName: Full=GMP reductase;         EC=1.7.1.7;AltName:
  147::237     7e-04  31%  323 aa  DUSB_PROVU RecName: Full=tRNA-dihydrouridine synthase B;       
  146::257     7e-04  25%  332 aa  DUSB_PASMU RecName: Full=tRNA-dihydrouridine synthase B;       
  152::237     7e-04  33%  321 aa  DUSB_ERWCA RecName: Full=tRNA-dihydrouridine synthase B;       
  185::241     7e-04  32%  333 aa  DUS1_BACSU RecName: Full=Probable tRNA-dihydrouridine synthase 1;  
  133::206     0.001  30%  254 aa  THIG_SHEPW RecName: Full=Thiazole biosynthesis protein thiG;
  139::227     0.001  25%  255 aa  THIG_CLOTH RecName: Full=Thiazole biosynthesis protein thiG;
  230::302     0.001  28%  307 aa  PYRD_LACJO RecName: Full=Dihydroorotate dehydrogenase;       
  174::281     0.001  30%  309 aa  PYRD_BACC4 RecName: Full=Dihydroorotate dehydrogenase;       
  288::350     0.001  40%  359 aa  PYRD_ACIAC RecName: Full=Dihydroorotate dehydrogenase;       
    1::256

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           MSLAVRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNRETTYDVVRRT
HIS6_THEFY      MSLAVRVIPCLDVDGGRVVKGVNFQNLRDAGDPVELARRYDAEGADELTFLDVTASSSNRETTYDVVRRT
HIS6_STRCO      MTLAVRVIPCLDVDNGRVVKGVNFQNLRDAGDPVEMAKVYDAEGADELTFLDITASSGNRETTYDVVRRT
HIS6_STRAW      MTLAVRVIPCLDVDNGRVVKGVNFQNLRDAGDPVEMAKVYDAEGADELTFLDITASSGNRETTYDVVRRT
HIS6_KINRD      MSVAVRVIPCLDVDAGRVVKGVNFADLRDAGDPVELARRYDAEGADELTFLDVTASSGSRETTYDVVRRT
HIS6_STRGG      MSLAVRVIPCLDVDNGRVVKGVNFQNLRDAGDPVEMAKLYDAEGADELTFLDITASSGDRETTYDVVRRT
HIS6_MYCVP      --VATRVIPCLDVDGGRVVKGVNFANLRDAGDPVELAAAYDAEGADELTFLDVTASSSGRATMLDVVRRT
HIS6_RHOOB      MTLAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAAYDAQGADELTFLDVTASTADRGTMLDVVSRT
HIS6_RHOSR      MTLAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAAYDAQGADELTFLDVTASTADRGTMLDVVSRT
HIS6_RHOE4      MTLAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAAYDAQGADELTFLDVTASTSDRGTMLDVVSRT
HIS6_NOCFA      MTVAVRVIPCLDVDAGRVVKGVNFQNLRDAGDPVELAATYDAQGADELTFLDVTASTGDRGTMIDVVTRT
HIS6_MYCPA      --LAVRVIPCLDVDDGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRATMLDVVRRT
HIS6_MYCA1      --LAVRVIPCLDVDDGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRATMLDVVRRT
HIS6_MYCGI      --VATRVIPCLDVDDGRVVKGVNFANLRDAGDPVELAAAYDAEGADELTFLDVTASSSGRSTMLEVVRRT
HIS6_MYCA9      MSVATRVIACLDVDDGRVVKGVNFENLRDAGDPVELAAAYDAEGVDELTFLDVTASSSGRATMLDVVRRT
HIS6_ARTS2      MAVAVRVIPCLDVDAGRVVKGINFEGLRDAGDPVELAHRYDNGGADELTFLDVTASSGNRETTFDVVRRT
HIS6_MYCMM      --LAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAAYDAEGADELTFLDVTASSSGRATMLEVVRHT
HIS6_MYCUA      --LAVRVIPCLDIDAGRVVKGVNFENLRDAGDPVELAAAYDAEGADELTFLDVTASSSGRATMLEVVRHT
HIS6_MICLC      MSLAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELARRYNAAGADEITFLDVTASTSDRATTYDVVTRT
HIS6_BIFLI      MSLAVRVIPCLDVDAGRVVKGVHFENLKDAGDPVELAAEYYRQGADEITFLDVTASSSHRNTMIDVVSRT
HIS6_CORGL      MGVAIRVIPCLDVDNGRVVKGVNFENLRDAGDPVELAKRYDEEGADELTFLDVTASKHGRGTMLDVVRRT
HIS6_CORGB      MGVAIRVIPCLDVDNGRVVKGVNFENLRDAGDPVELAKRYDEEGADELTFLDVTASKHGRGTMLDVVRRT
HIS6_BEUC1      MPVALRVVPCLDVDGGRVVKGVNFLDLRDAGDPVELARRYDADGADEITFLDVSASTQGRATTLEMVSAT
HIS6_COREF      MGVAIRVIPCLDVDNGRVVKGVNFENLRDAGDPVELAKRYGEEGADELTFLDVSASKDGRGTMLDVVRRT
HIS6_CORJK      MSVTVRVIPCLDVDNGRVVKGVNFEGLRDAGDPVELAKRYDALGADELTFLDVSASKDGRGTMLDVVRHT
HIS6_ARTAT      MAVAVRVIPCLDVDAGRVVKGVNFEGLRDAGDPVELAHRYDNGGADELTFLDVTASSGNRETTFDVVRRT
HIS6_BIFLO      MSLAVRVIPCLDVDAGRVVKGVHFENLKDAGDPVELAAEYYRQRADEITFLDVTASSSHRNTMIDVVSRT
HIS6_BIFLD      MSLAVRVIPCLDVDAGRVVKGVHFENLKDAGDPVELAAEYYRQGADEITFLDVTASSSHRNTMIDVVSCT
HIS6_CORDI      MPVAVRVIPCLDVKNGRVVKGVNFEGLKDAGDPVELAARYDAEGADELTFLDVSASQDGRGTMLEVVRRT
HIS6_BIFAA      MSLAVRVIPCLDVDAGRVVKGVHFENLRDAGDPVELAAEYYRQGADELTFLDVTASSSHRQTMVDVVSRT
HIS6_BIFA0      MSLAVRVIPCLDVDDGRVVKGVHFENLRDAGDPVELAAEYYRQGADELTFLDVTASSSHRQTMVNVVTRT
HIS6_RENSM      MSVAIRVIPCLDVDAGRVVKGVNFADLRDAGDPVELARRYDGAGADELTFLDVTATSGNRETTFEMVARA
HIS6_FRASC      MSVAVRVIPCLDVDAGRVVKGVNFTDLRDAGDPVEMARLYDAEGADELTFLDITASSGDRETTYDIVRRT
HIS6_ARTCA      MAVAVRVIPCLDVDAGRVVKGVNFEGLRDAGDPVELAHRYDNAGADELTFLDVTASSGNRETTFDVVRRT
HIS6_NOCSJ      MTLAVRVIPCLDVDAGRVVKGINFKELRDAGDPVELARTYDAEGADELTFLDISASFEGRATTMEIVSRT
HIS6_MYCTU      --LAVRVIPCLDVDDGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRATMLEVVRRT
HIS6_MYCTA      --LAVRVIPCLDVDDGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRATMLEVVRRT
HIS6_MYCLE      --LAVRVIPCLDVYCGRVVKGVNFKNLRDAGDLVELAAAYDAEGADELAFLDVTASSSGRATMLEVVRCT
HIS6_MYCLB      --LAVRVIPCLDVYCGRVVKGVNFKNLRDAGDLVELAAAYDAEGADELAFLDVTASSSGRATMLEVVRCT
HIS6_MYCS2      --VATRVIPCLDVDNGRVVKGVNFENLRDAGDPVELAAAYDAEGADELTFLDVTASSSGRSTMLEVVRRT
HIS6_MYCBT      --LAVRVIPCLDVDDGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRATMLEVVRRT
HIS6_MYCBP      --LAVRVIPCLDVDDGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRATMLEVVRRT
HIS6_MYCBO      --LAVRVIPCLDVDDGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRATMLEVVRRT
HIS6_KOCRD      MGVAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAARYDLAGADELTFLDVTASSGERDTMFDVVSRT
HIS6_CORU7      MSVSVRVIPCLDVANGRVVKGVNFKNLRDAGDPVELAKRYDEEGADELTFLDVSASKEGRGTMLDVVRRT
HIS6_SALTO      MSLAVRVIPCLDVDAGRVVKGVNFLDLRDAGDPVERAAAYDRAGADELTFLDVTASVSDRGTMLDVVRRT
HIS6_LEIXX      MGVAVRVIPCLDVAAGRVVKGVNFQNLRDQGDPVEFARRYAEQGADELTFLDVTATVDDRSTTYDVVRAT
HIS6_CORA7      MALAVRVIPCLDVDNGRVVKGVNFENLRDAGDPVELAARYGQVGADELTFLDVSASKDGRGTMLDVVRRT
HIS6_MYCSS      --LAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRSTMLDVVRRT
HIS6_MYCSK      --LAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRSTMLDVVRRT
HIS6_MYCSJ      --LAVRVIPCLDVDAGRVVKGVNFENLRDAGDPVELAAVYDAEGADELTFLDVTASSSGRSTMLDVVRRT
HIS6_THERP      -----RIIPCLDVTAGRVVKGVQFLDLRDAGDPVELAARYDAEGADELVFLDITASAEGRETMVEVVRRT
HIS6_MAGSA      --LKMRIIPCLDVKDGRVVKGVNFVDLIDAGDPVEQAKLYDKAGADELTFLDITASHENRDTIYDVVRRT
HIS6_NITOC      MSLAKRIIPCLDVANGRVVKGVRFVNIRDAGDPVEIARRYDEQGADEITFLDITASSDNRDTMVHVVEEV
HIS6_SALAI      MSLAVRVIPCLDVDAGRVVKGVNFLDLRDAGDPVELAAAYDRAGADELTFLDVTASASDRGTMVDVVRRT
HIS6_GEOSF      --LTKRIIPCLDVKGGRVVKGVQFLELRDAGDPVEIAEIYDRQGADELTFLDITASSDARDIIIDVVRRT
HIS6_PSEMY      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_MARAV      MALAKRIIPCLDVDKGRVVKGVNFVDIRDAGDPVEVARRYNEQGADEITFLDITASSESRDTTYETVERM
HIS6_AZOBR      --LKMRVIPCLDVKDGRVVKGVNFVDLIDAGDPVEQARVYDREGADELTFLDITASHENRDTIYDVVRRT
HIS6_PSEA7      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_PSEAB      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_PSEA8      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_GEOUR      --LTKRIIPCLDVKGGRVVKGVQFLELRDAGDPVEIAEIYDRQGADELTFLDITASSDARDIIIDVVRRT
HIS61_PSEAE     MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_PSEU5      MALAKRIIPCLDVDNGRVVKGVQFENIRDAGDPVEIARRYDEQGADEITFLDITASVDNRDTTLHTVERM
HIS6_BURPS      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDAQGADELTFLDITATSDGRDLILPIIEAV
HIS6_BURP6      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDAQGADELTFLDITATSDGRDLILPIIEAV
HIS6_BURP1      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDAQGADELTFLDITATSDGRDLILPIIEAV
HIS6_BURP0      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDAQGADELTFLDITATSDGRDLILPIIEAV
HIS6_AZOSB      --LAKRIIPCLDVSAGRVVKGVNFVDLRDAGDPVEVARRYDAQGADEITFLDITASSDDRDIILHVVERV
HIS6_PSEFS      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_BURMS      MALAKRIIPCFDVTAGRVVKGVNFVELRDAGDPVEIARRYDAQGADELTFLDITATSDGRDLILPIIEAV
HIS6_BURMA      MALAKRIIPCFDVTAGRVVKGVNFVELRDAGDPVEIARRYDAQGADELTFLDITATSDGRDLILPIIEAV
HIS6_BURM9      MALAKRIIPCFDVTAGRVVKGVNFVELRDAGDPVEIARRYDAQGADELTFLDITATSDGRDLILPIIEAV
HIS6_BURM7      MALAKRIIPCFDVTAGRVVKGVNFVELRDAGDPVEIARRYDAQGADELTFLDITATSDGRDLILPIIEAV
HIS6_THISH      --LAKRIIPCLDVDNGRVVKGVNFVEIRDAGDPVEIARRYDAEGADEITFLDITASHDERETMVHVVEQV
HIS6_PSEF5      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_GLUOX      --LKLRVIPCLDVKDGRVVKGVNFVSLRDAGDPVEQAKLYDAAGADELTFLDITASVENRDTILDVVRRT
HIS6_GEOSL      --LTKRIIPCLDVKGGRVVKGVQFLELRDAGDPVEIAELYDRQGADELTFLDITASSDERSIIIDVVRRT
HIS6_BURTA      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDGRDLILPIIEAV
HIS6_PSESM      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_PSEPF      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_PSEPK      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_PSEP1      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_HALHL      ---AKRIIPCLDVDAGRVVKGVRFVDIRDAGDPVEIARRYDAMGADELTFLDITASHEERETIYDVVEAV
HIS6_AZOVD      MALAKRIIPCLDVDNGRVVKGVRFENIRDAGDPVEIAQRYDEQGADEITFLDITASHEGRDTTLHTVERM
HIS6_GEOMG      --LTKRIIPCLDVKGGRVVKGVQFLELRDAGDPVEIAEAYDRQGADELTFLDITASSDERNIIIDVVRRT
HIS6_PSEU2      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_PSE14      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYDEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_PELTS      --LQKRIIPCLDVTEGRVVKGTNFINLRDAGDPVELAAFYDREGADELVFLDITASAEGRKTTVEMVYRT
HIS6_MARMS      MGLAKRIIPCLDVDNGRVVKGVQFVDIRDAGDPVEVAKRYNEQGADEITFLDITASSDDRETTVHMVEAI
HIS6_BURS3      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAV
HIS6_BURCM      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAV
HIS6_BURCH      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAV
HIS6_BURCC      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAV
HIS6_BURCA      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAV
HIS6_BURA4      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAV
HIS6_PSEPG      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYNEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_PSEE4      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYNEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_IGNH4      MPLTKRIIPCLDVKDGRVVKGVSFQNLRDAGDPVELAAYYQEQGADEIVFLDISATPEGRETMIEVVRRT
HIS6_DESAP      --LAKRIIPCLDVNRGRVVKGVNFVNLRDAGDPVELAAVYDREGADEVVFLDITASAEGRDIVLDMVRRT
HIS6_PSEPW      MALAKRIIPCLDVDNGRVVKGVKFENIRDAGDPVEIARRYNEQGADEITFLDITASVDGRDTTLHTVERM
HIS6_DESHY      MMLAKRIIPCLDVHEGRVVKGTNFVNLRDAGDPVELAALYDREGADELVFLDISASAEGRETMVEVVRRT
HIS6_MOOTA      --LTKRIIPCLDVDHGRVVKGTNFLNLRDAGDPVELAAAYDREGADELVFLDISASVEGRDIMIDVARRT
HIS6_GEOLS      --LTRRIIPCLDVTGGRVVKGVQFLELRDAGDPVEIAEAYDLQGADELTFLDITASSDGRDTMVDVVRHT
HIS6_BURP8      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDEQGADELTFLDITATSDQRDLILPIIEAV
HIS6_BURM1      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDEQGADELTFLDITATSDQRDLILPIIEAV
HIS6_DESHD      --LAKRIIPCLDVHEGRVVKGTNFVNLRDAGDPVELAALYDREGADELVFLDISASAEGRETMVEVVRRT
HIS6_AKKM8      --LAKRIIPCLDVTDGRVVKGTNFINLRDAGDPVECARAYDAQQADELVFLDITASSDGRATMADVVRRT
HIS6_GLUDA      --LKLRVIPCLDVKNGRVVKGVNFVSLRDAGDPVEQAAVYDAAGADELTFLDITASHENRDTILDVVSRT
HIS6_CHRVO      --LAKRIIPCLDVTAGRVVKGVNFLGLRDAGDPVEIARRYNEQGADELTFLDITASSDQRDIILHVIEAV
HIS6_BURCJ      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAV
HIS6_ROSS1      -----RIIPCLDVKAGRVVKGVAFLNHRDAGDPVELAAAYDAGGADELVFYDITASSDERAIMVDVVERT
HIS6_METCA      --LAKRIIPCLDVDNGRVVKGVRFVDIRDAGDPVEIARRYDREGADELAFLDITASSDDRETMVHVVEQV
HIS6_RHOCS      --LKARVIPCLDVKDGRVVKGVNFVDLVDAGDPVEQARLYDAAGADELTFLDITASSDNRETIYDVVRRT
HIS6_NITEC      MGLAKRIIPCLDIKDGRVVKGVNFVSLRDAGDPVEIARSYNEQGADELVFLDITASVENRDLILHIVEKV
HIS6_METPP      --LAKRIIPCLDVTGGRVVKGVNFVELRDAGDPVEIAARYNEQGADELTFLDITATSDGRDLILPIIEAV
HIS6_SULSY      --LAKRIIPCLDVDKGRVVKGVNFVNLIDAGDPVEIASVYDKEGADELVFLDITASSEDRNIILDVVKKT
HIS6_BURPP      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAV
HIS6_NEIM0      MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGADELTFLDITASSDNRDTILHIIEEV
HIS6_NEIG2      MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGADELTFLDITASSDNRDTILHIIEEV
HIS6_NEIG1      MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGADELTFLDITASSDNRDTILHIIEEV
HIS6_DESRM      --LMKRVIPCLDVTAGRVVKGTNFVNLRDAGDPVELAAFYDKEGADELVFLDITASSDGRVTMLDVVRRT
HIS6_NEIMF      MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGADELTFLDITASSDNRDTILHIIEEV
HIS6_CHRSD      MALAKRIIPCLDVDAGRVVKGVNFVGIRDAGDPVEVAKRYNQQGADEITFLDITASVEDRGTTVEMVERI
HIS6_NITEU      MGLAKRIIPCLDIKDGRVVKGVNFVSLRDAGDPVEIARSYNEQGADELVFLDITASSENRDLILHIVEKV
HIS6_BURVG      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDEQGADELTFLDITATSDQRDLILPIIEAV
HIS6_AZOC5      --LKVRVIPCLDVKDGRVVKGVQFVDLRDAGDPVESARAYDAAGADELTFLDITASHENRGTILDVVRRT
HIS6_THETN      --LAKRIIPCLDVKDGRVVKGINFVNLKDAGDPVEIAERYNELGADELVFLDITASYEKRKIMIDVVKRT
HIS6_THET2      MSLAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAILLDVVARV
HIS6_NEIMA      MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGADELTFLDITASSDNRDTILHIIEEV
HIS6_LARHH      --LAKRIIPCLDVTAGRVVKGVNFVGLRDAGDPVEIARRYNEQGADELTFLDITASSDARDIILHVIEAV
HIS6_BURXL      MALAKRIIPCLDVTAGRVVKGVNFVELRDAGDPVEIARRYDDQGADELTFLDITATSDQRDLILPIIEAV
HIS6_ARCB4      -SFAKRIIPCLDVDNGRVVKGVNFVGLRDAGDPVEVAKRYNSEGADEITFLDITASHENRGTIVDIVKKV
HIS6_RALME      --LAKRIIPCLDVTNGRVVKGVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGRDLILHIIEAV
HIS6_TERTT      MPLAKRIIPCLDVDKGRVVKGVQFVDIRDAGDPVEVAKKYNEQGADEITFLDITASHEARETTINTVEKI
HIS6_VARPS      --LAKRIIPCLDVTGGRVVKGVNFLELRDAGDPVEIAARYNAQGADELTFLDITATSDGRDLILPIIEAV
HIS6_THET8      MSLAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAILLDVVARV
HIS6_THEPX      --LAKRIIPCLDVKDGRVVKGVNFLNLKDAGDPVQIASEYNELGADELVFLDITASYEKRKIMIEVVKRT
HIS6_CLOTH      -----RIIPCLDVHNGRVVKGVNFVNIRDAGDPVEIASYYDKAGADELTFLDITASAEARNIMIDVVRRV
HIS6_THIDA      --LAKRIIPCLDVTNGRVVKGVNFVELKDAGDPVEIARGYNEAGADELTFLDITASSDNRDLILHIVEAV
HIS6_PERMH      --LAKRIIPCLDVNKGRVVKGVNFVNLVDAGDPVEAAKAYDEAGADELVFLDITASAEERDIILDVVKQT
HIS6_RALEJ      --LAKRIIPCLDVTNGRVVKGVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGRDLILHIIEAV
HIS6_NITMU      MGLAKRIIPCLDVTNGRVVKGVKFVSLRDAGDPIEIARRYDDQGADELTFLDITASSDDRDLILHIIEEV
HIS6_SULDN      ---AKRIIPCLDVKDGRVVKGVNFVGLRDAGDPVEVAKRYNQEGADEITFLDITASSDNRDTIVDIVAQV
HIS6_PSYWF      --LAKRIIPCLDVDNGRVVKGVQFVDIKDAGDPVEVARRYNEQGADEITFLDITATHHGRETTYDMVERI
HIS6_CLOAB      --LTKRIIPCLDVDMGRVVKGVNFVNLKDVGDPVEIADFYNREGADEIVFLDISATNEGRNTMIDVVRRT
HIS6_PSYA2      --LAKRIIPCLDVDNGRVVKGVQFVDIKDAGDPVEVAKRYNEQGADEITFLDITATSDERDTTYHTVERM
HIS6_MAGSM      --MAKRIIPCLDVKAGRVVKGVQFEGLVDAGDPVEAAKRYDEEGADELTFLDITATHEDRGIMEDVVRRT
HIS6_CLAM3      --LAVRVIPCLDVAAGRVVKGVNFLDLQDAGDPVELARLYYEQGADELTFLDVTATVEDRSTMYDVVSAT
HIS6_HAHCH      MGLAKRIIPCLDVDKGRVVKGVQFVDIRDAGDPVEVAKRYDEQGADEITFLDITASHEGRDTTVHTVERM
HIS6_BORPE      -TLTRRIIPCLDVTAGRVVKGVNFVNLTDAGDPVEIARRYNEQGADELTFLDITATSDGRDLILPIIEQV
HIS6_BORBR      -TLTRRIIPCLDVTAGRVVKGVNFVNLTDAGDPVEIARRYNEQGADELTFLDITATSDGRDLILPIIEQV
HIS6_SULNB      ---AKRIIPCLDVNEGRVVKGVNFVGLRDAGDPVEVAKRYNEEGADEITFLDIGASHEGRDTIVDVVKKV
HIS6_SOLUE      --LAKRIIPCLDVTGGRVVKGVNFVNLRDAGDPVELADRYNLDGADELVFLDITASSDARDIMADVVART
HIS6_METFK      MSLAKRIIPCLDVTNGRVVKGVNFLELRDAGDPVEIARRYDEQGADELTFLDITASSDNRGLMLGIIEQV
HIS6_RALEH      --LAKRIIPCLDVTNGRVVKGVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGRDLMLHIIEDV
HIS6_PELCD      --LTKRIIPCLDVKDGRVVKGVQFLELRDAGDPVEAAEAYDAQGADELTFLDITASSDKRNIILDVVSRT
HIS6_OPITP      --LSRRIIPCLDVNAGRVVKGVRFQQLRDAGDPVACARAYDAQGADELIFLDITASSDERKIMHDVVAAT
HIS6_HELMI      --LAKRIIPCLDVHGGRVVKGTNFVNLRDAGDPVELAAVYDKEGADEVVFLDITASSDGRAIMLDVVRRT
HIS6_DIAST      --LAKRIIPCLDVTGGRVVKGVNFVELRDAGDPVEIAARYNAQGADELTFLDITATSDERDLILPIIEAV
HIS6_BORA1      -ALTRRIIPCLDVTAGRVVKGVNFVNLTDAGDPVEIARRYNEQGADELTFLDITATSDGRDLILPIIEQV
HIS6_ACISJ      --LAKRIIPCLDVTGGRVVKGVNFVELRDAGDPVEIAARYNAQGADELTFLDITATSDERDLILPIIEAV
HIS6_UNCMA      --LTRRIIPCLDVNGGCVVKGVEFVNLRSAGDPVELAKRYNDQGADELVFLDITASHEGRATMIDVIERT
HIS6_THICR      MSLAKRIIPCLDVDNGRVVKGVQFVDIRDAGDPVEVAKRYDEQGADEITFLDITATAHERDTIVHVVEEV
HIS6_METMJ      MVLTKRIIPCLDLKDGRVVKGTHFVGLRDAGDPVELAQRYNEQGADEVVFLDITATREDRGTIIDVVQRA
HIS6_BORPA      -TLTRRIIPCLDVTAGRVVKGVNFVNLTDAGDPVEIARRYNEQGADELTFLDITATSDGHDLILPIIEQV
HIS6_PSYCK      --LAKRIIPCLDVDNGRVVKGVQFVDIKDAGDPVEVAKRYNEQGADEITFLDITATNDERDTTYHTVERM
HIS6_ACIAD      --LAKRIIPCLDVDNGRVVKGVQFLDIRDAGDPVEVARRYNEQGADEITFLDITATHHGRDTTYRTVERM
HIS6_METB6      MVLTRRIIPCLDLKDGRVVKGTNFLGLRDAGDPVELAGRYNEQGADEVVFLDITASKEKRGIIIELIQRA
HIS6_CUPTR      --LAKRIIPCLDVTNGRVVKGVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGRDLMLHIIEDV
HIS6_ACIF5      --LASRVIPCLDIDHGRVVKGVQFVALRDAGDPVEVAKRYNDEGADEITFLDISASYEERGTLADMVSAV
HIS6_ACIF2      --LASRVIPCLDIDHGRVVKGVQFVALRDAGDPVEVAKRYNDEGADEITFLDISASYEERGTLADMVSAV
HIS6_THEP3      -----RIIPCLDVHNGRVVKGVNFVNIRDAGDPVEIASYYDKAGADELTFLDITASAELRNIMIDVVRRV
HIS6_RHORT      --LKMRIIPCLDVKDGRVVKGVNFVGLRDAGDPVEQARLYDAAGADELCFLDITASHENRDTLLDVVGRT
HIS6_RALPJ      --LAKRIIPCLDVTNGRVVKGVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGRDLMLGIIEAV
HIS6_METHJ      MTLTRRIIPCLDIKDGRVVKGTNFLGLRDAGDPVELACRYNEQGADEVVFLDITASRENRGMIIDVIQRA
HIS6_DECAR      --LAKRIIPCLDVTAGRVVKGTNFVGLRDAGDPIEIARRYNEQGADEVTFLDITASSDQRDIILHIIEAC
HIS6_ARCFU      --LAKRIIPCLDVSEARVVKGVEFVNLRDAGDPVELAKRYDEEGADELVFLDITASPEGRRTMIDVIERT
HIS6_PYRKO      --LAKRIIAALDIRAGRVVKGIKFRNIRDAGDPVELARRYESEGIDEIVFLDITASHEKRGILLDLVERV
HIS6_CLOCE      --LTKRIIPCLDVHAGRVVKGVQFVNIIDAGDPVEAAAFYDKAGADELTFLDITASSDARSIMLDVVSRV
HIS6_ACIBT      --LAKRIIPCLDVDNGRVVKGVQFLDIRDAGDPVEVARRYNEQGADEITFLDITATHHGRDTTYRTVERM
HIS6_ACIBC      --LAKRIIPCLDVDNGRVVKGVQFLDIRDAGDPVEVARRYNEQGADEITFLDITATHHGRDTTYRTVERM
HIS6_ACIB5      --LAKRIIPCLDVDNGRVVKGVQFLDIRDAGDPVEVARRYNEQGADEITFLDITATHHGRDTTYRTVERM
HIS6_ACIB3      --LAKRIIPCLDVDNGRVVKGVQFLDIRDAGDPVEVARRYNEQGADEITFLDITATHHGRDTTYRTVERM
HIS6_DELAS      --LAKRIIPCLDVTGGRVVKGVNFVELRDAGDPVEIAARYNAQGADELTFLDITATSDGRDLILPIIESV
HIS6_ANAVT      --LSKRILPCLDVKAGRVVKGVNFVDLKDAGDPVELAKVYNDAGADELVFLDITATHEDRDTIIDVVYRT
HIS6_RALSO      --LAKRIIPCLDVTNGRVVKGVNFVELRDAGDPVEIARRYDEQGADEITFLDITATSDGRDLILHIIEAV
HIS6_MICAN      --LAKRILPCLDVNKGRVVKGVNFVNLQDAGDPVELARLYNQAGADELVFLDITATHEDRDTIIDVVYRT
HIS6_WOLSU      --LAKRIIPCLDIKEGRVVKGVNFLGLRDAGDPVEVARRYNEEGADEIAFLDITATHERRDTMCDIVRAV
HIS6_POLNA      --LAKRIIPCLDVTGGRVVKGVNFVELRDAGDPVEIAARYNDQGADELTFLDITATSDGRDLILHIIEAV
HIS6_DINSH      --LKIRVIPCLDVADGRVVKGVNFVDLVDAGDPVESAKAYDAAGADELCFLDIHATNENRGTMYDLATRT
HIS6_ANASP      --LSKRILPCLDVKAGRVVKGVNFVDLKDAGDPVELAKVYNDAGADELVFLDITATHEDRDTIIDVVYRT
HIS6_POLSJ      --LAKRIIPCLDVTGGRVVKGVNFVELRDAGDPVEIAARYNEQGADELTFLDITATSDGRDLILHIIEAV
HIS6_NEIMB      MALAKRIIPCLDVKDGRVVKGVNFIGLRDAGDPVEAAKRYNGEGADELTFLDITASSDNRDTILHIIEEV
HIS6_HELMO      --LAKRIIPCLDVHGGRVVKGTNFVNLRDAGDPVELAAVYDKEGADELVFLDITASSDGRAIMLDVVRRT
HIS6_CLOBK      -----RIIPCLDVDMGRVVKGVNFVNLKDVGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKT
HIS6_AZOSE      --LAKRIIPCLDVNAGRVVKGVNFVELRDAGDPVEIARRYDEQGADEITFLDITASSDARDIILHVVEQV
HIS6_THEGJ      --LAKRIIAALDIKEGRVVKGIKFKNIRDAGDPIELARRYEKEGIDEIVFLDITASYEKRGILLDLVERI
HIS6_STRMU      --LKKRIIPCLDVKDGRVVKGVNFVNLTDVGDPVDAARAYYEAGCDELVFLDITATSDNRETTVDMVRHV
HIS6_NITSB      ---AKRIIPCLDVDKGRVVKGVNFVGLKDAGDPVEVAKRYNEEGADEITFLDITATYEERDTIVHIVEEV
HIS6_CLOBJ      -----RIIPCLDVDMGRVVKGVNFVNLKDVGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKT
HIS6_BRUSU      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_BRUSI      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_BRUO2      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_BRUME      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_BRUMB      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_BRUC2      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_BRUAB      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_BRUA2      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_BRUA1      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_OCHA4      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVIART
HIS6_METPE      MVLTKRIIPCLDLKDGRVVKGTHFVDLRDAGDPVELAERYNEQGADEVVFLDITASKEQRGAILSVISRA
HIS6_METLZ      MGLTRRIIPCLDLKAGRVVKGVNFEGLRDAGDPVELASRYNEQGADEVVFLDIAASKDNRDTMIDVIGRA
HIS6_CAUCR      --LKTRIIPCLDVKDGRVVKGVNFVSLRDAGDPVEQARAYDAAGADELMFLDITASSEGRGLILDVISRT
HIS6_CAUCN      --LKTRIIPCLDVKDGRVVKGVNFVSLRDAGDPVEQARAYDAAGADELMFLDITASSEGRGLILDVISRT
HIS6_LISIN      --LTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGADELVFLDITATVELRQTMIDVVERT
HIS6_CLOBH      -----RIIPCLDVDMGRVVKGVNFVNLKDVGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKT
HIS6_CLOB1      -----RIIPCLDVDMGRVVKGVNFVNLKDVGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKT
HIS6_THEON      --LAKRIIAALDIKEGRVVKGIKFQNIRDAGDPIELARRYEEEGIDEIVFLDITASFEKRKILLDLVKRI
HIS6_METJA      --LTKRIIPCLDIKDGRVVKGTKFLNLRDAGDPVELAQYYDDEGADELVFLDITASAEKRDIIIDVVERT
HIS6_THEEB      MMLAKRILPCLDVKAGRVVKGVNFVNLRDAGDPVELAQAYNAAGADELVFLDITATHEERNILIDVVYRT
HIS6_RHOBA      --LSARVIPCLDVHGGRVVKGTNFVNLRDAGDPVEVARRYEAEGADELVFLDITASHEERAILLDVVRRT
HIS6_LISMO      --LTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGADELVFLDITATVELRQTMIDVVERT
HIS6_PYRFU      --LARRIIAALDIKDGRVVKGIKFKNIRDAGDPIELAKRYESEGIDEIVFLDITASYEKRKILLDLVERV
HIS6_HALOH      --LTKRIIPCLDVKGGRVVKGVNFKDLRDEGDPVELARYYDREGADELVFLDITASAENRGIVIDMVEKT
HIS6_CLOB6      -----RIIPCLDVDMGRVVKGVNFVNLKDVGDPVEIAEFYNKEGADEIVFLDISATHEGRATMIDVVRKT
HIS6_BACC0      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_RHILO      --LKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVIART
HIS6_METM7      --LTKRIIPCLDIKEGRVVKGTNFVELRDAGDPVELSKIYNEQGADELVFLDITASFEKRDIIIDVVKRT
HIS6_METM5      --LTKRIIPCLDIKEGRVVKGTNFVELRDAGDPVELSKIYNEQGADELVFLDITASFEKRDIIIDVVKRT
HIS6_BACC3      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVKKT
HIS6_BACAH      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVKKT
HIS6_SYNWW      ---AKRIIPCLDVHGGRVVKGTNFINLRDAGDPVEFAAFYDKEGADELVFLDISATSEERQTMVEVVRQT
HIS6_PYRAE      MDVALRIIPCLDIDGGVVVKGVNFQGIREVGDPVEMAVRYEEEGADEIAILDITAAPEGRATFIDSVKRV
HIS6_METM6      --LTKRIIPCLDIKEGRVVKGTNFVELKDAGDPVELSKIYNEQGADELVFLDITASFEKRGIIIDVVKRT
HIS6_METBU      --LTKRIIPCLDVSGGTVVKGVEFVDLKKAGDPVDLAKRYNEQGADELVFLDITASHEGRSTMIDVIERT
HIS6_LISW6      --LTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGADELVFLDITATVELRQTMIDVVERT
HIS6_GEOSM      --LTKRIIPCLDVKGGRVVKGVQFLGLRDAGDPVEIAELYDQQGADELTFLXXXXXXXXXXXXXXXXXXX
HIS6_CARHZ      --LTVRIIPCLDVNKGRVVKGVNFLNLVDAGDPVELAAFYDREGADEVVFLDITASFEGRQTMVEVAKRT
HIS6_AQUAE      --LAKRIIPCLXXXXXXXXXXXXFLNLRDAGDPVEVAKRYEEEGADELVFLDITASAEDREIMIDVVKKV
HIS6_METVS      --LTKRIIPCLDIKEGRVVKGTNFLELRDAGDPVELSKIYNEQGADELVFLDITASFEKRDIIIDVVKRT
HIS6_CLOBL      -----RIIPCLDVDMGRVVKGVNFVNLKDVGDPVEIAEFYNKEGADEIVFLDISATHEGRAIMIDVVRKT
HIS6_CHLSY      --LTRRIIPCLDVKAGRVVKGVKFLNHRDAGDPVELAAAYNAAGADELVFYDITASSDERAIMVEVVERT
HIS6_CHLAA      --LTRRIIPCLDVKAGRVVKGVKFLNHRDAGDPVELAAAYNAAGADELVFYDITASSDERAIMVEVVERT
HIS6_GEOBB      --LTKRIIPCLDVKGGRVVKGVQFLGLRDAGDPVEIAELYDQQGADELTFLXXXXXXXXXXXXXXXXXXX
HIS6_METMP      --LTKRIIPCLDIKEGRVVKGTNFVELRDAGDPVELSKIYNEQGADELVFLDITASFEKRDIIIDVVKRT
HIS6_CELJU      MPLAKRIIPCLDVDNGRVVKGVKFLDIRDAGDPVEIAKRYNQEGADEITFLDITATHEGRDTTVHTVEKI
HIS6_CAUSK      --LKTRIIPCLDVKDGRVVKGVNFVALRDAGDPVEQARAYDAAGADELMFLDITASSDNRGLLLDVISRT
HIS6_BACCR      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAEAYNEAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_SYNY3      MTLAKRILPCLDVNAGRVVKGINFVDLQDAGDPVELARAYNEAGADELVFLDITATHEQRDTIIDVVYRT
HIS6_RHISN      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_RHIME      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVVART
HIS6_METMA      --LTKRIIPCLDVTGGCVVKGVEFVDLKEAGDPVELAKRYNEDGADELVFLDITASAHGRETMIDVIERT
HIS6_HERA2      --LTRRIIPCLDVKAGRVVKGISFLNHRDAGDPVQLAAFYNESGADELVFYDITASSDERNIMVEVVENV
HIS6_CAMFF      ---AKRIIPCLDVNNGRVVKGINFVGLRDAGDPVEVAKRYNDEGADELCFLDITASSDGRDTIVHVVEEV
HIS6_BREBN      --LAKRIIPCLDVKDGRVVKGMQFVGLRDAGDPVELAKKYSDERADELIFLDISASHEGRKTMVDVIEKT
HIS6_CAMHC      -NFAKRIIPCLDVNNGRVVKGVNFVNLIDAGDPVEVAKIYNDSGADELCFLDITASFENRDTIVEVVRNV
HIS6_BACCQ      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_METSB      --LKSRIIPCLDVKDGRVVKGVNFVDLTDAGDPVEAAIRYDAAGADELCFLDITASSDDRPILLDVVRRT
HIS6_BACWK      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVEQT
HIS6_NAUPA      ---AKRIIPCLDVKDGRVVKGVNFVGLRDAGDPVEAAIRYNEEGADELTFLDITASHEGRKPIVDIVKEV
HIS6_GEOKA      -----RIIPCLDVKDGRVVKGVQFVQLRDAGDPVELAKAYDEQGADELVFLDISASHEGRKTMVDVVERV
HIS6_BACHK      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_BACAN      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_BACAC      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_BACAA      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_RHOS5      --LKTRIIPCLDVADGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDIHATHENRGTMYDLVTRT
HIS6_HELHP      MSLAKRIIPCLDINGGRVVKGVNFIGLQDAGDPVEIARRYNDEGADEIVLLDITASYEQRGIMIEVVKNI
HIS6_THEYD      --LAKRIIPCLDVKDGRVVKGVNFLNLRDAGDPVENALYYNEEEADELVFLDVTASHEKRKIIIDVVERT
HIS6_STRSV      --LKKRIIPCLDVKDGRVVKGINFVNLTDVGDPVDAAKAYYEAGCDELVFLDITATHEERDTTVEMVRRV
HIS6_GLOVI      --LAKRIVPCLDVKAGRVVKGVNFVGLRDAGDPVELAKLYNDQGADELVFLDIAATHEERAILIDVVYRT
HIS6_BACCZ      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_BACC4      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAEAYNVAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_BACC1      --LAKRVIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIVDVVEKT
HIS6_ALKMQ      -----RIIPCLDVRKGRVVKGVNFVDIKDAGDPVALARAYNDQGADEIVFLDITASHEERYILLDVVKKT
HIS6_DEHSB      -----RVIPCLDVNNGRVVKGTSFVNLRDAGDPVELAARYYREGADELVFLDISATTEERKTMAEVVEKV
HIS6_BRAJA      ----VRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELTFLDITATHENRGIMLDVVRRT
HIS6_BACC7      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAALYNDAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_ALCBS      MGLAKRIIPCLDVDAGRVVKGVQFVDIRDAGDPVEIAKRYNDAGADEITFLDITASHQERDTTLHTVEQI
HIS6_SYNP6      --LAKRILPCLDVKAGRVVKGVNFVDLRDAGDPVELAQAYDAAGADELVFLDIAATHEERQILVDVVYRT
HIS6_DEHSC      -----RVIPCLDVNNGRVVKGTSFVNLRDAGDPVELAARYYREGADELVFLDISATTEERKTMAEVVEKV
HIS6_ACIAC      --LAKRIIPCLDVTGGRVVKGVNFLELRDAGDPVEIAARYNGQGADELTFLDITATSDGRDLILPIIEAV
HIS6_SINMW      MTLKARVIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRETIFDVIART
HIS6_SILST      --LKTRLIPCLDVADGRVVKGVNFVGLRDAGDPVEXXXXXXXXXXDEICFLDIHATHENRGTMFDMVRRT
HIS6_POLNS      --LTKRIIPCLDVTAGRVVKGVNFVGLRDAGDPVEIAKRYDTQGADELTFLDITATSDGRDLILHIIEDV
HIS6_METAC      --LTKRIIPCLDVTGGCVVKGVEFVDLKEAGDPVELAKRYNEDGADELVFLDITASAHGRETMIDVIERT
HIS6_VESOH      MSLAIRIIPCLDVCDGRVVKGTKFIDIKDAGDPVEVAKRYDLEGADEIIFLDITASIDGRDTMIHMVEAI
HIS6_PROAC      --MAIRVIPCLDVKDGRVVKGVNFVGLRDAGDPVELAAEYGRLGADEVTFLDISASTEGRATTREMVTRC
HIS6_PELUB      -----RIIPCLDVKNGRVVKGINFVDLKDAGDPVEQAKIYSDGGADEICFLDITASKENRDTIYDVVERT
HIS6_GEOTN      -----RIIPCLDVKDGRVVKGVQFVQLRDAGDPVELAKAYDEQGADELVFLDISASHEGRKTMVDVVERV
HIS6_STRGC      --LKKRIIPCLDVKDGRVVKGINFVNLTDVGDPVDASKAYYEAGCDELVFLDITATHEERDTTIEMVRRV
HIS6_OCEIH      --LAKRIIPCLDVDNGRVVKGKKFLDIQDVADPVELAKRYNDEGADELVFYDITASNEQRGIFLDVVEKV
HIS6_METBF      --LTKRIIPCLDVTGGCVVKGVEFVDLKEAGDPVELAKRYNEEGADELVFLDITASAQGRKTMIDVIERT
HIS6_BRASO      ----VRVIPCLDVKDGRVVKGVNFVNLRDAGDPVEXXXXXXXXXXDELCFLDITATHENRGIMLDVVRRT
HIS6_JANSC      --LKTRIIPCLDVAEGRTVKGVNFVDLIDAGDPVEQARAYDLAGADELCFLDIKATHENRGTMYDLATRT
HIS6_DEHE1      -----RVIPCLDVNNGRVVKGTSFVNLRDAGNPVELAARYYREGADELVFLDISATTEERKTMAEVVEQV
HIS6_BACC2      --LAKRIIPCLDVKEGRVVKGVNFIGLQDVGDPVEIAEAYNEAGADEIVFLDITATHEGRKTIIDVVEKT
HIS6_SACD2      MPLAKRIIPCLDVDKGRVVKGVQFVDIRDAGDPVEVAKKYNEQGADEITFLDITASVEGRETTVQTVEKI
HIS6_LYSSC      --LTKRIIPCLDVKEGRVVKGIQFVSIRDAGDPVELAKFYDEQGADELVFLDISASHEGRETMIEVVQQT
HIS6_BRASB      ----VRVIPCLDVKDGRVVKGVNFVNLRDAGDPVEXXXXXXXXXXDELCFLDITATHENRGIMLDVVRRT
HIS6_RHOP5      ----VRVIPCLDVKDGRVVKGINFVDLRDAGDPVEXXXXXXXXXXDELTFLDITATHENRGIMLDVVRRT
HIS6_NITWN      ----VRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELTFLDITATHENRGIMLDVVRRT
HIS6_CLOPH      -----RIIPCLDVHNGRVVKGTNFLNLRDAGDPVLVGAEYGQAGADELVFLDITASSDARTIKLDMVRKV
HIS6_RUTMC      MPLAKRIIPCLDVCNGRVVKGTKFVDIKDAGDPVEVAKRYDFECADEITFLDITASIEGRDTMIHMVEAI
HIS6_RHOPB      ----VRVIPCLDVKDGRVVKGINFVDLRDAGDPVEXXXXXXXXXXDELCFLDITATHENRGIMLDVVRRT
HIS6_PROM9      --VALRLIPCLDVAHGRVVKGVNFVNLRDSGDPVELACRYSDEGADELVFLDIRASVENRNTLVDLVSRT
HIS6_PARDP      --LKTRVIPCLDVADGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDEICFLDIHATHENRGTMYDLVTRT
HIS6_MESSB      MTLKARVIPCLDVKDGRVVKGVQFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASHENRETIFDVIART
HIS6_PROM0      --VALRLIPCLDVAHGRVVKGVNFVNLRDSGDPVELACRYSDEGADELVFLDIRASVENRNTLVDLVSRT
HIS6_RHOSK      --LKTRIIPCLDVADGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDIHATHENRGTMYDLVTRT
HIS6_SULTO      ---AKRIIACLDVKNGRVVKGVNFLNLKDKGDPVELASRYEEEGADEIVFLDITATIEGRKALLEVVKNT
HIS6_ALHEH      MTVAKRIIPCLXXXXXXXXXXXXXXXIRDAGDPVEIARRYDAMGADEITFLDITASHERRDTMVQVVEKV
HIS6_PROMS      --VALRLIPCLDVAHGRVVKGVNFVNLRDSGDPVELACRYSDEGADELVFLDIRASVENRNTLVDLVSRT
HIS6_VEREI      --LTKRIIACLDVTGGRVVKGVNFVGLRDAGDPVAVAARYNAQGADELAFLDITATSDERDLILPIIEAV
HIS6_CHLAD      --LTRRIIPCLDVKAGRVVKGVKFLNHRDAGDPVXXXXXXXXXXXDELVFYDITASSDERAIMVEVVERT
HIS6_ZYMMO      MTLCTRIIPCLDVADGRVVKGVNFTDLMDAGDPVEQAKVYDAAGADELCFLDISASHEGRGTMLDVVART
HIS6_RHOS4      --LKTRIIPCLDVADGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDIHATHENRGTMYDLVTRT
HIS6_PROM1      --VALRLIPCLDVSNGRVVKGVNFVGLRDAGDPVELGCRYSKAGADELVFLDITATHEKRSTLVDMVRRT
HIS6_CAMC5      ---AKRIIPCLDVKDGRVVKGVNFVGLIDAGDPVEVAKRYNEEGADELAFLDITATHLGQETMVETIARV
HIS6_METKA      MALAKRIIPCLDVKDGRVVKGVRFRGLRDAGDPAELAHHYYRHGADEIVFLDISASPEGRRLMVDVVRRT
HIS6_HYDS0      --LAKRIIPCLDIKDGRVVKGINFVDLKDAGDPVENAIVYEEQKADEIVFLDITASYEKRNTVIDLAKRV
HIS6_GEOSW      -----RIIPCLDVKDGRVVKGVQFVQLRDAGDPVELAKFYDKQGADELVFLDISASHEGRKTMVEVVEKV
HIS6_ACICJ      --LKLRVIPCLDVKDGRVVKGVNFVSLRDAGDPVEQAVVYDRAGADELTFLDITASHENRDTIIDVVGRT
HIS6_METPB      --LKTRIIPCLDVKDGRVVKGVQFLELRDAGDPVESAKAYDAAGADELCFLDITASHEDRGTLLDVVSRT
HIS6_JANMA      MTLAKRIIPCLDVTAGRVVKGVNFLELRDAGDPIEIARRYDEQGADEITFLDITATSDGRDLILDIIEAV
HIS6_ANOFW      -----RIIPCLDVKDGRVVKGVQFVSLRDAGDPVELARAYDEQGADELVFLDISASHEGRKTMVDVVRRV
HIS6_XANP2      --LKVRVIPCLDVKDGRVVKGVQFVDLRDAGDPVEAARAYDLAGADELTFLDITASHENRGTILDVVRRT
HIS6_SALRD      MPLAKRIIPCLDVDEGRVVKGINFVDIRDAGDPVEQARTYDAAGADELVFLDITATHEDRDIMHDVVRRT
HIS6_RHOS1      --LKTRIIPCLDVADGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDIHATHENRGTMYDLVTRT
HIS6_PROM2      --VALRLIPCLDVANGRVVKGVNFVNLRDSGDPVELACRYSDEGADELVFLDIRASVENRNTLVNLVSRT
HIS6_CLOB8      -----RIIPCLDVKEGRVVKGINFEGLVDVGDPVALAEYYNKQGADELVFLDITATHEKRGIMEKVVQSV
HIS6_BACCN      --LAKRIIPCLDVKAGRVVKGVNFIGLQDIGDPVEIAALYNQAGADEIVFLDITATYEERKTIVDVVEKT
HIS6_PROMT      --VALRLIPCLDVSNGRVVKGVNFVGLRDAGDPVELGCRYSKAGADELVFLDITATYEKRSTLVDMVRRT
HIS6_PROM5      --VALRLIPCLDVANGRVVKGVNFVNLRDSGDPVELACRYSEAGADELVFLDIRASVENRKTLVDLVSRT
HIS6_UNCTG      --LGIRVIPCLDVTDGRVVKGTNFVNLKDAGDPVEVAKQYNSDGADELVFLDITATHEXXXXXXXXXXXX
HIS6_RHOFD      --LAKRIIPCLDVTGGRVVKGVNFVELRDAGDPVEIAARYNDQGADELTFLDITATSDGRDLILHIIEAV
HIS6_LISMH      --LTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGADELVFLDITATVELRQTMIDVVERT
HIS6_PROMP      --VALRLIPCLDVANGRVVKGVNFVNLRDSGDPVELACKYSEAGADELVFLDIRASVENRKTLVDLVSRT
HIS6_DEIRA      --LAKRIVPCLDVQNGRVVKNVRFEDHRDAGDPLVLAQAYEAQQADELVFYDITATHEGRSLMLDVAARV
HIS6_META3      --LTKRIIPCLDIKNGRVVKGTNFVELRDAGDPVELSKIYNEQGADELVFLDIGASHEKRDIIEHLVEKT
HIS6_BACHD      --LTKRIIPCLDVKDGRVVKGVQFVDLRDAGDPVELAAFYDEQGADELVFLDISASHEGRETMIDVVEKV
HIS6_NITHX      ----VRVIPCLDVKDGRVVKGVNFVDLRDAGDPXXXXXXXXXXXXXXLTFLDITATHENRGIMLDVVRRT
HIS6_BACLD      -----RIIPCLDVKDGRVVKGVQFVELKDAGDPVELAEVYDHEGADELVFLDISASHEGRKTMVDVVERV
HIS6_POLSQ      --LTKRIIPCLDVTAGRVVKGVNFVGLRDAGDPVEIARRYDSQGADELTFLDITATSDGRDLILHIIENV
HIS6_LACPL      --LAKRIIPCLDVADGRVKKGVNFVNLTDVGDPVAIAAAYQQQGADELVFLDIAATNEHRETMAAMVEQV
HIS6_PARL1      MTLKARLIPCLDVKDGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDITASHEERAIIFDVVRRT
HIS6_DICTD      --LAKRIIPCLDTIGKKVVKGTSFINVRVVGDAKELARRYEKEGADEIVLLDITASEEGRSTFVDVVTDV
HIS6_SYNSC      --VALRLIPCLDVARGRVVKGVNFVGLRDAGDPVELACRYSRAGADELVFLDIAASHEGRGTLIDMVRRT
HIS6_DICT6      --LAKRIIPCLDTIGRNVVKGTSFVNIRIVGDAKELARRYEREGADEIVLLDITASEEGRGTFVDVVTEV
HIS6_DESVM      --LSKRIIPCLDVRNGRLTKGVKFEGNVDIGDPVETARRYYEQGADEIVFYDITASHEDRGIFLDVVERV
HIS6_BACSK      --LAKRIIPCLDVKEGRVVKGTQFLSLRDAGDPVELAAFYDKEGADELVFLDISASHEGRETMVDVVREV
HIS6_THEMA      --LAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
HIS6_SULAC      -----RIIPCLDVKDGRVVKGVNFLNLVDKGDPVELAARYEEEGADEIVFLDITATIEGRKTMMNVVKDT
HIS6_LISMF      --LTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGADELVFLDITATVELRQTMIDVVERT
HIS6_LISMC      --LTKRIIPCLDVTAGRVVKGVNFVSLTDVGDPVEIAKAYNEAGADELVFLDITATVELRQTMIDVVERT
HIS6_HALMA      MTLTKRIIPCIDVDDAAVYTGVNFEDLEYTGDPVEMAKAYNESGADEFVFLDITASAEGRETMLDTVSAV
HIS6_DESDG      --LSKRIIPCLDVRDGRLTKGIKFQGNVDIGDPVESARRYYEQGADEIVFYDITASHEGRGIFLDIVEKV
HIS6_CLOBA      -----RIIPCLDVKDGRVVKGINFKGIIDVGNPVDLAKHYNDQGADELVFLDITATHEKRGIMMRVVEEV
HIS61_SYNPX     --VALRLIPCLDVARGRVVKGVNFVGLRDAGDPVELACRYSGAGADELVFLDIAASHEGRGTLIDMVHRT
HIS6_EXIS2      --LMKRIIPCLDVKEGRVVKGVKFQNLRDLGDPVAVAKYYYEQGADELVLLDISATQEGRDTMLDIVERV
HIS6_SPHAL      MTVRVRVIPCLDVADGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDISASHQGRGTLLDLVSRT
HIS6_THESQ      --LAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
HIS6_METRJ      --LKTRIIPCLDVKDGRVVKGVRFEGLRDAGDPVEAAKVYDAAGADELCFLDITASREARGTLLDIVSRT
HIS6_RHOCA      --LKTRIIPCLDVADGRVVKGVNFVNLIDAGDPVEXXXXXXXXXXDELCFLDIHATHENRGTMFDLVTRT
HIS6_HALSA      MTLTKRVIPCIDVDEPAVYTGVNFEELAYTGDPVEMAKRYNEAGADEFVFLDITASAEGRETMLDTVSAV
HIS6_HALS3      MTLTKRVIPCIDVDEPAVYTGVNFEELAYTGDPVEMAKRYNEAGADEFVFLDITASAEGRETMLDTVSAV
HIS6_CAMC1      ---AKRIIPCLDVKDGRVVKGVNFVGLVDAGDPVEIAKRYNDEGADELCFLDITASHLGRDTIVDVVKKV
HIS6_DESVV      --LSKRIIPCLDVRAGRLTKGVKFEGNVDIGDPVATARRYYEEGADEIVFYDITASHEDRGIFLDVVERV
HIS6_DESVH      --LSKRIIPCLDVRAGRLTKGVKFEGNVDIGDPVATARRYYEEGADEIVFYDITASHEDRGIFLDVVERV
HIS6_AGRT5      MTLKARIIPCLDVKDGRVVKGVNFVDLIDAGDPVEXXXXXXXXXXDELCFLDITASSDNRDTIFDVVSRT
HIS6_SYNS9      --VALRLIPCLDVARGRVVKGINFVGLRDAGDPVELACRYSHAGADELVFLDIAASHEGRATLVDLVRRT
HIS6_METC4      --LKTRIIPCLDVKDGRVVKGVQFLELRDAGDPVESAKAYDAAGADELCFLDITASHEARGTLLDVVSRT
HIS6_BACP2      -----RIIPCLDVKEGRVVKGVQFLGLKDAGDPVELAQIYDEEGADELVFLDISASHEGRKTMVDVVKQV
HIS61_PROMM     --VALRLIPCLDVADGRVVKGVNFVGLRDAGDPVELACRYSQAGADELVFLDIAASHEGRATLVALVRRT
HIS6_NATPD      MALTKRIIPCIDVDEAAVYTGVNFEDLEYTGDPVELAKKYNEAGADEFVFLDITASAEGRETMLDTVSAV
HIS6_METEP      --LKTRIIPCLDVKDGRVVKGVQFLELRDAGDPVESAKAYDAAGADELCFLDITASHEARGTLLDVVSRT
HIS6_EXISA      -----RIIPCLDVKEGRVVKGIEFVQLRDIGDPVEIAKYYDESGADELVFLDITASTERRQTMLDVVSAV
HIS6_SYNS3      --VALRLIPCLDVAKGRVVKGVNFVGLRDAGDPVELACRYSEAGADELVFLDIAASHEGRATLVDLVRRT
HIS6_PROA2      --LAKRIIPCLDVRDGRVVKGINFEGLRDAGSILEQARFYNGELADELVFLDISASLESRKTTLGEVLKV
HIS6_METNO      --LKTRVIPCLDVKDGRVVKGVQFLDLRDAGDPVEAAKAYDRAGADELCFLDITASHEARGILLDVVQRT
HIS6_SYNFM      --LSKRIIPCLDVRDGRTTKGIKFRNNVDIGDPVDMGRFYYEEGADEIVFYDITASSDRRGIMLDVVKRV
HIS6_LACLS      --LTKRIIPCLDIKNGKVVKGINFVGLKEIGDPVEIAKIYEEQCADEIVFLDITASFXXXXXXXXXXXXA
HIS6_HERAR      MTLAKRIIPCLDVTAGRVVKGVNFLELRDAGDPVEIARRYDDQGADELTFLDITATSDGRDLILDIIEAV
HIS6_SPHWW      MTVRVRVIPCLDVAGGRVVKGVNFVDLADAGDPVEQARVYDAAGADELCFLDITASHEGRGTILDVVART
HIS6_GRAFK      --LTKRIIPCLDIKNGRTVKGVNFVDLRDAGDPVELAAAYAEKGADELVFLDISATEEKRKTLAKLVLDV
HIS6_DESDA      --LSKRVIPCLDVRNGRLTKGVKFVGNEDIGDPVESARRYYEEGADEIVFYDITASAEARGIFLDVVERV
HIS6_BACFN      --LAKRIIPCLDIKDGQTVKGTNFVNLRQAGDPVELGRAYSEQGADELVFLDITASHEGRKTFAELVRRI
HIS6_RHOPT      ----VRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDITATHENRGIMLDVVRRT
HIS6_RHOPA      ----VRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDITATHENRGIMLDVVRRT
HIS6_BACFR      --LAKRIIPCLDIKDGQTVKGTNFVNLRQAGDPVELGRAYSEQGADELVFLDITASHEGRKTFAELVRRI
HIS6_LEPIC      -NLTARVIPCLDIKDGRVVKGVNFVNLVDAGDPVESAAIYEENLADELCFLDITASSDRREILLHLVERI
HIS61_LEPIN     -NLTARVIPCLDIKDGRVVKGVNFVNLVDAGDPVESAAIYEENLADELCFLDITASSDRREILLHLVERI
HIS6_PROM4      --VALRLIPCLDVANGRVVKGVNFVGLRDAGDPVELAYRYSKSGADELVFLDIAASHEGRATLIEIVRRT
HIS6_LACF3      --LTKRIIPCLDVTDGRVKKGVNFVNLVDVGDPVAIARRYQEQGADELVFLDITATNQGRQATVDMVAAV
HIS6_ELUMP      --LAKRIIPCLDVKDGKTVKGVNFINFRDAGDPVALAAEYSRKGADEIVFLDITASHEKRKTLTDLARRV
HIS6_BACTN      --LAKRIIPCLDIKDGQTVKGTNFVNLRQAGDPVELGRAYSEQGADELVFLDITASHEGRKTFTELVKRI
HIS6_SULSO      -----RIIACLDVKDGNVVKGVNFLNLQLKGDPVSLASLYEEEGADEIVFLDITATIEARKALYNVIKDT
HIS6_RHOP2      ----VRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDITATHENRGIMLDVVRRT
HIS6_DEIGD      --LTKRIIPCLDVQNGRVVKNVRFENHRDAGDPXXXXXXXXXXXXXXXVFYDITATHEGRQLLLDVAARV
HIS6_METTH      --LAKRIIPCLDCDNGRVVKGVEFKQIRYAGDPVELATRYYEDGADEIVFLDITASHERRETMTHVIEAT
HIS6_LACLM      --LTKRIIPCLDIKNGKVVKGINFVGLKEIGDPVELAKIYEEQCADEIVFLDITASFXXXXXXXXXXXXA
HIS6_LACCB      --LTKRIIPCLDVDHGRVKKGINFVQLKDVGDPVAIAKAYQEQGADELVFLDITATNEARGTLVQTVEAV
HIS6_LACC3      --LTKRIIPCLDVDHGRVKKGINFVQLKDVGDPVAIAKAYQEQGADELVFLDITATNEARGTLVQTVEAV
HIS6_HALWD      --LTKRIIPCIDVDNPAVYTGINFEDLEYTGDPVEMAKQYNMAGADEFVFLDITASAVGRETMLETVSRV
HIS6_FLAJ1      --LAKRIIPCLDIKNGRTVKGVNFVDLRDAGDPVELAEIYSREGADELVFLDISATEERRKTLVNMVRSV
HIS6_DESOH      --LTRRIIPCLDVRDGRTTKGIKFENNVDIGDPVEMAKVYYEAGADEIVFYDITASHEKRGLMIDVVRKV
HIS6_DESAA      --LSKRVIVCLDVRDGKTTKGIKFKGNVDIGDPVDMARVYYEAGCDELVFYDITASHEKRGIMIDVVRRV
HIS6_ACIC5      --LTRRIIACLDVTNGRVVKGVQFLDLMDAGDPAELAARHAASGADEIVLLDITATHEGRGTLLETVRKT
HIS6_LEUMM      MTLAKRIVPALDIKNGRVVKGVNFVNLREVGDPVESAKAYQAAGADELVFLDITATLEERDTIMSVVDAV
HIS6_FLAPJ      --LTKRIIPCLDIKNGRTVKGVNFLDLKDAGDPVALAQKYAEEGADELVFLDISATEEDRKTVIDLVRKV
HIS6_PROMA      --VALRLIPCLDVANGRVVKGVNFVGLRDAGDPVELACRYSREGADELVFLDIAASHEARATLVEIVRRT
HIS6_PELLD      --LAKRIIPCLDVRDGRVVKGINFEGLRDAGSILEQARFYNNELADELVFLDISASLESRRTTLEEVLKV
HIS6_OLICO      ----VRVIPCLDVKDGRVVKGVNFVGLRDAGDPVEXXXXXXXXXXDELCFLDITATHENRGTILDVVKRT
HIS6_NITMS      --LTKRIIPCLDVDNGRVVKGLNFESIKDAGDPVELAAKYSKDGADELVFLDITASQEKRKTIKELVSNV
HIS6_CYTH3      --LTKRIIPCLDVKDGKTVKGVNFLNLRDAGDPVELGALYSQQGADELVFLDITATLEKRGTLVELVKRV
HIS6_CHLPB      --LAKRIIPCLDVREGRVVKGINFEDLRDAGSILEQARFYNNELADELVFLDISASLESRKTTLEEVLKV
HIS6_BEII9      --LKARVIPCLDVKDGRVVKGVNFVDLRDAGDPVQCAIAYDAAGADELCFLDITASHEDRGILLDVVERT
HIS6_BACSU      -----RIIPCLDVKEGRVVKGIQFLELKDAGDPVELAEVYDREGADELVFLDISASHEGRKTMVDVVEQV
HIS6_MYXXD      --LTRRLVVCLDVKGGRVVKGVQFEGLRDVGDPVELARRYEAEGADELTFLDISASAEERDTLWELVRRT
HIS6_LACLA      --LTKRIIPCLDIKNGKVVKGINFVGLREIGDPVELAKIYEEQCADEIVFLDITASFXXXXXXXXXXXXA
HIS6_DESAH      --LSKRIIPCLDVRAGKTTKGIKFQNNVEIGDPVEMAKFYYEAGADELVFYDITASHEQRGIMIDVVKKV
HIS6_CHLT3      --LAKRIIPCLDVKNGRVVKGVQFEELRDAGSILEQAKFYNDELADELVFLDISASIESRRTTLEEVLKV
HIS6_CHLPD      --LAKRIIPCLDVTGGRVVKGINFEGLRDAGSILEQARFYNNELADELVFLDISASLESRKTTLEEVMKV
HIS6_BACA2      -----RIIPCLDVKEGRVVKGIQFLGLKDAGDPVELAEAYDRESADELVFLDISASHEGRKTMTDVVEQV
HIS6_LEPBL      -NLTARVIPCLDIKDGRVVKGVNFVDLVDAGDPVESAGIYEENLADELCFLDITASSDRREILLHLVERI
HIS6_LEPBJ      -NLTARVIPCLDIKDGRVVKGVNFVDLVDAGDPVESAGIYEENLADELCFLDITASSDRREILLHLVERI
HIS6_PROVI      --LAKRIIPCLDVRDGRVVKGINFEGLRDAGSILEQARFYNNELADELVFLDISASLESRKTTLEEVLKV
HIS6_METS3      --LTKRIIPCLDCDEGRVVKGVEFKEIKYAGNPVDLATRYYEMGADEIVILDITASYERRATMADVIDRL
HIS6_SYMTH      MPLAKRIIPCLDIRDGRVVKNVQFHNTWDAGDPVALAAEYDRQGADEIVFLDINASWEGRSATLDVLSRA
HIS6_HYPNA      --LKTRIIPCLDVKDGRTVKGVNFVDLKDAGDPVXXXXXXXXXXXDELCFLDITASHEGRGTLLETVSRT
HIS6_CHLP8      --LAKRIIPCLDVRDGRVVKGINFEGLRDAGSILEQARFYNNEMADELVFLDISASIESRRTTLEEVLKV
HIS6_LEPBP      --LTKRVIPCLDIKGGRVVKGVQFVNLIDAGDPVSCAVAYEENKADELCFLDITASSDKRDILLHLVEEV
HIS6_LEPBA      --LTKRVIPCLDIKGGRVVKGVQFVNLIDAGDPVSCAVAYEENKADELCFLDITASSDKRDILLHLVEEV
HIS6_BACV8      --LAKRIIPCLDIKDGQTVKGTNFVNLRQAGDPVELGRTYSEQGADELVFLDITASHEGRKTFTDLVKRV
HIS6_PETMO      --LTKRIVAALDIKEGRVVKGVQFENIRDAGDPVELAKKYEKDGVDEIVFLDITASKEKRNILKNLVEEI
HIS6_STACT      -----RIIPCLDVKDGRVVKGVQFKGLRDIGDPVALAAYYNAELADELVFLDISRTENGHQMMLDIIEET
HIS6_CHLCH      --LAKRIIPCLDVRDGRVVKGINFEGLRDAGSILEQARFYNNELADELVFLDISASLESRRTTLEEVMKV
HIS6_ACIBL      -----RIIACLDVRDGRVVKGVNFVNLRDAGSPXXXXXXXXXXXXDEIVLLDITATYEGRGTLLETVRKT
HIS6_NATTJ      --LAKRIIPCLXXXXXXXXXXXXFNELKLAGDPVELAQKYDREGADELVFLDITASIEDRGTMLEVVEKT
HIS6_METST      --LSKRIIPCLDCDEGRVVKGVEFKQIRYAGNPVELATKYYEQGADEIVFLDITASHERRSTMADVIEKT
HIS6_THEP1      --LAKRIIACLDVKDGRVVKGTNFENLRDSGDPVELGKFYSEIGIDELVFLDITASVEKRKTMLELVEKV
HIS6_PELPB      --LAKRIIPCLDVRDGRVVKGINFEGLRDAGSILEQARFYNNELADELVFLDISASLESRKTTLEEVLKV
HIS6_DESMR      --LSKRVIPCLDVRDGKLTKGIKFQGNVDIGDPVETARLYYEAGADELVFYDITASSEGRGIMLDVVDRV
HIS6_CLOD6      --LTRRIIPCLDVRNGRVVKGKKFKDIVDVDSPEVLGKFYSDCGADELVFYDITASNEERKTSLEFVTKV
HIS6_CHLL2      --LAKRIIPCLDVTGGRVVKGINFEGLRDAGSILEQARFYNGELADELVFLDISASVESRKTTLEEVLKV
HIS6_RHOPS      ----VRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEXXXXXXXXXXDELCFLDITATHENRGIMLDVVRRT
HIS6_LEGPN      ----VRLIARLDIKGPNLIKGVHLEGLRVVGNPNEYAMAYYAQGADELIYMDTVASLYGRNNLSEIVKTT
HIS6_PARD8      --LAKRIVPCLDIKDGKTVKGINFVNFRDAGDPVELGAQYSREGADELVYLDITASHEGRKTFTELVKQV
HIS6_STAEQ      -----RVIPCLDVKDGRVVKGIQFQSLRDIGNPVDLALYYNEAGADELVFLDISKTEAGHDLMIEVIEAT
HIS6_SILPO      --LKTRIIPCLDVADGRVVKGVNFVGLRDAGXXXXXXXXXXXXXXXEICFLDIHATHENRGTMFDVVSRT
HIS6_SORC5      --LAKRIIPCLDVKDGRVVKGVRFVGLRDAGDPVEAARRYDAEGADEITFLDITASHEKRGIILDVVART
HIS6_METS4      --LKTRVIPCLDVKDGRVVKGVQFLALRDAGDPVEXXXXXXXXXXDELCFLDITASHEARGILLDVVQRT
HIS6_STAES      -----RVIPCLDVKDGRVVKGIQFQSLRDIGNPVDLALYYNEAGADELVFLDISKTEAGHDLMIEVIEAT
HIS6_AZOPC      --LAKRIIPCLDVKDGKTVKGINFINFRDAGDAVELGRQYSKQGADELVYLDIIASHEERKTFIELVKKV
HIS6_STAS1      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDFALYYNEQGADELVFLDISRTEAGHDLVLDVISET
HIS6_ROSDO      --LKTRIIPCLDVADGRVVKGVNFVDLRDAGXXXXXXXXXXXXXXXELCFLDITATHENRATMFDVVTRT
HIS6_CHLTE      --LAKRIIPCLDVRDGRVVKGINFEGLRDAGSILEQARFYNNEMADELVFLDISASLESRRTTLEEVLKV
HIS6_STAAR      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAAB      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAAN      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAIYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAAM      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAIYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAA9      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAIYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAA2      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAIYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAA1      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAIYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAAW      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAAT      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAAS      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAAE      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAAC      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_STAA3      -----RIIPCLDVKDGRVVKGIQFKGLRDIGNPVDLAMYYNEAGADELVFLDISKTEEGHSLMLEVIEQT
HIS6_METS5      -----RIIACLXXXXXXXXXXXRFLDLKLKGDPAELASRYEEEGADEIVFLDISATVEGRKTLLEKVRET
HIS61_VIBVY     --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_VIBPA      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_VIBHB      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAQRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_VIBVU      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_VIBSL      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAQRYAEEGADELVFYDITASSDGRVVDKSWVKRV
HIS6_CAMJ8      --LTKRIIACLDVKDGRVVKGTQFKNHKDMGDIIELARYYSQNGIDELVFYDIAASARKERISREWVSEV
HIS6_VIBCM      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_VIBCH      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_VIBC3      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_XANCP      --LSRRIIPCLDVRDGRVVKGVKFRDHIDMGDIVELAMRYRDQGADELVFYDIGASPEGRSVDYAWVERV
HIS6_XANC8      --LSRRIIPCLDVRDGRVVKGVKFRDHIDMGDIVELAMRYRDQGADELVFYDIGASPEGRSVDYAWVERV
HIS6_CAMJD      --LTKRIIACLDVKDGRVVKGTQFKNHKDMGDIIELARYYSQNGIDELVFYDIAASARKERISREWVSEV
HIS6_XANOR      --LSRRIIPCLDVRNGRVVKGVKFHDHIDMGDIVELALRYRAQGADELVFYDIGASPEGRSVDYTWVERV
HIS6_XANOM      --LSRRIIPCLDVRNGRVVKGVKFHDHIDMGDIVELALRYRAQGADELVFYDIGASPEGRSVDYTWVERV
HIS6_XANC5      --LSRRIIPCLDVRDGRVVKGVKFRDHIDMGDIVELALRYRAQGADELVFYDIGASPEGRSVDYTWVERV
HIS6_ECO81      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_CITK8      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_XANCB      --LSRRIIPCLDVRDGRVVKGVKFRDHIDMGDIVELAMRYRDQGADELVFYDIGASPEGRSVDYAWVGRV
HIS6_ESCF3      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOSM      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOLI      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECODH      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOBW      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECO7I      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECO5E      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECO57      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECO45      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECO27      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_SHIDS      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_SHIBS      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOLU      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_PECCP      --LAKRIIPCLDVRNGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_XANAC      --LSRRIIPCLDVRDGRVVKGVKFRDHIDMGDIVELALRYRAQGADELVFYDIGASPEGRSVDYTWVERV
HIS6_ENT38      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_ECOK1      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_SHISS      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOUT      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOL6      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOL5      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOHS      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECO55      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_SERP5      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_CAMJR      --LTKRIIACLDVKDGRVVKGTQFKNHKDMGDIIELARYYSQNGIDELVFYDIAASARKERISREWVSEV
HIS61_CAMJE     --LTKRIIACLDVKDGRVVKGTQFKNHKDMGDIIELARYYSQNGIDELVFYDIAASARKERISREWVSEV
HIS6_SHIB3      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOSE      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECOLC      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ECO8A      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_ERWCT      --LAKRIIPCLDVRNGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_CAMLR      --LTKRIIACLDVKDGRVVKGMQFKNHEDMGDVIELAKFYSQNGIDELVFYDITASAKNERINRAWVSKV
HIS6_ECO24      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_SALTY      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALTI      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALPK      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALPC      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALPB      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALPA      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALNS      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALHS      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALG2      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALEP      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALDC      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_KLEP7      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_SALCH      --LAKRIIPCLDVRDGQVMKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALAR      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_KLEOX      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_COLP3      --LARRIIPCLDVRDGKVVKGVQFRNHEIIGDIVPLAKQYAEAGADELVFYDITASSDGRVVDKSWVSRI
HIS6_SHIFL      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_SHIF8      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_KLEP3      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_VIBFM      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_ALISL      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALSV      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_ALTMD      --LAKRIIPCLDVRDGKVVKGVQFRNHEIIGDIVPLAEQYAKAGADELVFYDITASSDARVVDKSWVSRI
HIS6_VIBF1      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_TOLAT      --LARRIIPCLDVKDGVVVKGIQFRNHEVMGDIVPLAKRYADEGADELVFYDITASSDARVVDKSWVSRV
HIS6_PHOPR      --LAKRIVPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVARV
HIS6_SALA4      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYADEGADELVFYDITASSDGRVVDKSWVARV
HIS6_ENTS8      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRVVDKSWVTRV
HIS6_ACTP7      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRTVDKSWVERV
HIS6_PROMH      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAERYAKEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_EDWI9      --LAKRIIPCLDVRDGQVVKGVQFRHHEIIGDIVPLARRYADEGADELVFYDITASADGRVVDKSWVARV
HIS6_XYLFT      --LSRRIIPCLDVRDGRVVKGVKFRDHVDMGDIVELALRYRDHGADELVFYDIGASPQGRSVDYRWVERV
HIS6_XYLFM      --LSRRIIPCLDVRDGRVVKGVKFRDHVDMGDIVELALRYRDHGADELVFYDIGASPQGRSVDYRWVERV
HIS6_XYLF2      --LSRRIIPCLDVRDGRVVKGVKFRDHVDMGDIVELALRYRDHGADELVFYDIGASPQGRSVDYRWVERV
HIS6_BAUCH      --LAKRIIPCLDIHNGQVIKGMQFRNHKVIGDIVPMAQRYAKEGADELVFYDITASSEGRVVDKSWIARV
HIS6_XYLFA      --LSRRLIPCLDVRDGRVVKGVKFRDHVDMGDIVELALRYRDHGADELVFYDIGASPRGRSVDYRWVERV
HIS6_PHOLL      --LAKRIIPCLDVRDGQVVKGIQFRHHEIIGDIVPLAQRYATEGADELVFYDITASSDGRVVDKSWITKV
HIS6_IDILO      --LAKRVIPCLDVRDGQVVKGVKFRNHEIIGDILPLAKRYAESGADELVFYDITASADGRTVDKSWVERV
HIS6_YERPS      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVARV
HIS6_YERPB      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVARV
HIS6_PASMU      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAQRYAEEGADELVFYDITASSDGRTIDKSWVERV
HIS6_ACTSZ      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRTVDKSWVERV
HIS6_YERPP      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVARV
HIS6_YERPN      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVARV
HIS6_YERPE      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVARV
HIS6_YERPA      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVARV
HIS6_YERP3      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVARV
HIS6_YERE8      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVSRV
HIS6_SHEFN      --LAKRIVPCLDVREGKVVKGVQFRNHEIVGDIVPLAARYAEEGADELVFYDITASAHDRVIDKSWVSRV
HIS6_PSEA6      --LARRIIPCLDVRDGLVVKGVKFRNHETIGEIVPLAELYAQQGADELVFYDITASSDQRVVDKSWVTRI
HIS6_YERPY      --LAKRIIPCLDVKDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRVVDKSWVARV
HIS6_MANSM      --LAKRIIPCLDVRNGQVVKGVQFRNHEIIGDIVPLAARYAEEGADELVFYDITASSDGRTVDKSWVERV
HIS6_BUCAP      --LAKRIIACLDVNNGVVVKGIQFKNHEIVGDIISLSKRYTKEGIDELVFYDITASTNNKLVDRSWIKKV
HIS6_SHEON      --LAKRIVPCLDVKDGCVVKGVQFRNHEIVGDIVPLAARYAAEGADELVFYDITASAHDRVVDKSWVSRV
HIS6_PSYIN      --LAKRIIPCLDVKDGQVVKGVQFRNHEIVGDIVPLAKRYAEEGADELVFYDITASSDARVVDKSWVSRV
HIS6_SHESR      --LAKRIVPCLDVKDGCVVKGVQFRNHEIVGDIVPLAARYAAEGADELVFYDITASAHDRVVDKSWVSRV
HIS6_SHESM      --LAKRIVPCLDVKDGCVVKGVQFRNHEIVGDIVPLAARYAAEGADELVFYDITASAHDRVVDKSWVSRV
HIS6_SHESA      --LAKRIVPCLDVKDGCVVKGVQFRNHEIVGDIVPLAARYAAEGADELVFYDITASAHDRVVDKSWVSRV
HIS6_BUCBP      --LAKRIIPCLDVKSGIVVKGVQFRNHEIVGGILSLAKRYTQEGADELVFYDIEASSNNRLIKKKWVSQI
HIS6_HAEIN      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRTVDKSWVERI
HIS6_HAEI8      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGADELVFYDITASSDGRTVDKSWVERI
HIS6_SHEWM      --LAKRIVPCLDVREGKVVKGVQFRNHEIVGDIVPLAARYAEEGADELVFYDITASAHDRVIDKSWVSRV
HIS6_SHELP      --LAKRIVPCLDVRDGKVVKGVQFRNHEIVGDIVPLAARYAAESADELVFYDITASAHDRVVDKSWVSRV
HIS6_AERHH      --LSKRIIPCLXXXXXXXXXXXQFRNHEVMGGIVELARRYASEGADELVFYDITASSDERVVDKSWVSRV
HIS6_HAEIE      --LAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAQHYAQEGADELVFYDITASSDGRTVDKSWVERI
HIS6_SHEPW      --LAKRIVPCLDVKEGKVVKGVQFRNHEIVGDIVPLAARYADEGADELVFYDITASAHDRVIDKSWVSRV
HIS6_AERS4      --LSKRIIPCLXXXXXXXXXXXQFRNHEVMGGIVELARRYAEEGADELVFYDITASSDARVVDKSWVSRV
HIS6_SHEPA      --LAKRIVPCLDVKEGKVVKGVQFRNHEIVGDIVPLAQRYAEEGADELVFYDITASAHDRVIDKSWVSRV
HIS6_FRAP2      --LTKRIIPCLXXXXXXXXXXXXFRNHRIIGDIIELAQKYSDAGADELVFYDIGASPDNKLLSIKWIQEI
HIS6_SHESH      --LAKRIVPCLDVKEGKVVKGVQFRNHEIVGDIVPLAARYAEEGADELVFYDITASAHDRVIDKSWVSRV
HIS6_SHEHH      --LAKRIVPCLDVKEGKVVKGVQFRNHEIVGDIVPLAKRYAEEGADELVFYDITASAHDRVIDKSWISRV
HIS6_BLOPB      --LAKRIIPCLDVGNNKVIKGIQFKDHKIVGDILELANRYAKSGADELVFYDITASPNDQVVNKRWISQI
HIS6_BLOFL      --LAKRIIPCLDVINNQVIKGIQFQNHQIIGDIVSLAQYYSQEGADELVFYDIMASPNNQTVSKKWVAKI
HIS6_SODGM      --LAKRIIPCLDVRQGQVVKGVQFRNHEIIGGIVPLVCRYAEEGADELVFYDITASADARVVDKRWIADV
HIS6_BUCAI      --LAKRIIACLXXXXXXXXKGIKFQNHKIVGDIVPLARRYAKEGIDELVFYDITAATKNKLVDRSWIKNV
HIS6_SHEPC      --LAKRLVPCLXXXXXXXXXXXQFRNHEIVGDIVPLAARYAEEGADELVFYDITASAHERVVDKSWVSRV
HIS6_SHEB9      --LAKRLVPCLXXXXXXXXXXXQFRNHEIVGDIVPLAARYAEEGADELVFYDITASAHERVVDKSWVSRV
HIS6_SHEB8      --LAKRLVPCLXXXXXXXXXXXQFRNHEIVGDIVPLAARYAEEGADELVFYDITASAHERVVDKSWVSRV
HIS6_SHEB2      --LAKRLVPCLXXXXXXXXXXXQFRNHEIVGDIVPLAARYAEEGADELVFYDITASAHERVVDKSWVSRV
HIS6_MARMM      --LARRLIPCLXXXXXXXXXXXXXXXHEDVGDIVDLARRYAREGADELVFYDIAASARGRTVEPEWVSAV
HIS6_SHESW      --LAKRLVPCLXXXXXXXXXXXQFRNHEIVGDIVPLAARYAEEGADELVFYDITASAHERVVDKSWVSRV
HIS6_STRMK      --LSRRIIPCLXXXXXXXXXXXXXXXHVDMGDIAELAQRYRDQGADELVFYDIGASPEARSVDVAWIERI
HIS6_SHEB5      --LAKRLVPCLXXXXXXXXXXXQFRNHEIVGDIVPLAARYAEEGADELVFYDI