[GTOP][HELP][ORGANISMS][SEARCH][SUMMARY][COMMENT/QUESTION(gtop-admin@spock.genes.nig.ac.jp)]

Result of BLT:SWS for tfus0:AAZ55274.1

[Show Plain Result]


## Summary of Sequence Search
    1::227
   83::132     1e-09  48%  200 aa  FMNR_SCHPO RecName: Full=NAD(P)H-dependent FMN reductase C4B3.06c; 
   86::139     2e-08  46%  191 aa  LOT6_YEAST RecName: Full=NAD(P)H-dependent FMN reductase LOT6;     
   70::168     1e-07  32%  196 aa  NQR_ARATH RecName: Full=NADPH:quinone oxidoreductase;       
   77::168     1e-07  36%  197 aa  NQR1_ORYSJ RecName: Full=Probable NADPH:quinone oxidoreductase 1;  
    5::187     6e-07  30%  188 aa  YIEF_SHIFL RecName: Full=Uncharacterized protein yieF;
    5::187     6e-07  30%  188 aa  YIEF_ECOLI RecName: Full=Uncharacterized protein yieF;
    5::187     6e-07  30%  188 aa  YIEF_ECO57 RecName: Full=Uncharacterized protein yieF;
   77::173     1e-06  30%  203 aa  NQR2_ORYSJ RecName: Full=Probable NADPH:quinone oxidoreductase 2;  
   66::164     1e-06  32%  194 aa  NQR_SOLTU RecName: Full=NAD(P)H:quinone oxidoreductase;       
   63::176     3e-06  29%  188 aa  AZO1_STAS1 RecName: Full=FMN-dependent NADPH-azoreductase;       
   59::156     3e-05  28%  168 aa  Y342_MYCGE RecName: Full=Uncharacterized protein MG342;
   57::154     4e-04  30%  166 aa  Y517_MYCPN RecName: Full=Uncharacterized protein MG342 homolog;
  110::222     4e-04  23%  318 aa  HEMH_XANAC RecName: Full=Ferrochelatase;       
   83::116     4e-04  47%  211 aa  AZOR_MACCJ RecName: Full=FMN-dependent NADH-azoreductase;       
   78::110     6e-04  48%  213 aa  AZOR3_PSEAE RecName: Full=FMN-dependent NADH-azoreductase 3;       
    9::176     8e-04  23%  188 aa  AZO1_STAHJ RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAAW RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAAU RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAAS RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAAR RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAAN RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAAM RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAAC RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAAB RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAA8 RecName: Full=FMN-dependent NADPH-azoreductase;       
   61::155     8e-04  26%  188 aa  AZO1_STAA3 RecName: Full=FMN-dependent NADPH-azoreductase;       
    1::227

## Multiple Alignment
                         .         .         .         .         +         .         .:70
query           xxxxxxxxxxxxxxxxxxxxxLRLXXXXASARKGRNGGCVAQWFLEQTTGRSELEVDTVDTAVFXXXXXX
FMNR_SCHPO      ----------------------------------------------------------------------
LOT6_YEAST      ----------------------------------------------------------------------
NQR_ARATH       ----------------------------------------------------------------------
NQR1_ORYSJ      ----------------------------------------------------------------------
YIEF_SHIFL      ---------------------LQVVTLLGSLRKGSFNGMVARTLPK--IAPASMEVNALPSIADIPLYDA
YIEF_ECOLI      ---------------------LQVVTLLGSLRKGSFNGMVARTLPK--IAPASMEVNALPSIADIPLYDA
YIEF_ECO57      ---------------------LQVVTLLGSLRKGSFNGMVARTLPK--IAPASMEVNALPSIADIPLYDA
NQR2_ORYSJ      ----------------------------------------------------------------------
NQR_SOLTU       ----------------------------------------------------------------------
AZO1_STAS1      ----------------------------------------------------------------------
Y342_MYCGE      ----------------------------------------------------------------------
Y517_MYCPN      ----------------------------------------------------------------------
HEMH_XANAC      ----------------------------------------------------------------------
AZOR_MACCJ      ----------------------------------------------------------------------
AZOR3_PSEAE     ----------------------------------------------------------------------
AZO1_STAHJ      -----------------------------SAKVGSHTNALAKYLVGQFDTH-DLDVDIYDLAERPLNQLD
AZO1_STAAW      ----------------------------------------------------------------------
AZO1_STAAU      ----------------------------------------------------------------------
AZO1_STAAS      ----------------------------------------------------------------------
AZO1_STAAR      ----------------------------------------------------------------------
AZO1_STAAN      ----------------------------------------------------------------------
AZO1_STAAM      ----------------------------------------------------------------------
AZO1_STAAC      ----------------------------------------------------------------------
AZO1_STAAB      ----------------------------------------------------------------------
AZO1_STAA8      ----------------------------------------------------------------------
AZO1_STAA3      ----------------------------------------------------------------------


                         .         .         *         .         .         .         .:140
query           XXXXXXTTVQVLSRLTPRLRRADMFVFVVPEYNRSFPASVKSLIDWHTAEWEAKPVGFVSYGGRSGGLRA
FMNR_SCHPO      -----------------KIAGADGFVFVTPQYNGGYPAILKNALDHLYHEWNGKPLLIVSYGGHGGG---
LOT6_YEAST      ----------------------DIIVFVTPQYNWGYPAALKNAIDRLYHEWHGKPALVVSYGGH-GGSKC
NQR_ARATH       ----------VVEAFRQKILEADSILFASPEYNFSVSAPLKNALDWASRPWADKPAAIISTXXXXXXXRS
NQR1_ORYSJ      -----------------KVRQADCFLFGSPEYNYSIATPLKNALDWASRGWADKPAAIVSAXXXXXXXRS
YIEF_SHIFL      DVQQEEGFPATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSQPLAGKPVLITSSMGVIGGARC
YIEF_ECOLI      DVQQEEGFPATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSQPLAGKPVLITSSMGVIGGARC
YIEF_ECO57      DVQQEEGFPATVEALAEQIRQADGVVIVTPEYNYSVPGGLKNAIDWLSQPLAGKPVLITSSMGVIGGARC
NQR2_ORYSJ      ------------------VRAADCFLFASPEYNYSISGPLKNALDWGSRPWADRXXXXXXXXXXXXXXRS
NQR_SOLTU       ----------VVEAFRKKIEEADCFLFASPEYNYSITGPLKNAIDWASRPWADKAAAMVSAXXXXXXXRS
AZO1_STAS1      -----------LQTLKTKAREADFFVLGSPNYHGSYSGILKNALDHLTMDFKMKPVGLI---GNSGGIVS
Y342_MYCGE      -----------IKTLVRKIKEHSNLIFVTPEHNGFIPAFAKNIIDWMTRDEQYGRNQFLKTPATAGGGKT
Y517_MYCPN      -----------IKSLVRKLHDHKTLIFVTPEHNGFVPAFAKNTIDWMTRDTQYGKNQFVTPAAKSGGKTV
HEMH_XANAC      ---------KTLDRLRARGIKRIVVLPLYPQYSTTTTASIQDVVDWRTSAPEIAVEVIQDYCEDTGWVAA
AZOR_MACCJ      -----------LNELSDEFAAADKYIFVTPMWNLSFPAVVKAYID-------------------------
AZOR3_PSEAE     ------------NRLTEELRMADVLVLAAPMYNFAIPSSLKSWFD-------------------------
AZO1_STAHJ      FSGTTPSIDEIKTNIKDKVMAADFLVLGTPNYHGSYSGILKNALDHINMDYKMKPVGLI---GNSGGIVS
AZO1_STAAW      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS
AZO1_STAAU      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS
AZO1_STAAS      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS
AZO1_STAAR      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS
AZO1_STAAN      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS
AZO1_STAAM      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS
AZO1_STAAC      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS
AZO1_STAAB      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS
AZO1_STAA8      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS
AZO1_STAA3      ---------QNMKDLKEKAMAADFLILGTPNYHGSYSGILKNALDHLNMDYKMKPVGLI---GNSGGIVS


                         +         .         .         .         .         *         .:210
query           VEHLGQVFTELHAVTVRNTVSFHSVEEQFDSEGRPKSPEACAVAAQNLLDQLVWWGRALRRARxxxxxxx
FMNR_SCHPO      ----------------------------------------------------------------------
LOT6_YEAST      NDQLQEV---------------------------------------------------------------
NQR_ARATH       QYHLRQVFLDLHFINKPETLNAFQPPQKFDAEG-------------------------------------
NQR1_ORYSJ      QYHLRQVFLDLHFINKPEAVKAFEQPPKFDSDG-------------------------------------
YIEF_SHIFL      QYHLRQILVFLDAM-VMNKPEFMGIQNKVD-------PQTGEVIDQGTLDQLTAFGEFIQRVK-------
YIEF_ECOLI      QYHLRQILVFLDAM-VMNKPEFMGIQNKVD-------PQTGEVIDQGTLDQLTAFGEFIQRVK-------
YIEF_ECO57      QYHLRQILVFLDAM-VMNKPEFMGIQNKVD-------PQTGEVIDQGTLDQLTAFGEFIQRVK-------
NQR2_ORYSJ      MYHIRQVFLDIHFINKPEVIKAHQPPKKFDSDGNLIDPE-------------------------------
NQR_SOLTU       QYHLRQVFLDLHFINKPEFLNAFQQPPKFDSDG-------------------------------------
AZO1_STAS1      SEHLRLIVRSLLGIAVPTQIATHDTDKKLDDGTYYLANEEFQLRARLFVDQII-----------------
Y342_MYCGE      VLELLDKFLSFSGLNVKGTVLVNGYHENFD----------------------------------------
Y517_MYCPN      LELLTKFFS-FSGLNVKGAVLVNGYHDGFD----------------------------------------
HEMH_XANAC      IAESIRAHWQVHGRSEKLMFSFHGLPQRVADAGDP-YPQQCERSAQAIVAAL------------------
AZOR_MACCJ      ----------------------------------------------------------------------
AZOR3_PSEAE     ----------------------------------------------------------------------
AZO1_STAHJ      SEHLRVIVRSLLGIAVPTQIATHDSDSKLDDGTLYLDDDQFQLRAKLFVDQIV-----------------
AZO1_STAAW      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------
AZO1_STAAU      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------
AZO1_STAAS      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------
AZO1_STAAR      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------
AZO1_STAAN      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------
AZO1_STAAM      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------
AZO1_STAAC      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------
AZO1_STAAB      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------
AZO1_STAA8      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------
AZO1_STAA3      SEHLRVIVRSLLGIAVPTQIATHDSDFAKNEDG-------------------------------------


                         .         .         .         +         .         .         .:280
query           xxxxxxxxxxxxxxxxx
FMNR_SCHPO      -----------------
LOT6_YEAST      -----------------
NQR_ARATH       -----------------
NQR1_ORYSJ      -----------------
YIEF_SHIFL      -----------------
YIEF_ECOLI      -----------------
YIEF_ECO57      -----------------
NQR2_ORYSJ      -----------------
NQR_SOLTU       -----------------
AZO1_STAS1      -----------------
Y342_MYCGE      -----------------
Y517_MYCPN      -----------------
HEMH_XANAC      -----------------
AZOR_MACCJ      -----------------
AZOR3_PSEAE     -----------------
AZO1_STAHJ      -----------------
AZO1_STAAW      -----------------
AZO1_STAAU      -----------------
AZO1_STAAS      -----------------
AZO1_STAAR      -----------------
AZO1_STAAN      -----------------
AZO1_STAAM      -----------------
AZO1_STAAC      -----------------
AZO1_STAAB      -----------------
AZO1_STAA8      -----------------
AZO1_STAA3      -----------------